3KRFB

Mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, ipp, and dmaspp (i)
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
259
structure length
259
Chain Sequence
MQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLTDGSRPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALEELGGFHGKNAELMSSLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyl diphosphate synthase large subunit
publication title Structure of a heterotetrameric geranyl pyrophosphate synthase from mint (Mentha piperita) reveals intersubunit regulation
pubmed doi rcsb
source organism Mentha x piperita
total genus 96
structure length 259
sequence length 259
chains with identical sequence C
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2009-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3krfB00
1YYQA 1UBVA 1VG4A 4Q23A 3IPIA 3UCAA 4K10A 4LA6A 3TS7A 1VG6A 2J5CA 4KQUA 5DHKA 3ICZA 1WKZA 2O1OA 5B0LA 1RTRA 2OPNA 4E9UA 5ILJA 3B7LA 3CKEA 4FJQA 4LPHF 3LVSA 2AZJA 1V4JA 2EWGA 4JZXA 4JXNA 1WL1A 4EA1A 4ZQ8A 4H5CF 3SDRA 5IM1A 4KVWA 4F6VA 4EA2A 3M01A 4GA3A 4RXEA 5ERNA 5JV1F 2E95A 5DJRF 1JFAA 2ZEUA 3LJIA 3ACYA 2F94F 3N46F 3PH7A 3N49F 3WE9A 3WJOA 2ZCQA 1YHLA 3IBAA 4LFEA 3M00A 2PS6A 3ACWA 3V1VA 3KRCA 5ERMA 4KKMA 3P8LA 4P0XA 3KROA 2Q58A 5IN8A 2E94A 3KRPA 1WMWA 1N1BA 4WK5A 4H5DF 3KRFB 5DZ2A 3TC1A 5IMIA 3AQBB 3N1VF 2P1CA 4LIXA 3OABB 2AETA 2OPMA 5EROA 4DEMF 3EFQA 4KQ5A 4DI5A 4RXDA 1N22A 4KWDA 2ZY1A 1N23A 4GP1A 3WJNA 5IK0A 3VJ8A 1VG7A 5C05A 2Z4YA 3ICNA 4LZ3A 5B02A 5B0IA 3KRAA 5DW7A 5AHUB 5IKHA 4LTVA 5B0JA 3WCDA 1UBXA 4KVYA 3MAVA 3Q2ZA 4RXCA 3P8RA 5B0MA 3P41A 3ZMCA 3P5PA 3VJ9A 4PVYF 3W7FA 3DYFA 1WL2A 4NFKF 2AELA 3WC9A 4KVIA 2Z4ZA 2PS7A 2I19A 5ILDA 2AZLA 2Q9YA 3LK5A 5JV2F 3V1XA 5HNAA 3WCHA 3SDVA 2Q9ZA 4DZWA 3S4JA 1WY0A 2E8TA 4JXYA 4F62A 4NFJF 1WL3A 2Z7HA 3V66A 3PYAA 3SDQA 5DGNF 3LZ9A 3M9UA 5IMNA 2Z7IA 3PYBA 4MC0A 5IK6A 2J1OA 3WCMA 5DGMF 2F8CF 2E90A 2E4OA 4NKEA 1V4IA 3SDTA 4GP2A 3WCGA 3OYRA 3ACXA 2E93A 4KPDA 3WCBA 4KQSA 5ILHA 2ZEVA 3MZVA 5ILYA 3Q2QA 3PDEA 5A0IA 3LSNA 2E8UA 5DJPF 2PS5A 5AELA 4NFIF 1YJ4A 4LUUA 4EA0A 1DGPA 1V4HA 5EATA 3N3LF 3QQVA 3SDUA 5B00A 3WEKA 5IVGA 4LFGA 3Q1OA 5B0KA 4LLSA 4KK2A 2PS4A 4LFVF 2ZCOA 3N0GA 1YQ7A 3KRCB 1VG3A 3EZ3A 3TFPA 3N45F 1KIZA 1HM4A 4KVDA 3EGTA 3KROB 3LEEA 2F7MF 1YYRA 2QISA 3WCLA 3ID0A 3KRFA 3TFNA 2H8OA 3OABA 2ZCSA 3WCFA 1RQIA 5E8HA 3SAEA 4RNQA 4OGUA 4DXJA 2E8XA 3N3DA 2Q80A 4PVXF 4DHDA 5I1UA 1YYSA 4LPGF 3M0GA 3WJKA 4E9ZA 3CP6A 3Q30A 1JFGA 2Z4VA 3WCJA 3CC9A 1V4KA 1RQJA 3N5JF 4LXWA 1PS1A 3DYGA 5EAUA 1N1ZA 2Z52A 3OACA 5CG6A 2F8ZF 3RMGA 2AZKA 2Z78A 4JVJF 4P0VA 3VJEA 1DI1A 5AYPA 4F6XA 3NPRA 5IMPA 3WCIA 2OA6A 2F92F 4N9UA 5IK9A 4LTZA 4LZCA 1YV5A 3WCAA 2E91A 2FTZA 2Z50A 2E8WA 4DWGA 4XQTF 4L2XF 4OKMA 3VJAA 3NRIA 3M02A 5DHIA 1YYUA 5IKAA 4UMJA 5DGSF 5JUZF 4QPFA 5DJVF 4GAXA 2DH4A 1ZW5A 3N1WF 3QKCA 3S9VA 4RYPA 1KIYA 3ASXA 4DWBA 3G4FA 4XQSF 3NF2A 5HN9A 2F89F 1YYTA 1HM7A 3APZA 5A0KA 5ILKA 1YHKA 4N1ZF 1V4EA 5JV0F 4XQRF 3LGKA 1FPSA 1N20A 2E92A 2Z4WA 4OMGA 2FORA 4MC3A 4JYXA 5IL8A 3AQCB 3AQ0A 2F9KF 5HN7A 4NUAA 5E8KA 3BNYA 3LLWA 3PKOA 3BNXA 5KSXF 1VG2A 3KBKA 2J1PA 2VF6A 4FP4A 3KRPB 2OGDA 3WEFA 3ZMBA 5ER8A 3P5RA 3ICMA 4KPJA 3ZOUA 3WCCA 3LGZB 3N5HF 5H9DA 3LDWA 4JZBA 3RYWA 3ADZA 4HD1A 3KB9A 1HXCA 5IL3A 4NKFA 4KFAA 1UBWA 3WCEA 3WSAA 4LOBA 4KUXA 3WEJA 5AFXA 3RBMA 5DIQF 1N21A 4MC8A 3WSBA 4LLTA 5ILIA 3N0FA 3AE0A 1N24A 3KRAB 2AEKA 5A0JA 4H5EF 2ONHA 1WL0A 5CG5A 5EASA 3WEGA 2PS8A 2E8VA 3TFVA 2ZCRA 5JA0F 1YHMA 5E8LA 4OMHA 3VJCA 2ONGA 4OKZA 4LZ0A 3VJDA 5B01A 3N6KF 4NG6A 5B03A 1UBYA 3NPKA 3OACB 1HXAA 3ICKA 4P0WA 3DYHA 3WEIA 3VJBA 2Z4XA 4LA5A 4QXSF 3ZL6A 3LG5A 3WEHA 3RYEA 4RXAA 3G4DA 5HN8A 3LMDA 1EZFA 1HXGA 5ILZA 4E1EA 3ZCDA 2RAHA 1HX9A 3LOMA
chains in the Genus database with same CATH superfamily
1YYQA 1UBVA 1VG4A 4Q23A 3IPIA 3UCAA 4K10A 4LA6A 3TS7A 1VG6A 2J5CA 4KQUA 5DHKA 3ICZA 1WKZA 2O1OA 5B0LA 1RTRA 2OPNA 4E9UA 5ILJA 3B7LA 3CKEA 4FJQA 4LPHF 3LVSA 2AZJA 1V4JA 2EWGA 4JZXA 4JXNA 1WL1A 4EA1A 4ZQ8A 4H5CF 3SDRA 5IM1A 4KVWA 4F6VA 4EA2A 3M01A 4GA3A 4RXEA 5ERNA 5JV1F 2E95A 5DJRF 1JFAA 2ZEUA 3LJIA 3ACYA 2F94F 3N46F 3PH7A 3N49F 3WE9A 3WJOA 2ZCQA 1YHLA 3IBAA 4LFEA 3M00A 2PS6A 3ACWA 3V1VA 3KRCA 5ERMA 4KKMA 3P8LA 4P0XA 3KROA 2Q58A 5IN8A 2E94A 3KRPA 1WMWA 1N1BA 4WK5A 4H5DF 3KRFB 5DZ2A 3TC1A 5IMIA 3AQBB 3N1VF 2P1CA 4LIXA 3OABB 2AETA 2OPMA 5EROA 4DEMF 3EFQA 4KQ5A 4DI5A 4RXDA 1N22A 4KWDA 2ZY1A 1N23A 4GP1A 3WJNA 5IK0A 3VJ8A 1VG7A 5C05A 2Z4YA 3ICNA 4LZ3A 5B02A 5B0IA 3KRAA 5DW7A 5AHUB 5IKHA 4LTVA 5B0JA 3WCDA 1UBXA 4KVYA 3MAVA 3Q2ZA 4RXCA 3P8RA 5B0MA 3P41A 3ZMCA 3P5PA 3VJ9A 4PVYF 3W7FA 3DYFA 1WL2A 4NFKF 2AELA 3WC9A 4KVIA 2Z4ZA 2PS7A 2I19A 5ILDA 2AZLA 2Q9YA 3LK5A 5JV2F 3V1XA 5HNAA 3WCHA 3SDVA 2Q9ZA 4DZWA 3S4JA 1WY0A 2E8TA 4JXYA 4F62A 4NFJF 1WL3A 2Z7HA 3V66A 3PYAA 3SDQA 5DGNF 3LZ9A 3M9UA 5IMNA 2Z7IA 3PYBA 4MC0A 5IK6A 2J1OA 3WCMA 5DGMF 2F8CF 2E90A 2E4OA 4NKEA 1V4IA 3SDTA 4GP2A 3WCGA 3OYRA 3ACXA 2E93A 4KPDA 3WCBA 4KQSA 5ILHA 2ZEVA 3MZVA 5ILYA 3Q2QA 3PDEA 5A0IA 3LSNA 2E8UA 5DJPF 2PS5A 5AELA 4NFIF 1YJ4A 4LUUA 4EA0A 1DGPA 1V4HA 5EATA 3N3LF 3QQVA 3SDUA 5B00A 3WEKA 5IVGA 4LFGA 3Q1OA 5B0KA 4LLSA 4KK2A 2PS4A 4LFVF 2ZCOA 3N0GA 1YQ7A 3KRCB 1VG3A 3EZ3A 3TFPA 3N45F 1KIZA 1HM4A 4KVDA 3EGTA 3KROB 3LEEA 2F7MF 1YYRA 2QISA 3WCLA 3ID0A 3KRFA 3TFNA 2H8OA 3OABA 2ZCSA 3WCFA 1RQIA 5E8HA 3SAEA 4RNQA 4OGUA 4DXJA 2E8XA 3N3DA 2Q80A 4PVXF 4DHDA 5I1UA 1YYSA 4LPGF 3M0GA 3WJKA 4E9ZA 3CP6A 3Q30A 1JFGA 2Z4VA 3WCJA 3CC9A 1V4KA 1RQJA 3N5JF 4LXWA 1PS1A 3DYGA 5EAUA 1N1ZA 2Z52A 3OACA 5CG6A 2F8ZF 3RMGA 2AZKA 2Z78A 4JVJF 4P0VA 3VJEA 1DI1A 5AYPA 4F6XA 3NPRA 5IMPA 3WCIA 2OA6A 2F92F 4N9UA 5IK9A 4LTZA 4LZCA 1YV5A 3WCAA 2E91A 2FTZA 2Z50A 2E8WA 4DWGA 4XQTF 4L2XF 4OKMA 3VJAA 3NRIA 3M02A 5DHIA 1YYUA 5IKAA 4UMJA 5DGSF 5JUZF 4QPFA 5DJVF 4GAXA 2DH4A 1ZW5A 3N1WF 3QKCA 3S9VA 4RYPA 1KIYA 3ASXA 4DWBA 3G4FA 4XQSF 3NF2A 5HN9A 2F89F 1YYTA 1HM7A 3APZA 5A0KA 5ILKA 1YHKA 4N1ZF 1V4EA 5JV0F 4XQRF 3LGKA 1FPSA 1N20A 2E92A 2Z4WA 4OMGA 2FORA 4MC3A 4JYXA 5IL8A 3AQCB 3AQ0A 2F9KF 5HN7A 4NUAA 5E8KA 3BNYA 3LLWA 3PKOA 3BNXA 5KSXF 1VG2A 3KBKA 2J1PA 2VF6A 4FP4A 3KRPB 2OGDA 3WEFA 3ZMBA 5ER8A 3P5RA 3ICMA 4KPJA 3ZOUA 3WCCA 3LGZB 3N5HF 5H9DA 3LDWA 4JZBA 3RYWA 3ADZA 4HD1A 3KB9A 1HXCA 5IL3A 4NKFA 4KFAA 1UBWA 3WCEA 3WSAA 4LOBA 4KUXA 3WEJA 5AFXA 3RBMA 5DIQF 1N21A 4MC8A 3WSBA 4LLTA 5ILIA 3N0FA 3AE0A 1N24A 3KRAB 2AEKA 5A0JA 4H5EF 2ONHA 1WL0A 5CG5A 5EASA 3WEGA 2PS8A 2E8VA 3TFVA 2ZCRA 5JA0F 1YHMA 5E8LA 4OMHA 3VJCA 2ONGA 4OKZA 4LZ0A 3VJDA 5B01A 3N6KF 4NG6A 5B03A 1UBYA 3NPKA 3OACB 1HXAA 3ICKA 4P0WA 3DYHA 3WEIA 3VJBA 2Z4XA 4LA5A 4QXSF 3ZL6A 3LG5A 3WEHA 3RYEA 4RXAA 3G4DA 5HN8A 3LMDA 1EZFA 1HXGA 5ILZA 4E1EA 3ZCDA 2RAHA 1HX9A 3LOMA
chains in the Genus database with same CATH topology
1YYQA 1UBVA 1VG4A 4Q23A 3IPIA 3UCAA 4K10A 4LA6A 3TS7A 1VG6A 2J5CA 4KQUA 5DHKA 3ICZA 1WKZA 2O1OA 5B0LA 1RTRA 2OPNA 4E9UA 5ILJA 3B7LA 3CKEA 4FJQA 4LPHF 3LVSA 2AZJA 1V4JA 2EWGA 4JZXA 4JXNA 1WL1A 4EA1A 4ZQ8A 4H5CF 3SDRA 5IM1A 4KVWA 4F6VA 4EA2A 3M01A 4GA3A 4RXEA 5ERNA 5JV1F 2E95A 5DJRF 1JFAA 2ZEUA 3LJIA 3ACYA 2F94F 3N46F 3PH7A 3N49F 3WE9A 3WJOA 2ZCQA 1YHLA 3IBAA 4LFEA 3M00A 2PS6A 3ACWA 3V1VA 3KRCA 5ERMA 4KKMA 3P8LA 4P0XA 3KROA 2Q58A 5IN8A 2E94A 3KRPA 1WMWA 1N1BA 4WK5A 4H5DF 3KRFB 5DZ2A 3TC1A 5IMIA 3AQBB 3N1VF 2P1CA 4LIXA 3OABB 2AETA 2OPMA 5EROA 4DEMF 3EFQA 4KQ5A 4DI5A 4RXDA 1N22A 4KWDA 2ZY1A 1N23A 4GP1A 3WJNA 5IK0A 3VJ8A 1VG7A 5C05A 2Z4YA 3ICNA 4LZ3A 5B02A 5B0IA 3KRAA 5DW7A 5AHUB 5IKHA 4LTVA 5B0JA 3WCDA 1UBXA 4KVYA 3MAVA 3Q2ZA 4RXCA 3P8RA 5B0MA 3P41A 3ZMCA 3P5PA 3VJ9A 4PVYF 3W7FA 3DYFA 1WL2A 4NFKF 2AELA 3WC9A 4KVIA 2Z4ZA 2PS7A 2I19A 5ILDA 2AZLA 2Q9YA 3LK5A 5JV2F 3V1XA 5HNAA 3WCHA 3SDVA 2Q9ZA 4DZWA 3S4JA 1WY0A 2E8TA 4JXYA 4F62A 4NFJF 1WL3A 2Z7HA 3V66A 3PYAA 3SDQA 5DGNF 3LZ9A 3M9UA 5IMNA 2Z7IA 3PYBA 4MC0A 5IK6A 2J1OA 3WCMA 5DGMF 2F8CF 2E90A 2E4OA 4NKEA 1V4IA 3SDTA 4GP2A 3WCGA 3OYRA 3ACXA 2E93A 4KPDA 3WCBA 4KQSA 5ILHA 2ZEVA 3MZVA 5ILYA 3Q2QA 3PDEA 5A0IA 3LSNA 2E8UA 5DJPF 2PS5A 5AELA 4NFIF 1YJ4A 4LUUA 4EA0A 1DGPA 1V4HA 5EATA 3N3LF 3QQVA 3SDUA 5B00A 3WEKA 5IVGA 4LFGA 3Q1OA 5B0KA 4LLSA 4KK2A 2PS4A 4LFVF 2ZCOA 3N0GA 1YQ7A 3KRCB 1VG3A 3EZ3A 3TFPA 3N45F 1KIZA 1HM4A 4KVDA 3EGTA 3KROB 3LEEA 2F7MF 1YYRA 2QISA 3WCLA 3ID0A 3KRFA 3TFNA 2H8OA 3OABA 2ZCSA 3WCFA 1RQIA 5E8HA 3SAEA 4RNQA 4OGUA 4DXJA 2E8XA 3N3DA 2Q80A 4PVXF 4DHDA 5I1UA 1YYSA 4LPGF 3M0GA 3WJKA 4E9ZA 3CP6A 3Q30A 1JFGA 2Z4VA 3WCJA 3CC9A 1V4KA 1RQJA 3N5JF 4LXWA 1PS1A 3DYGA 5EAUA 1N1ZA 2Z52A 3OACA 5CG6A 2F8ZF 3RMGA 2AZKA 2Z78A 4JVJF 4P0VA 3VJEA 1DI1A 5AYPA 4F6XA 3NPRA 5IMPA 3WCIA 2OA6A 2F92F 4N9UA 5IK9A 4LTZA 4LZCA 1YV5A 3WCAA 2E91A 2FTZA 2Z50A 2E8WA 4DWGA 4XQTF 4L2XF 4OKMA 3VJAA 3NRIA 3M02A 5DHIA 1YYUA 5IKAA 4UMJA 5DGSF 5JUZF 4QPFA 5DJVF 4GAXA 2DH4A 1ZW5A 3N1WF 3QKCA 3S9VA 4RYPA 1KIYA 3ASXA 4DWBA 3G4FA 4XQSF 3NF2A 5HN9A 2F89F 1YYTA 1HM7A 3APZA 5A0KA 5ILKA 1YHKA 4N1ZF 1V4EA 5JV0F 4XQRF 3LGKA 1FPSA 1N20A 2E92A 2Z4WA 4OMGA 2FORA 4MC3A 4JYXA 5IL8A 3AQCB 3AQ0A 2F9KF 5HN7A 4NUAA 5E8KA 3BNYA 3LLWA 3PKOA 3BNXA 5KSXF 1VG2A 3KBKA 2J1PA 2VF6A 4FP4A 3KRPB 2OGDA 3WEFA 3ZMBA 5ER8A 3P5RA 3ICMA 4KPJA 3ZOUA 3WCCA 3LGZB 3N5HF 5H9DA 3LDWA 4JZBA 3RYWA 3ADZA 4HD1A 3KB9A 1HXCA 5IL3A 4NKFA 4KFAA 1UBWA 3WCEA 3WSAA 4LOBA 4KUXA 3WEJA 5AFXA 3RBMA 5DIQF 1N21A 4MC8A 3WSBA 4LLTA 5ILIA 3N0FA 3AE0A 1N24A 3KRAB 2AEKA 5A0JA 4H5EF 2ONHA 1WL0A 5CG5A 5EASA 3WEGA 2PS8A 2E8VA 3TFVA 2ZCRA 5JA0F 1YHMA 5E8LA 4OMHA 3VJCA 2ONGA 4OKZA 4LZ0A 3VJDA 5B01A 3N6KF 4NG6A 5B03A 1UBYA 3NPKA 3OACB 1HXAA 3ICKA 4P0WA 3DYHA 3WEIA 3VJBA 2Z4XA 4LA5A 4QXSF 3ZL6A 3LG5A 3WEHA 3RYEA 4RXAA 3G4DA 5HN8A 3LMDA 1EZFA 1HXGA 5ILZA 4E1EA 3ZCDA 2RAHA 1HX9A 3LOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YYQ A;  1UBV A;  1VG4 A;  4Q23 A;  3IPI A;  3UCA A;  4K10 A;  4LA6 A;  3TS7 A;  1VG6 A;  2J5C A;  4KQU A;  5DHK A;  3ICZ A;  1WKZ A;  2O1O A;  5B0L A;  1RTR A;  2OPN A;  4E9U A;  5ILJ A;  3B7L A;  3CKE A;  4FJQ A;  4LPH F;  3LVS A;  2AZJ A;  1V4J A;  2EWG A;  4JZX A;  4JXN A;  1WL1 A;  4EA1 A;  4ZQ8 A;  4H5C F;  3SDR A;  5IM1 A;  4KVW A;  4F6V A;  4EA2 A;  3M01 A;  4GA3 A;  4RXE A;  5ERN A;  5JV1 F;  2E95 A;  5DJR F;  1JFA A;  2ZEU A;  3LJI A;  3ACY A;  2F94 F;  3N46 F;  3PH7 A;  3N49 F;  3WE9 A;  3WJO A;  2ZCQ A;  1YHL A;  3IBA A;  4LFE A;  3M00 A;  2PS6 A;  3ACW A;  3V1V A;  3KRC A;  5ERM A;  4KKM A;  3P8L A;  4P0X A;  3KRO A;  2Q58 A;  5IN8 A;  2E94 A;  3KRP A;  1WMW A;  1N1B A;  4WK5 A;  4H5D F;  3KRF B;  5DZ2 A;  3TC1 A;  5IMI A;  3AQB B;  3N1V F;  2P1C A;  4LIX A;  3OAB B;  2AET A;  2OPM A;  5ERO A;  4DEM F;  3EFQ A;  4KQ5 A;  4DI5 A;  4RXD A;  1N22 A;  4KWD A;  2ZY1 A;  1N23 A;  4GP1 A;  3WJN A;  5IK0 A;  3VJ8 A;  1VG7 A;  5C05 A;  2Z4Y A;  3ICN A;  4LZ3 A;  5B02 A;  5B0I A;  3KRA A;  5DW7 A;  5AHU B;  5IKH A;  4LTV A;  5B0J A;  3WCD A;  1UBX A;  4KVY A;  3MAV A;  3Q2Z A;  4RXC A;  3P8R A;  5B0M A;  3P41 A;  3ZMC A;  3P5P A;  3VJ9 A;  4PVY F;  3W7F A;  3DYF A;  1WL2 A;  4NFK F;  2AEL A;  3WC9 A;  4KVI A;  2Z4Z A;  2PS7 A;  2I19 A;  5ILD A;  2AZL A;  2Q9Y A;  3LK5 A;  5JV2 F;  3V1X A;  5HNA A;  3WCH A;  3SDV A;  2Q9Z A;  4DZW A;  3S4J A;  1WY0 A;  2E8T A;  4JXY A;  4F62 A;  4NFJ F;  1WL3 A;  2Z7H A;  3V66 A;  3PYA A;  3SDQ A;  5DGN F;  3LZ9 A;  3M9U A;  5IMN A;  2Z7I A;  3PYB A;  4MC0 A;  5IK6 A;  2J1O A;  3WCM A;  5DGM F;  2F8C F;  2E90 A;  2E4O A;  4NKE A;  1V4I A;  3SDT A;  4GP2 A;  3WCG A;  3OYR A;  3ACX A;  2E93 A;  4KPD A;  3WCB A;  4KQS A;  5ILH A;  2ZEV A;  3MZV A;  5ILY A;  3Q2Q A;  3PDE A;  5A0I A;  3LSN A;  2E8U A;  5DJP F;  2PS5 A;  5AEL A;  4NFI F;  1YJ4 A;  4LUU A;  4EA0 A;  1DGP A;  1V4H A;  5EAT A;  3N3L F;  3QQV A;  3SDU A;  5B00 A;  3WEK A;  5IVG A;  4LFG A;  3Q1O A;  5B0K A;  4LLS A;  4KK2 A;  2PS4 A;  4LFV F;  2ZCO A;  3N0G A;  1YQ7 A;  3KRC B;  1VG3 A;  3EZ3 A;  3TFP A;  3N45 F;  1KIZ A;  1HM4 A;  4KVD A;  3EGT A;  3KRO B;  3LEE A;  2F7M F;  1YYR A;  2QIS A;  3WCL A;  3ID0 A;  3KRF A;  3TFN A;  2H8O A;  3OAB A;  2ZCS A;  3WCF A;  1RQI A;  5E8H A;  3SAE A;  4RNQ A;  4OGU A;  4DXJ A;  2E8X A;  3N3D A;  2Q80 A;  4PVX F;  4DHD A;  5I1U A;  1YYS A;  4LPG F;  3M0G A;  3WJK A;  4E9Z A;  3CP6 A;  3Q30 A;  1JFG A;  2Z4V A;  3WCJ A;  3CC9 A;  1V4K A;  1RQJ A;  3N5J F;  4LXW A;  1PS1 A;  3DYG A;  5EAU A;  1N1Z A;  2Z52 A;  3OAC A;  5CG6 A;  2F8Z F;  3RMG A;  2AZK A;  2Z78 A;  4JVJ F;  4P0V A;  3VJE A;  1DI1 A;  5AYP A;  4F6X A;  3NPR A;  5IMP A;  3WCI A;  2OA6 A;  2F92 F;  4N9U A;  5IK9 A;  4LTZ A;  4LZC A;  1YV5 A;  3WCA A;  2E91 A;  2FTZ A;  2Z50 A;  2E8W A;  4DWG A;  4XQT F;  4L2X F;  4OKM A;  3VJA A;  3NRI A;  3M02 A;  5DHI A;  1YYU A;  5IKA A;  4UMJ A;  5DGS F;  5JUZ F;  4QPF A;  5DJV F;  4GAX A;  2DH4 A;  1ZW5 A;  3N1W F;  3QKC A;  3S9V A;  4RYP A;  1KIY A;  3ASX A;  4DWB A;  3G4F A;  4XQS F;  3NF2 A;  5HN9 A;  2F89 F;  1YYT A;  1HM7 A;  3APZ A;  5A0K A;  5ILK A;  1YHK A;  4N1Z F;  1V4E A;  5JV0 F;  4XQR F;  3LGK A;  1FPS A;  1N20 A;  2E92 A;  2Z4W A;  4OMG A;  2FOR A;  4MC3 A;  4JYX A;  5IL8 A;  3AQC B;  3AQ0 A;  2F9K F;  5HN7 A;  4NUA A;  5E8K A;  3BNY A;  3LLW A;  3PKO A;  3BNX A;  5KSX F;  1VG2 A;  3KBK A;  2J1P A;  2VF6 A;  4FP4 A;  3KRP B;  2OGD A;  3WEF A;  3ZMB A;  5ER8 A;  3P5R A;  3ICM A;  4KPJ A;  3ZOU A;  3WCC A;  3LGZ B;  3N5H F;  5H9D A;  3LDW A;  4JZB A;  3RYW A;  3ADZ A;  4HD1 A;  3KB9 A;  1HXC A;  5IL3 A;  4NKF A;  4KFA A;  1UBW A;  3WCE A;  3WSA A;  4LOB A;  4KUX A;  3WEJ A;  5AFX A;  3RBM A;  5DIQ F;  1N21 A;  4MC8 A;  3WSB A;  4LLT A;  5ILI A;  3N0F A;  3AE0 A;  1N24 A;  3KRA B;  2AEK A;  5A0J A;  4H5E F;  2ONH A;  1WL0 A;  5CG5 A;  5EAS A;  3WEG A;  2PS8 A;  2E8V A;  3TFV A;  2ZCR A;  5JA0 F;  1YHM A;  5E8L A;  4OMH A;  3VJC A;  2ONG A;  4OKZ A;  4LZ0 A;  3VJD A;  5B01 A;  3N6K F;  4NG6 A;  5B03 A;  1UBY A;  3NPK A;  3OAC B;  1HXA A;  3ICK A;  4P0W A;  3DYH A;  3WEI A;  3VJB A;  2Z4X A;  4LA5 A;  4QXS F;  3ZL6 A;  3LG5 A;  3WEH A;  3RYE A;  4RXA A;  3G4D A;  5HN8 A;  3LMD A;  1EZF A;  1HXG A;  5ILZ A;  4E1E A;  3ZCD A;  2RAH A;  1HX9 A;  3LOM A; 
#chains in the Genus database with same CATH topology
 1YYQ A;  1UBV A;  1VG4 A;  4Q23 A;  3IPI A;  3UCA A;  4K10 A;  4LA6 A;  3TS7 A;  1VG6 A;  2J5C A;  4KQU A;  5DHK A;  3ICZ A;  1WKZ A;  2O1O A;  5B0L A;  1RTR A;  2OPN A;  4E9U A;  5ILJ A;  3B7L A;  3CKE A;  4FJQ A;  4LPH F;  3LVS A;  2AZJ A;  1V4J A;  2EWG A;  4JZX A;  4JXN A;  1WL1 A;  4EA1 A;  4ZQ8 A;  4H5C F;  3SDR A;  5IM1 A;  4KVW A;  4F6V A;  4EA2 A;  3M01 A;  4GA3 A;  4RXE A;  5ERN A;  5JV1 F;  2E95 A;  5DJR F;  1JFA A;  2ZEU A;  3LJI A;  3ACY A;  2F94 F;  3N46 F;  3PH7 A;  3N49 F;  3WE9 A;  3WJO A;  2ZCQ A;  1YHL A;  3IBA A;  4LFE A;  3M00 A;  2PS6 A;  3ACW A;  3V1V A;  3KRC A;  5ERM A;  4KKM A;  3P8L A;  4P0X A;  3KRO A;  2Q58 A;  5IN8 A;  2E94 A;  3KRP A;  1WMW A;  1N1B A;  4WK5 A;  4H5D F;  3KRF B;  5DZ2 A;  3TC1 A;  5IMI A;  3AQB B;  3N1V F;  2P1C A;  4LIX A;  3OAB B;  2AET A;  2OPM A;  5ERO A;  4DEM F;  3EFQ A;  4KQ5 A;  4DI5 A;  4RXD A;  1N22 A;  4KWD A;  2ZY1 A;  1N23 A;  4GP1 A;  3WJN A;  5IK0 A;  3VJ8 A;  1VG7 A;  5C05 A;  2Z4Y A;  3ICN A;  4LZ3 A;  5B02 A;  5B0I A;  3KRA A;  5DW7 A;  5AHU B;  5IKH A;  4LTV A;  5B0J A;  3WCD A;  1UBX A;  4KVY A;  3MAV A;  3Q2Z A;  4RXC A;  3P8R A;  5B0M A;  3P41 A;  3ZMC A;  3P5P A;  3VJ9 A;  4PVY F;  3W7F A;  3DYF A;  1WL2 A;  4NFK F;  2AEL A;  3WC9 A;  4KVI A;  2Z4Z A;  2PS7 A;  2I19 A;  5ILD A;  2AZL A;  2Q9Y A;  3LK5 A;  5JV2 F;  3V1X A;  5HNA A;  3WCH A;  3SDV A;  2Q9Z A;  4DZW A;  3S4J A;  1WY0 A;  2E8T A;  4JXY A;  4F62 A;  4NFJ F;  1WL3 A;  2Z7H A;  3V66 A;  3PYA A;  3SDQ A;  5DGN F;  3LZ9 A;  3M9U A;  5IMN A;  2Z7I A;  3PYB A;  4MC0 A;  5IK6 A;  2J1O A;  3WCM A;  5DGM F;  2F8C F;  2E90 A;  2E4O A;  4NKE A;  1V4I A;  3SDT A;  4GP2 A;  3WCG A;  3OYR A;  3ACX A;  2E93 A;  4KPD A;  3WCB A;  4KQS A;  5ILH A;  2ZEV A;  3MZV A;  5ILY A;  3Q2Q A;  3PDE A;  5A0I A;  3LSN A;  2E8U A;  5DJP F;  2PS5 A;  5AEL A;  4NFI F;  1YJ4 A;  4LUU A;  4EA0 A;  1DGP A;  1V4H A;  5EAT A;  3N3L F;  3QQV A;  3SDU A;  5B00 A;  3WEK A;  5IVG A;  4LFG A;  3Q1O A;  5B0K A;  4LLS A;  4KK2 A;  2PS4 A;  4LFV F;  2ZCO A;  3N0G A;  1YQ7 A;  3KRC B;  1VG3 A;  3EZ3 A;  3TFP A;  3N45 F;  1KIZ A;  1HM4 A;  4KVD A;  3EGT A;  3KRO B;  3LEE A;  2F7M F;  1YYR A;  2QIS A;  3WCL A;  3ID0 A;  3KRF A;  3TFN A;  2H8O A;  3OAB A;  2ZCS A;  3WCF A;  1RQI A;  5E8H A;  3SAE A;  4RNQ A;  4OGU A;  4DXJ A;  2E8X A;  3N3D A;  2Q80 A;  4PVX F;  4DHD A;  5I1U A;  1YYS A;  4LPG F;  3M0G A;  3WJK A;  4E9Z A;  3CP6 A;  3Q30 A;  1JFG A;  2Z4V A;  3WCJ A;  3CC9 A;  1V4K A;  1RQJ A;  3N5J F;  4LXW A;  1PS1 A;  3DYG A;  5EAU A;  1N1Z A;  2Z52 A;  3OAC A;  5CG6 A;  2F8Z F;  3RMG A;  2AZK A;  2Z78 A;  4JVJ F;  4P0V A;  3VJE A;  1DI1 A;  5AYP A;  4F6X A;  3NPR A;  5IMP A;  3WCI A;  2OA6 A;  2F92 F;  4N9U A;  5IK9 A;  4LTZ A;  4LZC A;  1YV5 A;  3WCA A;  2E91 A;  2FTZ A;  2Z50 A;  2E8W A;  4DWG A;  4XQT F;  4L2X F;  4OKM A;  3VJA A;  3NRI A;  3M02 A;  5DHI A;  1YYU A;  5IKA A;  4UMJ A;  5DGS F;  5JUZ F;  4QPF A;  5DJV F;  4GAX A;  2DH4 A;  1ZW5 A;  3N1W F;  3QKC A;  3S9V A;  4RYP A;  1KIY A;  3ASX A;  4DWB A;  3G4F A;  4XQS F;  3NF2 A;  5HN9 A;  2F89 F;  1YYT A;  1HM7 A;  3APZ A;  5A0K A;  5ILK A;  1YHK A;  4N1Z F;  1V4E A;  5JV0 F;  4XQR F;  3LGK A;  1FPS A;  1N20 A;  2E92 A;  2Z4W A;  4OMG A;  2FOR A;  4MC3 A;  4JYX A;  5IL8 A;  3AQC B;  3AQ0 A;  2F9K F;  5HN7 A;  4NUA A;  5E8K A;  3BNY A;  3LLW A;  3PKO A;  3BNX A;  5KSX F;  1VG2 A;  3KBK A;  2J1P A;  2VF6 A;  4FP4 A;  3KRP B;  2OGD A;  3WEF A;  3ZMB A;  5ER8 A;  3P5R A;  3ICM A;  4KPJ A;  3ZOU A;  3WCC A;  3LGZ B;  3N5H F;  5H9D A;  3LDW A;  4JZB A;  3RYW A;  3ADZ A;  4HD1 A;  3KB9 A;  1HXC A;  5IL3 A;  4NKF A;  4KFA A;  1UBW A;  3WCE A;  3WSA A;  4LOB A;  4KUX A;  3WEJ A;  5AFX A;  3RBM A;  5DIQ F;  1N21 A;  4MC8 A;  3WSB A;  4LLT A;  5ILI A;  3N0F A;  3AE0 A;  1N24 A;  3KRA B;  2AEK A;  5A0J A;  4H5E F;  2ONH A;  1WL0 A;  5CG5 A;  5EAS A;  3WEG A;  2PS8 A;  2E8V A;  3TFV A;  2ZCR A;  5JA0 F;  1YHM A;  5E8L A;  4OMH A;  3VJC A;  2ONG A;  4OKZ A;  4LZ0 A;  3VJD A;  5B01 A;  3N6K F;  4NG6 A;  5B03 A;  1UBY A;  3NPK A;  3OAC B;  1HXA A;  3ICK A;  4P0W A;  3DYH A;  3WEI A;  3VJB A;  2Z4X A;  4LA5 A;  4QXS F;  3ZL6 A;  3LG5 A;  3WEH A;  3RYE A;  4RXA A;  3G4D A;  5HN8 A;  3LMD A;  1EZF A;  1HXG A;  5ILZ A;  4E1E A;  3ZCD A;  2RAH A;  1HX9 A;  3LOM A; 
#chains in the Genus database with same CATH homology
 1YYQ A;  1UBV A;  1VG4 A;  4Q23 A;  3IPI A;  3UCA A;  4K10 A;  4LA6 A;  3TS7 A;  1VG6 A;  2J5C A;  4KQU A;  5DHK A;  3ICZ A;  1WKZ A;  2O1O A;  5B0L A;  1RTR A;  2OPN A;  4E9U A;  5ILJ A;  3B7L A;  3CKE A;  4FJQ A;  4LPH F;  3LVS A;  2AZJ A;  1V4J A;  2EWG A;  4JZX A;  4JXN A;  1WL1 A;  4EA1 A;  4ZQ8 A;  4H5C F;  3SDR A;  5IM1 A;  4KVW A;  4F6V A;  4EA2 A;  3M01 A;  4GA3 A;  4RXE A;  5ERN A;  5JV1 F;  2E95 A;  5DJR F;  1JFA A;  2ZEU A;  3LJI A;  3ACY A;  2F94 F;  3N46 F;  3PH7 A;  3N49 F;  3WE9 A;  3WJO A;  2ZCQ A;  1YHL A;  3IBA A;  4LFE A;  3M00 A;  2PS6 A;  3ACW A;  3V1V A;  3KRC A;  5ERM A;  4KKM A;  3P8L A;  4P0X A;  3KRO A;  2Q58 A;  5IN8 A;  2E94 A;  3KRP A;  1WMW A;  1N1B A;  4WK5 A;  4H5D F;  3KRF B;  5DZ2 A;  3TC1 A;  5IMI A;  3AQB B;  3N1V F;  2P1C A;  4LIX A;  3OAB B;  2AET A;  2OPM A;  5ERO A;  4DEM F;  3EFQ A;  4KQ5 A;  4DI5 A;  4RXD A;  1N22 A;  4KWD A;  2ZY1 A;  1N23 A;  4GP1 A;  3WJN A;  5IK0 A;  3VJ8 A;  1VG7 A;  5C05 A;  2Z4Y A;  3ICN A;  4LZ3 A;  5B02 A;  5B0I A;  3KRA A;  5DW7 A;  5AHU B;  5IKH A;  4LTV A;  5B0J A;  3WCD A;  1UBX A;  4KVY A;  3MAV A;  3Q2Z A;  4RXC A;  3P8R A;  5B0M A;  3P41 A;  3ZMC A;  3P5P A;  3VJ9 A;  4PVY F;  3W7F A;  3DYF A;  1WL2 A;  4NFK F;  2AEL A;  3WC9 A;  4KVI A;  2Z4Z A;  2PS7 A;  2I19 A;  5ILD A;  2AZL A;  2Q9Y A;  3LK5 A;  5JV2 F;  3V1X A;  5HNA A;  3WCH A;  3SDV A;  2Q9Z A;  4DZW A;  3S4J A;  1WY0 A;  2E8T A;  4JXY A;  4F62 A;  4NFJ F;  1WL3 A;  2Z7H A;  3V66 A;  3PYA A;  3SDQ A;  5DGN F;  3LZ9 A;  3M9U A;  5IMN A;  2Z7I A;  3PYB A;  4MC0 A;  5IK6 A;  2J1O A;  3WCM A;  5DGM F;  2F8C F;  2E90 A;  2E4O A;  4NKE A;  1V4I A;  3SDT A;  4GP2 A;  3WCG A;  3OYR A;  3ACX A;  2E93 A;  4KPD A;  3WCB A;  4KQS A;  5ILH A;  2ZEV A;  3MZV A;  5ILY A;  3Q2Q A;  3PDE A;  5A0I A;  3LSN A;  2E8U A;  5DJP F;  2PS5 A;  5AEL A;  4NFI F;  1YJ4 A;  4LUU A;  4EA0 A;  1DGP A;  1V4H A;  5EAT A;  3N3L F;  3QQV A;  3SDU A;  5B00 A;  3WEK A;  5IVG A;  4LFG A;  3Q1O A;  5B0K A;  4LLS A;  4KK2 A;  2PS4 A;  4LFV F;  2ZCO A;  3N0G A;  1YQ7 A;  3KRC B;  1VG3 A;  3EZ3 A;  3TFP A;  3N45 F;  1KIZ A;  1HM4 A;  4KVD A;  3EGT A;  3KRO B;  3LEE A;  2F7M F;  1YYR A;  2QIS A;  3WCL A;  3ID0 A;  3KRF A;  3TFN A;  2H8O A;  3OAB A;  2ZCS A;  3WCF A;  1RQI A;  5E8H A;  3SAE A;  4RNQ A;  4OGU A;  4DXJ A;  2E8X A;  3N3D A;  2Q80 A;  4PVX F;  4DHD A;  5I1U A;  1YYS A;  4LPG F;  3M0G A;  3WJK A;  4E9Z A;  3CP6 A;  3Q30 A;  1JFG A;  2Z4V A;  3WCJ A;  3CC9 A;  1V4K A;  1RQJ A;  3N5J F;  4LXW A;  1PS1 A;  3DYG A;  5EAU A;  1N1Z A;  2Z52 A;  3OAC A;  5CG6 A;  2F8Z F;  3RMG A;  2AZK A;  2Z78 A;  4JVJ F;  4P0V A;  3VJE A;  1DI1 A;  5AYP A;  4F6X A;  3NPR A;  5IMP A;  3WCI A;  2OA6 A;  2F92 F;  4N9U A;  5IK9 A;  4LTZ A;  4LZC A;  1YV5 A;  3WCA A;  2E91 A;  2FTZ A;  2Z50 A;  2E8W A;  4DWG A;  4XQT F;  4L2X F;  4OKM A;  3VJA A;  3NRI A;  3M02 A;  5DHI A;  1YYU A;  5IKA A;  4UMJ A;  5DGS F;  5JUZ F;  4QPF A;  5DJV F;  4GAX A;  2DH4 A;  1ZW5 A;  3N1W F;  3QKC A;  3S9V A;  4RYP A;  1KIY A;  3ASX A;  4DWB A;  3G4F A;  4XQS F;  3NF2 A;  5HN9 A;  2F89 F;  1YYT A;  1HM7 A;  3APZ A;  5A0K A;  5ILK A;  1YHK A;  4N1Z F;  1V4E A;  5JV0 F;  4XQR F;  3LGK A;  1FPS A;  1N20 A;  2E92 A;  2Z4W A;  4OMG A;  2FOR A;  4MC3 A;  4JYX A;  5IL8 A;  3AQC B;  3AQ0 A;  2F9K F;  5HN7 A;  4NUA A;  5E8K A;  3BNY A;  3LLW A;  3PKO A;  3BNX A;  5KSX F;  1VG2 A;  3KBK A;  2J1P A;  2VF6 A;  4FP4 A;  3KRP B;  2OGD A;  3WEF A;  3ZMB A;  5ER8 A;  3P5R A;  3ICM A;  4KPJ A;  3ZOU A;  3WCC A;  3LGZ B;  3N5H F;  5H9D A;  3LDW A;  4JZB A;  3RYW A;  3ADZ A;  4HD1 A;  3KB9 A;  1HXC A;  5IL3 A;  4NKF A;  4KFA A;  1UBW A;  3WCE A;  3WSA A;  4LOB A;  4KUX A;  3WEJ A;  5AFX A;  3RBM A;  5DIQ F;  1N21 A;  4MC8 A;  3WSB A;  4LLT A;  5ILI A;  3N0F A;  3AE0 A;  1N24 A;  3KRA B;  2AEK A;  5A0J A;  4H5E F;  2ONH A;  1WL0 A;  5CG5 A;  5EAS A;  3WEG A;  2PS8 A;  2E8V A;  3TFV A;  2ZCR A;  5JA0 F;  1YHM A;  5E8L A;  4OMH A;  3VJC A;  2ONG A;  4OKZ A;  4LZ0 A;  3VJD A;  5B01 A;  3N6K F;  4NG6 A;  5B03 A;  1UBY A;  3NPK A;  3OAC B;  1HXA A;  3ICK A;  4P0W A;  3DYH A;  3WEI A;  3VJB A;  2Z4X A;  4LA5 A;  4QXS F;  3ZL6 A;  3LG5 A;  3WEH A;  3RYE A;  4RXA A;  3G4D A;  5HN8 A;  3LMD A;  1EZF A;  1HXG A;  5ILZ A;  4E1E A;  3ZCD A;  2RAH A;  1HX9 A;  3LOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...