2ZY1A

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-830
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
284
structure length
279
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dehydrosqualene synthase
publication title Inhibition of staphyloxanthin virulence factor biosynthesis in Staphylococcus aureus: in vitro, in vivo, and crystallographic results.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 122
structure length 279
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2009-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2zy1A00
3QQVA 3ASXA 5DJVF 1YHKA 3KRAA 2ONHA 3Q30A 3WCDA 2VF6A 3CKEA 1N1ZA 4PVYF 5DJRF 3TC1A 3DYFA 2OA6A 4L2XF 3V1XA 2Z7IA 1WL1A 5EASA 3BNXA 2O1OA 2Q9ZA 4JZBA 2Z4WA 3N45F 4KVWA 4F62A 2ZCRA 3IPIA 1UBYA 1DI1A 4RNQA 3P5RA 1YV5A 1YQ7A 2F7MF 4MC0A 5ILKA 2Q58A 5HN9A 4LA5A 4NFKF 1N20A 5HNAA 3TFPA 1HXAA 3LOMA 5IK9A 1JFGA 3VJEA 4OGUA 3VJCA 5DJPF 2ZEVA 4QXSF 3PH7A 5IMPA 3LK5A 3LJIA 5B0KA 2Z4XA 1YJ4A 4NKFA 2E8TA 3BNYA 3G4DA 3ACYA 2F8ZF 1VG4A 5ILDA 2QISA 3SAEA 4LTVA 3KRCB 2ONGA 1YYTA 2RAHA 4JXNA 5B02A 3N5HF 2E91A 2J1OA 3WCFA 4JYXA 1WL0A 2F8CF 3AQCB 3LVSA 4KVYA 3WJNA 3SDTA 5DHIA 3OABA 1DGPA 3WEJA 3Q1OA 5ERNA 5IM1A 3VJ9A 3OACA 4OKMA 3RMGA 1FPSA 5EAUA 3AE0A 2J1PA 4GA3A 3N3LF 3NF2A 3VJ8A 4DI5A 3SDVA 3LEEA 4F6XA 3LSNA 2E8XA 5JV0F 1HM7A 3WCJA 3PDEA 3WSAA 4ZQ8A 4EA1A 1N23A 3S9VA 3PYBA 3DYGA 2FTZA 1JFAA 1VG6A 3QKCA 1N21A 4H5CF 3WCBA 2AETA 4LLTA 3RYWA 4XQTF 4P0XA 3KRPA 2E94A 3M00A 4LFEA 4DXJA 2I19A 3SDUA 3LZ9A 5IKAA 5ILYA 1RTRA 3WCGA 5B03A 2Z7HA 4RXCA 5JV1F 1ZW5A 3KBKA 4DWBA 2FORA 4KK2A 5AFXA 3ACXA 1VG3A 3ID0A 4KQ5A 5B01A 4DZWA 3IBAA 4OKZA 5IL8A 4E9UA 4KVIA 5CG5A 2AZJA 1V4EA 3WEFA 3KRFB 3MAVA 3WE9A 3WCMA 2AEKA 5HN7A 3LGZB 4E9ZA 5DHKA 3KROB 2E90A 4LIXA 3P8LA 4LUUA 5CG6A 2F94F 5IK6A 3WCAA 2ZY1A 2Z52A 3LG5A 4KQSA 3LGKA 4NFIF 2PS8A 3WC9A 2P1CA 2ZEUA 4LFVF 1RQJA 4FP4A 5E8HA 1YYQA 2ZCSA 1YHMA 4H5DF 3KRAB 1EZFA 4LOBA 3P5PA 3LDWA 5EROA 5B0LA 4OMGA 5IN8A 4NG6A 1HXGA 5C05A 5EATA 3LMDA 3ZMCA 4LZ3A 3N1VF 5IKHA 3TS7A 3P8RA 3NPRA 4K10A 4LTZA 4UMJA 4KKMA 3N46F 1WMWA 4MC8A 3WCCA 5I1UA 1UBVA 2H8OA 5ILHA 1YYSA 4DEMF 4LPHF 4PVXF 3V1VA 5ILZA 4KUXA 3ADZA 3N5JF 4JXYA 3ACWA 1WL2A 1WL3A 3ICKA 5HN8A 4LLSA 4F6VA 1VG7A 2E8VA 3NRIA 2OGDA 5IMNA 2ZCQA 2Q80A 4LFGA 2E92A 5B0JA 3OYRA 5A0IA 1UBXA 1YYRA 5H9DA 5DGNF 5A0KA 4GAXA 3MZVA 5DGSF 1HX9A 3M0GA 3VJBA 4KFAA 3M02A 3Q2QA 3W7FA 5AELA 1YHLA 4LXWA 3AQ0A 3S4JA 3PKOA 2F89F 2PS6A 2E4OA 3N0FA 4P0WA 3KRCA 1V4KA 3ZOUA 3M9UA 4KPJA 4KQUA 1HM4A 4E1EA 3N49F 3N0GA 3AQBB 3OABB 2AZKA 5E8LA 3SDRA 1RQIA 3OACB 3WEKA 2DH4A 2Z78A 3PYAA 3KB9A 4LPGF 3EZ3A 3WSBA 5A0JA 2PS5A 4FJQA 4XQRF 3N6KF 2Z4VA 4NFJF 3WCLA 1UBWA 3VJAA 4EA2A 3DYHA 3N3DA 4LZCA 3LLWA 5DW7A 5B0MA 3G4FA 4QPFA 5B0IA 3UCAA 5JV2F 4EA0A 4LA6A 4RYPA 4WK5A 2E93A 4MC3A 3WCHA 1WY0A 5IK0A 2AELA 3M01A 1N24A 5IVGA 4XQSF 4HD1A 1N22A 1WKZA 3KRPB 2Z4YA 3CC9A 4NKEA 3B7LA 2AZLA 5B00A 3TFNA 3ZL6A 3ICZA 3WCIA 3ZMBA 4NUAA 2E8UA 3ICMA 3WJOA 3Q2ZA 5JUZF 5IMIA 3EFQA 2OPMA 4LZ0A 4GP2A 5ERMA 2OPNA 2J5CA 5JA0F 3WEHA 3TFVA 1V4JA 4N1ZF 3WEGA 3P41A 3APZA 1KIYA 2F9KF 2PS7A 4KPDA 2ZCOA 3ZCDA 3RBMA 1YYUA 4Q23A 1VG2A 1V4HA 1V4IA 3CP6A 3NPKA 3VJDA 5ILJA 2Z50A 3WCEA 4KWDA 2E95A 3KRFA 4JZXA 4DHDA 3V66A 5ILIA 4N9UA 3SDQA 4KVDA 2EWGA 1N1BA 4DWGA 1KIZA 3WJKA 1PS1A 4OMHA 5IL3A 2Z4ZA 3N1WF 5DGMF 2Q9YA 3WEIA 2F92F 5E8KA 3RYEA 3KROA 4RXAA 1HXCA 5ER8A 4GP1A 2E8WA 5AYPA 5DZ2A 3ICNA 4RXDA 4RXEA 4H5EF 4P0VA 5DIQF 4JVJF 2PS4A 5KSXF 5AHUB 3EGTA
chains in the Genus database with same CATH superfamily
3QQVA 3ASXA 5DJVF 1YHKA 3KRAA 2ONHA 3Q30A 3WCDA 2VF6A 3CKEA 1N1ZA 4PVYF 5DJRF 3TC1A 3DYFA 2OA6A 4L2XF 3V1XA 2Z7IA 1WL1A 5EASA 3BNXA 2O1OA 2Q9ZA 4JZBA 2Z4WA 3N45F 4KVWA 4F62A 2ZCRA 3IPIA 1UBYA 1DI1A 4RNQA 3P5RA 1YV5A 1YQ7A 2F7MF 4MC0A 5ILKA 2Q58A 5HN9A 4LA5A 4NFKF 1N20A 5HNAA 3TFPA 1HXAA 3LOMA 5IK9A 1JFGA 3VJEA 4OGUA 3VJCA 5DJPF 2ZEVA 4QXSF 3PH7A 5IMPA 3LK5A 3LJIA 5B0KA 2Z4XA 1YJ4A 4NKFA 2E8TA 3BNYA 3G4DA 3ACYA 2F8ZF 1VG4A 5ILDA 2QISA 3SAEA 4LTVA 3KRCB 2ONGA 1YYTA 2RAHA 4JXNA 5B02A 3N5HF 2E91A 2J1OA 3WCFA 4JYXA 1WL0A 2F8CF 3AQCB 3LVSA 4KVYA 3WJNA 3SDTA 5DHIA 3OABA 1DGPA 3WEJA 3Q1OA 5ERNA 5IM1A 3VJ9A 3OACA 4OKMA 3RMGA 1FPSA 5EAUA 3AE0A 2J1PA 4GA3A 3N3LF 3NF2A 3VJ8A 4DI5A 3SDVA 3LEEA 4F6XA 3LSNA 2E8XA 5JV0F 1HM7A 3WCJA 3PDEA 3WSAA 4ZQ8A 4EA1A 1N23A 3S9VA 3PYBA 3DYGA 2FTZA 1JFAA 1VG6A 3QKCA 1N21A 4H5CF 3WCBA 2AETA 4LLTA 3RYWA 4XQTF 4P0XA 3KRPA 2E94A 3M00A 4LFEA 4DXJA 2I19A 3SDUA 3LZ9A 5IKAA 5ILYA 1RTRA 3WCGA 5B03A 2Z7HA 4RXCA 5JV1F 1ZW5A 3KBKA 4DWBA 2FORA 4KK2A 5AFXA 3ACXA 1VG3A 3ID0A 4KQ5A 5B01A 4DZWA 3IBAA 4OKZA 5IL8A 4E9UA 4KVIA 5CG5A 2AZJA 1V4EA 3WEFA 3KRFB 3MAVA 3WE9A 3WCMA 2AEKA 5HN7A 3LGZB 4E9ZA 5DHKA 3KROB 2E90A 4LIXA 3P8LA 4LUUA 5CG6A 2F94F 5IK6A 3WCAA 2ZY1A 2Z52A 3LG5A 4KQSA 3LGKA 4NFIF 2PS8A 3WC9A 2P1CA 2ZEUA 4LFVF 1RQJA 4FP4A 5E8HA 1YYQA 2ZCSA 1YHMA 4H5DF 3KRAB 1EZFA 4LOBA 3P5PA 3LDWA 5EROA 5B0LA 4OMGA 5IN8A 4NG6A 1HXGA 5C05A 5EATA 3LMDA 3ZMCA 4LZ3A 3N1VF 5IKHA 3TS7A 3P8RA 3NPRA 4K10A 4LTZA 4UMJA 4KKMA 3N46F 1WMWA 4MC8A 3WCCA 5I1UA 1UBVA 2H8OA 5ILHA 1YYSA 4DEMF 4LPHF 4PVXF 3V1VA 5ILZA 4KUXA 3ADZA 3N5JF 4JXYA 3ACWA 1WL2A 1WL3A 3ICKA 5HN8A 4LLSA 4F6VA 1VG7A 2E8VA 3NRIA 2OGDA 5IMNA 2ZCQA 2Q80A 4LFGA 2E92A 5B0JA 3OYRA 5A0IA 1UBXA 1YYRA 5H9DA 5DGNF 5A0KA 4GAXA 3MZVA 5DGSF 1HX9A 3M0GA 3VJBA 4KFAA 3M02A 3Q2QA 3W7FA 5AELA 1YHLA 4LXWA 3AQ0A 3S4JA 3PKOA 2F89F 2PS6A 2E4OA 3N0FA 4P0WA 3KRCA 1V4KA 3ZOUA 3M9UA 4KPJA 4KQUA 1HM4A 4E1EA 3N49F 3N0GA 3AQBB 3OABB 2AZKA 5E8LA 3SDRA 1RQIA 3OACB 3WEKA 2DH4A 2Z78A 3PYAA 3KB9A 4LPGF 3EZ3A 3WSBA 5A0JA 2PS5A 4FJQA 4XQRF 3N6KF 2Z4VA 4NFJF 3WCLA 1UBWA 3VJAA 4EA2A 3DYHA 3N3DA 4LZCA 3LLWA 5DW7A 5B0MA 3G4FA 4QPFA 5B0IA 3UCAA 5JV2F 4EA0A 4LA6A 4RYPA 4WK5A 2E93A 4MC3A 3WCHA 1WY0A 5IK0A 2AELA 3M01A 1N24A 5IVGA 4XQSF 4HD1A 1N22A 1WKZA 3KRPB 2Z4YA 3CC9A 4NKEA 3B7LA 2AZLA 5B00A 3TFNA 3ZL6A 3ICZA 3WCIA 3ZMBA 4NUAA 2E8UA 3ICMA 3WJOA 3Q2ZA 5JUZF 5IMIA 3EFQA 2OPMA 4LZ0A 4GP2A 5ERMA 2OPNA 2J5CA 5JA0F 3WEHA 3TFVA 1V4JA 4N1ZF 3WEGA 3P41A 3APZA 1KIYA 2F9KF 2PS7A 4KPDA 2ZCOA 3ZCDA 3RBMA 1YYUA 4Q23A 1VG2A 1V4HA 1V4IA 3CP6A 3NPKA 3VJDA 5ILJA 2Z50A 3WCEA 4KWDA 2E95A 3KRFA 4JZXA 4DHDA 3V66A 5ILIA 4N9UA 3SDQA 4KVDA 2EWGA 1N1BA 4DWGA 1KIZA 3WJKA 1PS1A 4OMHA 5IL3A 2Z4ZA 3N1WF 5DGMF 2Q9YA 3WEIA 2F92F 5E8KA 3RYEA 3KROA 4RXAA 1HXCA 5ER8A 4GP1A 2E8WA 5AYPA 5DZ2A 3ICNA 4RXDA 4RXEA 4H5EF 4P0VA 5DIQF 4JVJF 2PS4A 5KSXF 5AHUB 3EGTA
chains in the Genus database with same CATH topology
3QQVA 3ASXA 5DJVF 1YHKA 3KRAA 2ONHA 3Q30A 3WCDA 2VF6A 3CKEA 1N1ZA 4PVYF 5DJRF 3TC1A 3DYFA 2OA6A 4L2XF 3V1XA 2Z7IA 1WL1A 5EASA 3BNXA 2O1OA 2Q9ZA 4JZBA 2Z4WA 3N45F 4KVWA 4F62A 2ZCRA 3IPIA 1UBYA 1DI1A 4RNQA 3P5RA 1YV5A 1YQ7A 2F7MF 4MC0A 5ILKA 2Q58A 5HN9A 4LA5A 4NFKF 1N20A 5HNAA 3TFPA 1HXAA 3LOMA 5IK9A 1JFGA 3VJEA 4OGUA 3VJCA 5DJPF 2ZEVA 4QXSF 3PH7A 5IMPA 3LK5A 3LJIA 5B0KA 2Z4XA 1YJ4A 4NKFA 2E8TA 3BNYA 3G4DA 3ACYA 2F8ZF 1VG4A 5ILDA 2QISA 3SAEA 4LTVA 3KRCB 2ONGA 1YYTA 2RAHA 4JXNA 5B02A 3N5HF 2E91A 2J1OA 3WCFA 4JYXA 1WL0A 2F8CF 3AQCB 3LVSA 4KVYA 3WJNA 3SDTA 5DHIA 3OABA 1DGPA 3WEJA 3Q1OA 5ERNA 5IM1A 3VJ9A 3OACA 4OKMA 3RMGA 1FPSA 5EAUA 3AE0A 2J1PA 4GA3A 3N3LF 3NF2A 3VJ8A 4DI5A 3SDVA 3LEEA 4F6XA 3LSNA 2E8XA 5JV0F 1HM7A 3WCJA 3PDEA 3WSAA 4ZQ8A 4EA1A 1N23A 3S9VA 3PYBA 3DYGA 2FTZA 1JFAA 1VG6A 3QKCA 1N21A 4H5CF 3WCBA 2AETA 4LLTA 3RYWA 4XQTF 4P0XA 3KRPA 2E94A 3M00A 4LFEA 4DXJA 2I19A 3SDUA 3LZ9A 5IKAA 5ILYA 1RTRA 3WCGA 5B03A 2Z7HA 4RXCA 5JV1F 1ZW5A 3KBKA 4DWBA 2FORA 4KK2A 5AFXA 3ACXA 1VG3A 3ID0A 4KQ5A 5B01A 4DZWA 3IBAA 4OKZA 5IL8A 4E9UA 4KVIA 5CG5A 2AZJA 1V4EA 3WEFA 3KRFB 3MAVA 3WE9A 3WCMA 2AEKA 5HN7A 3LGZB 4E9ZA 5DHKA 3KROB 2E90A 4LIXA 3P8LA 4LUUA 5CG6A 2F94F 5IK6A 3WCAA 2ZY1A 2Z52A 3LG5A 4KQSA 3LGKA 4NFIF 2PS8A 3WC9A 2P1CA 2ZEUA 4LFVF 1RQJA 4FP4A 5E8HA 1YYQA 2ZCSA 1YHMA 4H5DF 3KRAB 1EZFA 4LOBA 3P5PA 3LDWA 5EROA 5B0LA 4OMGA 5IN8A 4NG6A 1HXGA 5C05A 5EATA 3LMDA 3ZMCA 4LZ3A 3N1VF 5IKHA 3TS7A 3P8RA 3NPRA 4K10A 4LTZA 4UMJA 4KKMA 3N46F 1WMWA 4MC8A 3WCCA 5I1UA 1UBVA 2H8OA 5ILHA 1YYSA 4DEMF 4LPHF 4PVXF 3V1VA 5ILZA 4KUXA 3ADZA 3N5JF 4JXYA 3ACWA 1WL2A 1WL3A 3ICKA 5HN8A 4LLSA 4F6VA 1VG7A 2E8VA 3NRIA 2OGDA 5IMNA 2ZCQA 2Q80A 4LFGA 2E92A 5B0JA 3OYRA 5A0IA 1UBXA 1YYRA 5H9DA 5DGNF 5A0KA 4GAXA 3MZVA 5DGSF 1HX9A 3M0GA 3VJBA 4KFAA 3M02A 3Q2QA 3W7FA 5AELA 1YHLA 4LXWA 3AQ0A 3S4JA 3PKOA 2F89F 2PS6A 2E4OA 3N0FA 4P0WA 3KRCA 1V4KA 3ZOUA 3M9UA 4KPJA 4KQUA 1HM4A 4E1EA 3N49F 3N0GA 3AQBB 3OABB 2AZKA 5E8LA 3SDRA 1RQIA 3OACB 3WEKA 2DH4A 2Z78A 3PYAA 3KB9A 4LPGF 3EZ3A 3WSBA 5A0JA 2PS5A 4FJQA 4XQRF 3N6KF 2Z4VA 4NFJF 3WCLA 1UBWA 3VJAA 4EA2A 3DYHA 3N3DA 4LZCA 3LLWA 5DW7A 5B0MA 3G4FA 4QPFA 5B0IA 3UCAA 5JV2F 4EA0A 4LA6A 4RYPA 4WK5A 2E93A 4MC3A 3WCHA 1WY0A 5IK0A 2AELA 3M01A 1N24A 5IVGA 4XQSF 4HD1A 1N22A 1WKZA 3KRPB 2Z4YA 3CC9A 4NKEA 3B7LA 2AZLA 5B00A 3TFNA 3ZL6A 3ICZA 3WCIA 3ZMBA 4NUAA 2E8UA 3ICMA 3WJOA 3Q2ZA 5JUZF 5IMIA 3EFQA 2OPMA 4LZ0A 4GP2A 5ERMA 2OPNA 2J5CA 5JA0F 3WEHA 3TFVA 1V4JA 4N1ZF 3WEGA 3P41A 3APZA 1KIYA 2F9KF 2PS7A 4KPDA 2ZCOA 3ZCDA 3RBMA 1YYUA 4Q23A 1VG2A 1V4HA 1V4IA 3CP6A 3NPKA 3VJDA 5ILJA 2Z50A 3WCEA 4KWDA 2E95A 3KRFA 4JZXA 4DHDA 3V66A 5ILIA 4N9UA 3SDQA 4KVDA 2EWGA 1N1BA 4DWGA 1KIZA 3WJKA 1PS1A 4OMHA 5IL3A 2Z4ZA 3N1WF 5DGMF 2Q9YA 3WEIA 2F92F 5E8KA 3RYEA 3KROA 4RXAA 1HXCA 5ER8A 4GP1A 2E8WA 5AYPA 5DZ2A 3ICNA 4RXDA 4RXEA 4H5EF 4P0VA 5DIQF 4JVJF 2PS4A 5KSXF 5AHUB 3EGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQV A;  3ASX A;  5DJV F;  1YHK A;  3KRA A;  2ONH A;  3Q30 A;  3WCD A;  2VF6 A;  3CKE A;  1N1Z A;  4PVY F;  5DJR F;  3TC1 A;  3DYF A;  2OA6 A;  4L2X F;  3V1X A;  2Z7I A;  1WL1 A;  5EAS A;  3BNX A;  2O1O A;  2Q9Z A;  4JZB A;  2Z4W A;  3N45 F;  4KVW A;  4F62 A;  2ZCR A;  3IPI A;  1UBY A;  1DI1 A;  4RNQ A;  3P5R A;  1YV5 A;  1YQ7 A;  2F7M F;  4MC0 A;  5ILK A;  2Q58 A;  5HN9 A;  4LA5 A;  4NFK F;  1N20 A;  5HNA A;  3TFP A;  1HXA A;  3LOM A;  5IK9 A;  1JFG A;  3VJE A;  4OGU A;  3VJC A;  5DJP F;  2ZEV A;  4QXS F;  3PH7 A;  5IMP A;  3LK5 A;  3LJI A;  5B0K A;  2Z4X A;  1YJ4 A;  4NKF A;  2E8T A;  3BNY A;  3G4D A;  3ACY A;  2F8Z F;  1VG4 A;  5ILD A;  2QIS A;  3SAE A;  4LTV A;  3KRC B;  2ONG A;  1YYT A;  2RAH A;  4JXN A;  5B02 A;  3N5H F;  2E91 A;  2J1O A;  3WCF A;  4JYX A;  1WL0 A;  2F8C F;  3AQC B;  3LVS A;  4KVY A;  3WJN A;  3SDT A;  5DHI A;  3OAB A;  1DGP A;  3WEJ A;  3Q1O A;  5ERN A;  5IM1 A;  3VJ9 A;  3OAC A;  4OKM A;  3RMG A;  1FPS A;  5EAU A;  3AE0 A;  2J1P A;  4GA3 A;  3N3L F;  3NF2 A;  3VJ8 A;  4DI5 A;  3SDV A;  3LEE A;  4F6X A;  3LSN A;  2E8X A;  5JV0 F;  1HM7 A;  3WCJ A;  3PDE A;  3WSA A;  4ZQ8 A;  4EA1 A;  1N23 A;  3S9V A;  3PYB A;  3DYG A;  2FTZ A;  1JFA A;  1VG6 A;  3QKC A;  1N21 A;  4H5C F;  3WCB A;  2AET A;  4LLT A;  3RYW A;  4XQT F;  4P0X A;  3KRP A;  2E94 A;  3M00 A;  4LFE A;  4DXJ A;  2I19 A;  3SDU A;  3LZ9 A;  5IKA A;  5ILY A;  1RTR A;  3WCG A;  5B03 A;  2Z7H A;  4RXC A;  5JV1 F;  1ZW5 A;  3KBK A;  4DWB A;  2FOR A;  4KK2 A;  5AFX A;  3ACX A;  1VG3 A;  3ID0 A;  4KQ5 A;  5B01 A;  4DZW A;  3IBA A;  4OKZ A;  5IL8 A;  4E9U A;  4KVI A;  5CG5 A;  2AZJ A;  1V4E A;  3WEF A;  3KRF B;  3MAV A;  3WE9 A;  3WCM A;  2AEK A;  5HN7 A;  3LGZ B;  4E9Z A;  5DHK A;  3KRO B;  2E90 A;  4LIX A;  3P8L A;  4LUU A;  5CG6 A;  2F94 F;  5IK6 A;  3WCA A;  2ZY1 A;  2Z52 A;  3LG5 A;  4KQS A;  3LGK A;  4NFI F;  2PS8 A;  3WC9 A;  2P1C A;  2ZEU A;  4LFV F;  1RQJ A;  4FP4 A;  5E8H A;  1YYQ A;  2ZCS A;  1YHM A;  4H5D F;  3KRA B;  1EZF A;  4LOB A;  3P5P A;  3LDW A;  5ERO A;  5B0L A;  4OMG A;  5IN8 A;  4NG6 A;  1HXG A;  5C05 A;  5EAT A;  3LMD A;  3ZMC A;  4LZ3 A;  3N1V F;  5IKH A;  3TS7 A;  3P8R A;  3NPR A;  4K10 A;  4LTZ A;  4UMJ A;  4KKM A;  3N46 F;  1WMW A;  4MC8 A;  3WCC A;  5I1U A;  1UBV A;  2H8O A;  5ILH A;  1YYS A;  4DEM F;  4LPH F;  4PVX F;  3V1V A;  5ILZ A;  4KUX A;  3ADZ A;  3N5J F;  4JXY A;  3ACW A;  1WL2 A;  1WL3 A;  3ICK A;  5HN8 A;  4LLS A;  4F6V A;  1VG7 A;  2E8V A;  3NRI A;  2OGD A;  5IMN A;  2ZCQ A;  2Q80 A;  4LFG A;  2E92 A;  5B0J A;  3OYR A;  5A0I A;  1UBX A;  1YYR A;  5H9D A;  5DGN F;  5A0K A;  4GAX A;  3MZV A;  5DGS F;  1HX9 A;  3M0G A;  3VJB A;  4KFA A;  3M02 A;  3Q2Q A;  3W7F A;  5AEL A;  1YHL A;  4LXW A;  3AQ0 A;  3S4J A;  3PKO A;  2F89 F;  2PS6 A;  2E4O A;  3N0F A;  4P0W A;  3KRC A;  1V4K A;  3ZOU A;  3M9U A;  4KPJ A;  4KQU A;  1HM4 A;  4E1E A;  3N49 F;  3N0G A;  3AQB B;  3OAB B;  2AZK A;  5E8L A;  3SDR A;  1RQI A;  3OAC B;  3WEK A;  2DH4 A;  2Z78 A;  3PYA A;  3KB9 A;  4LPG F;  3EZ3 A;  3WSB A;  5A0J A;  2PS5 A;  4FJQ A;  4XQR F;  3N6K F;  2Z4V A;  4NFJ F;  3WCL A;  1UBW A;  3VJA A;  4EA2 A;  3DYH A;  3N3D A;  4LZC A;  3LLW A;  5DW7 A;  5B0M A;  3G4F A;  4QPF A;  5B0I A;  3UCA A;  5JV2 F;  4EA0 A;  4LA6 A;  4RYP A;  4WK5 A;  2E93 A;  4MC3 A;  3WCH A;  1WY0 A;  5IK0 A;  2AEL A;  3M01 A;  1N24 A;  5IVG A;  4XQS F;  4HD1 A;  1N22 A;  1WKZ A;  3KRP B;  2Z4Y A;  3CC9 A;  4NKE A;  3B7L A;  2AZL A;  5B00 A;  3TFN A;  3ZL6 A;  3ICZ A;  3WCI A;  3ZMB A;  4NUA A;  2E8U A;  3ICM A;  3WJO A;  3Q2Z A;  5JUZ F;  5IMI A;  3EFQ A;  2OPM A;  4LZ0 A;  4GP2 A;  5ERM A;  2OPN A;  2J5C A;  5JA0 F;  3WEH A;  3TFV A;  1V4J A;  4N1Z F;  3WEG A;  3P41 A;  3APZ A;  1KIY A;  2F9K F;  2PS7 A;  4KPD A;  2ZCO A;  3ZCD A;  3RBM A;  1YYU A;  4Q23 A;  1VG2 A;  1V4H A;  1V4I A;  3CP6 A;  3NPK A;  3VJD A;  5ILJ A;  2Z50 A;  3WCE A;  4KWD A;  2E95 A;  3KRF A;  4JZX A;  4DHD A;  3V66 A;  5ILI A;  4N9U A;  3SDQ A;  4KVD A;  2EWG A;  1N1B A;  4DWG A;  1KIZ A;  3WJK A;  1PS1 A;  4OMH A;  5IL3 A;  2Z4Z A;  3N1W F;  5DGM F;  2Q9Y A;  3WEI A;  2F92 F;  5E8K A;  3RYE A;  3KRO A;  4RXA A;  1HXC A;  5ER8 A;  4GP1 A;  2E8W A;  5AYP A;  5DZ2 A;  3ICN A;  4RXD A;  4RXE A;  4H5E F;  4P0V A;  5DIQ F;  4JVJ F;  2PS4 A;  5KSX F;  5AHU B;  3EGT A; 
#chains in the Genus database with same CATH topology
 3QQV A;  3ASX A;  5DJV F;  1YHK A;  3KRA A;  2ONH A;  3Q30 A;  3WCD A;  2VF6 A;  3CKE A;  1N1Z A;  4PVY F;  5DJR F;  3TC1 A;  3DYF A;  2OA6 A;  4L2X F;  3V1X A;  2Z7I A;  1WL1 A;  5EAS A;  3BNX A;  2O1O A;  2Q9Z A;  4JZB A;  2Z4W A;  3N45 F;  4KVW A;  4F62 A;  2ZCR A;  3IPI A;  1UBY A;  1DI1 A;  4RNQ A;  3P5R A;  1YV5 A;  1YQ7 A;  2F7M F;  4MC0 A;  5ILK A;  2Q58 A;  5HN9 A;  4LA5 A;  4NFK F;  1N20 A;  5HNA A;  3TFP A;  1HXA A;  3LOM A;  5IK9 A;  1JFG A;  3VJE A;  4OGU A;  3VJC A;  5DJP F;  2ZEV A;  4QXS F;  3PH7 A;  5IMP A;  3LK5 A;  3LJI A;  5B0K A;  2Z4X A;  1YJ4 A;  4NKF A;  2E8T A;  3BNY A;  3G4D A;  3ACY A;  2F8Z F;  1VG4 A;  5ILD A;  2QIS A;  3SAE A;  4LTV A;  3KRC B;  2ONG A;  1YYT A;  2RAH A;  4JXN A;  5B02 A;  3N5H F;  2E91 A;  2J1O A;  3WCF A;  4JYX A;  1WL0 A;  2F8C F;  3AQC B;  3LVS A;  4KVY A;  3WJN A;  3SDT A;  5DHI A;  3OAB A;  1DGP A;  3WEJ A;  3Q1O A;  5ERN A;  5IM1 A;  3VJ9 A;  3OAC A;  4OKM A;  3RMG A;  1FPS A;  5EAU A;  3AE0 A;  2J1P A;  4GA3 A;  3N3L F;  3NF2 A;  3VJ8 A;  4DI5 A;  3SDV A;  3LEE A;  4F6X A;  3LSN A;  2E8X A;  5JV0 F;  1HM7 A;  3WCJ A;  3PDE A;  3WSA A;  4ZQ8 A;  4EA1 A;  1N23 A;  3S9V A;  3PYB A;  3DYG A;  2FTZ A;  1JFA A;  1VG6 A;  3QKC A;  1N21 A;  4H5C F;  3WCB A;  2AET A;  4LLT A;  3RYW A;  4XQT F;  4P0X A;  3KRP A;  2E94 A;  3M00 A;  4LFE A;  4DXJ A;  2I19 A;  3SDU A;  3LZ9 A;  5IKA A;  5ILY A;  1RTR A;  3WCG A;  5B03 A;  2Z7H A;  4RXC A;  5JV1 F;  1ZW5 A;  3KBK A;  4DWB A;  2FOR A;  4KK2 A;  5AFX A;  3ACX A;  1VG3 A;  3ID0 A;  4KQ5 A;  5B01 A;  4DZW A;  3IBA A;  4OKZ A;  5IL8 A;  4E9U A;  4KVI A;  5CG5 A;  2AZJ A;  1V4E A;  3WEF A;  3KRF B;  3MAV A;  3WE9 A;  3WCM A;  2AEK A;  5HN7 A;  3LGZ B;  4E9Z A;  5DHK A;  3KRO B;  2E90 A;  4LIX A;  3P8L A;  4LUU A;  5CG6 A;  2F94 F;  5IK6 A;  3WCA A;  2ZY1 A;  2Z52 A;  3LG5 A;  4KQS A;  3LGK A;  4NFI F;  2PS8 A;  3WC9 A;  2P1C A;  2ZEU A;  4LFV F;  1RQJ A;  4FP4 A;  5E8H A;  1YYQ A;  2ZCS A;  1YHM A;  4H5D F;  3KRA B;  1EZF A;  4LOB A;  3P5P A;  3LDW A;  5ERO A;  5B0L A;  4OMG A;  5IN8 A;  4NG6 A;  1HXG A;  5C05 A;  5EAT A;  3LMD A;  3ZMC A;  4LZ3 A;  3N1V F;  5IKH A;  3TS7 A;  3P8R A;  3NPR A;  4K10 A;  4LTZ A;  4UMJ A;  4KKM A;  3N46 F;  1WMW A;  4MC8 A;  3WCC A;  5I1U A;  1UBV A;  2H8O A;  5ILH A;  1YYS A;  4DEM F;  4LPH F;  4PVX F;  3V1V A;  5ILZ A;  4KUX A;  3ADZ A;  3N5J F;  4JXY A;  3ACW A;  1WL2 A;  1WL3 A;  3ICK A;  5HN8 A;  4LLS A;  4F6V A;  1VG7 A;  2E8V A;  3NRI A;  2OGD A;  5IMN A;  2ZCQ A;  2Q80 A;  4LFG A;  2E92 A;  5B0J A;  3OYR A;  5A0I A;  1UBX A;  1YYR A;  5H9D A;  5DGN F;  5A0K A;  4GAX A;  3MZV A;  5DGS F;  1HX9 A;  3M0G A;  3VJB A;  4KFA A;  3M02 A;  3Q2Q A;  3W7F A;  5AEL A;  1YHL A;  4LXW A;  3AQ0 A;  3S4J A;  3PKO A;  2F89 F;  2PS6 A;  2E4O A;  3N0F A;  4P0W A;  3KRC A;  1V4K A;  3ZOU A;  3M9U A;  4KPJ A;  4KQU A;  1HM4 A;  4E1E A;  3N49 F;  3N0G A;  3AQB B;  3OAB B;  2AZK A;  5E8L A;  3SDR A;  1RQI A;  3OAC B;  3WEK A;  2DH4 A;  2Z78 A;  3PYA A;  3KB9 A;  4LPG F;  3EZ3 A;  3WSB A;  5A0J A;  2PS5 A;  4FJQ A;  4XQR F;  3N6K F;  2Z4V A;  4NFJ F;  3WCL A;  1UBW A;  3VJA A;  4EA2 A;  3DYH A;  3N3D A;  4LZC A;  3LLW A;  5DW7 A;  5B0M A;  3G4F A;  4QPF A;  5B0I A;  3UCA A;  5JV2 F;  4EA0 A;  4LA6 A;  4RYP A;  4WK5 A;  2E93 A;  4MC3 A;  3WCH A;  1WY0 A;  5IK0 A;  2AEL A;  3M01 A;  1N24 A;  5IVG A;  4XQS F;  4HD1 A;  1N22 A;  1WKZ A;  3KRP B;  2Z4Y A;  3CC9 A;  4NKE A;  3B7L A;  2AZL A;  5B00 A;  3TFN A;  3ZL6 A;  3ICZ A;  3WCI A;  3ZMB A;  4NUA A;  2E8U A;  3ICM A;  3WJO A;  3Q2Z A;  5JUZ F;  5IMI A;  3EFQ A;  2OPM A;  4LZ0 A;  4GP2 A;  5ERM A;  2OPN A;  2J5C A;  5JA0 F;  3WEH A;  3TFV A;  1V4J A;  4N1Z F;  3WEG A;  3P41 A;  3APZ A;  1KIY A;  2F9K F;  2PS7 A;  4KPD A;  2ZCO A;  3ZCD A;  3RBM A;  1YYU A;  4Q23 A;  1VG2 A;  1V4H A;  1V4I A;  3CP6 A;  3NPK A;  3VJD A;  5ILJ A;  2Z50 A;  3WCE A;  4KWD A;  2E95 A;  3KRF A;  4JZX A;  4DHD A;  3V66 A;  5ILI A;  4N9U A;  3SDQ A;  4KVD A;  2EWG A;  1N1B A;  4DWG A;  1KIZ A;  3WJK A;  1PS1 A;  4OMH A;  5IL3 A;  2Z4Z A;  3N1W F;  5DGM F;  2Q9Y A;  3WEI A;  2F92 F;  5E8K A;  3RYE A;  3KRO A;  4RXA A;  1HXC A;  5ER8 A;  4GP1 A;  2E8W A;  5AYP A;  5DZ2 A;  3ICN A;  4RXD A;  4RXE A;  4H5E F;  4P0V A;  5DIQ F;  4JVJ F;  2PS4 A;  5KSX F;  5AHU B;  3EGT A; 
#chains in the Genus database with same CATH homology
 3QQV A;  3ASX A;  5DJV F;  1YHK A;  3KRA A;  2ONH A;  3Q30 A;  3WCD A;  2VF6 A;  3CKE A;  1N1Z A;  4PVY F;  5DJR F;  3TC1 A;  3DYF A;  2OA6 A;  4L2X F;  3V1X A;  2Z7I A;  1WL1 A;  5EAS A;  3BNX A;  2O1O A;  2Q9Z A;  4JZB A;  2Z4W A;  3N45 F;  4KVW A;  4F62 A;  2ZCR A;  3IPI A;  1UBY A;  1DI1 A;  4RNQ A;  3P5R A;  1YV5 A;  1YQ7 A;  2F7M F;  4MC0 A;  5ILK A;  2Q58 A;  5HN9 A;  4LA5 A;  4NFK F;  1N20 A;  5HNA A;  3TFP A;  1HXA A;  3LOM A;  5IK9 A;  1JFG A;  3VJE A;  4OGU A;  3VJC A;  5DJP F;  2ZEV A;  4QXS F;  3PH7 A;  5IMP A;  3LK5 A;  3LJI A;  5B0K A;  2Z4X A;  1YJ4 A;  4NKF A;  2E8T A;  3BNY A;  3G4D A;  3ACY A;  2F8Z F;  1VG4 A;  5ILD A;  2QIS A;  3SAE A;  4LTV A;  3KRC B;  2ONG A;  1YYT A;  2RAH A;  4JXN A;  5B02 A;  3N5H F;  2E91 A;  2J1O A;  3WCF A;  4JYX A;  1WL0 A;  2F8C F;  3AQC B;  3LVS A;  4KVY A;  3WJN A;  3SDT A;  5DHI A;  3OAB A;  1DGP A;  3WEJ A;  3Q1O A;  5ERN A;  5IM1 A;  3VJ9 A;  3OAC A;  4OKM A;  3RMG A;  1FPS A;  5EAU A;  3AE0 A;  2J1P A;  4GA3 A;  3N3L F;  3NF2 A;  3VJ8 A;  4DI5 A;  3SDV A;  3LEE A;  4F6X A;  3LSN A;  2E8X A;  5JV0 F;  1HM7 A;  3WCJ A;  3PDE A;  3WSA A;  4ZQ8 A;  4EA1 A;  1N23 A;  3S9V A;  3PYB A;  3DYG A;  2FTZ A;  1JFA A;  1VG6 A;  3QKC A;  1N21 A;  4H5C F;  3WCB A;  2AET A;  4LLT A;  3RYW A;  4XQT F;  4P0X A;  3KRP A;  2E94 A;  3M00 A;  4LFE A;  4DXJ A;  2I19 A;  3SDU A;  3LZ9 A;  5IKA A;  5ILY A;  1RTR A;  3WCG A;  5B03 A;  2Z7H A;  4RXC A;  5JV1 F;  1ZW5 A;  3KBK A;  4DWB A;  2FOR A;  4KK2 A;  5AFX A;  3ACX A;  1VG3 A;  3ID0 A;  4KQ5 A;  5B01 A;  4DZW A;  3IBA A;  4OKZ A;  5IL8 A;  4E9U A;  4KVI A;  5CG5 A;  2AZJ A;  1V4E A;  3WEF A;  3KRF B;  3MAV A;  3WE9 A;  3WCM A;  2AEK A;  5HN7 A;  3LGZ B;  4E9Z A;  5DHK A;  3KRO B;  2E90 A;  4LIX A;  3P8L A;  4LUU A;  5CG6 A;  2F94 F;  5IK6 A;  3WCA A;  2ZY1 A;  2Z52 A;  3LG5 A;  4KQS A;  3LGK A;  4NFI F;  2PS8 A;  3WC9 A;  2P1C A;  2ZEU A;  4LFV F;  1RQJ A;  4FP4 A;  5E8H A;  1YYQ A;  2ZCS A;  1YHM A;  4H5D F;  3KRA B;  1EZF A;  4LOB A;  3P5P A;  3LDW A;  5ERO A;  5B0L A;  4OMG A;  5IN8 A;  4NG6 A;  1HXG A;  5C05 A;  5EAT A;  3LMD A;  3ZMC A;  4LZ3 A;  3N1V F;  5IKH A;  3TS7 A;  3P8R A;  3NPR A;  4K10 A;  4LTZ A;  4UMJ A;  4KKM A;  3N46 F;  1WMW A;  4MC8 A;  3WCC A;  5I1U A;  1UBV A;  2H8O A;  5ILH A;  1YYS A;  4DEM F;  4LPH F;  4PVX F;  3V1V A;  5ILZ A;  4KUX A;  3ADZ A;  3N5J F;  4JXY A;  3ACW A;  1WL2 A;  1WL3 A;  3ICK A;  5HN8 A;  4LLS A;  4F6V A;  1VG7 A;  2E8V A;  3NRI A;  2OGD A;  5IMN A;  2ZCQ A;  2Q80 A;  4LFG A;  2E92 A;  5B0J A;  3OYR A;  5A0I A;  1UBX A;  1YYR A;  5H9D A;  5DGN F;  5A0K A;  4GAX A;  3MZV A;  5DGS F;  1HX9 A;  3M0G A;  3VJB A;  4KFA A;  3M02 A;  3Q2Q A;  3W7F A;  5AEL A;  1YHL A;  4LXW A;  3AQ0 A;  3S4J A;  3PKO A;  2F89 F;  2PS6 A;  2E4O A;  3N0F A;  4P0W A;  3KRC A;  1V4K A;  3ZOU A;  3M9U A;  4KPJ A;  4KQU A;  1HM4 A;  4E1E A;  3N49 F;  3N0G A;  3AQB B;  3OAB B;  2AZK A;  5E8L A;  3SDR A;  1RQI A;  3OAC B;  3WEK A;  2DH4 A;  2Z78 A;  3PYA A;  3KB9 A;  4LPG F;  3EZ3 A;  3WSB A;  5A0J A;  2PS5 A;  4FJQ A;  4XQR F;  3N6K F;  2Z4V A;  4NFJ F;  3WCL A;  1UBW A;  3VJA A;  4EA2 A;  3DYH A;  3N3D A;  4LZC A;  3LLW A;  5DW7 A;  5B0M A;  3G4F A;  4QPF A;  5B0I A;  3UCA A;  5JV2 F;  4EA0 A;  4LA6 A;  4RYP A;  4WK5 A;  2E93 A;  4MC3 A;  3WCH A;  1WY0 A;  5IK0 A;  2AEL A;  3M01 A;  1N24 A;  5IVG A;  4XQS F;  4HD1 A;  1N22 A;  1WKZ A;  3KRP B;  2Z4Y A;  3CC9 A;  4NKE A;  3B7L A;  2AZL A;  5B00 A;  3TFN A;  3ZL6 A;  3ICZ A;  3WCI A;  3ZMB A;  4NUA A;  2E8U A;  3ICM A;  3WJO A;  3Q2Z A;  5JUZ F;  5IMI A;  3EFQ A;  2OPM A;  4LZ0 A;  4GP2 A;  5ERM A;  2OPN A;  2J5C A;  5JA0 F;  3WEH A;  3TFV A;  1V4J A;  4N1Z F;  3WEG A;  3P41 A;  3APZ A;  1KIY A;  2F9K F;  2PS7 A;  4KPD A;  2ZCO A;  3ZCD A;  3RBM A;  1YYU A;  4Q23 A;  1VG2 A;  1V4H A;  1V4I A;  3CP6 A;  3NPK A;  3VJD A;  5ILJ A;  2Z50 A;  3WCE A;  4KWD A;  2E95 A;  3KRF A;  4JZX A;  4DHD A;  3V66 A;  5ILI A;  4N9U A;  3SDQ A;  4KVD A;  2EWG A;  1N1B A;  4DWG A;  1KIZ A;  3WJK A;  1PS1 A;  4OMH A;  5IL3 A;  2Z4Z A;  3N1W F;  5DGM F;  2Q9Y A;  3WEI A;  2F92 F;  5E8K A;  3RYE A;  3KRO A;  4RXA A;  1HXC A;  5ER8 A;  4GP1 A;  2E8W A;  5AYP A;  5DZ2 A;  3ICN A;  4RXD A;  4RXE A;  4H5E F;  4P0V A;  5DIQ F;  4JVJ F;  2PS4 A;  5KSX F;  5AHU B;  3EGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...