3LOMA

Crystal structure of geranyltransferase from legionella pneumophila
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
303
structure length
288
Chain Sequence
NSTQMNKQVIDKYTQRHELYLEQLLNEIIIPAPQIRSALHYALFSGGKRIRPILVYLAGDLIDVDQGVLDIIAAALELTHCYSLIHDDLPAMDNDDLRRGKPSCHKAFDEATAILVGDGMQALAIEVLLMRLSPLLPAAQVVAITQVLVNASGISGMVSGQSLDLSELAKSSVTEEQLREIHLLKTGKLILACFEMVLAAQHEVSEQIKSALRTYGKHIGLVFQMQDDYLDLYAPKTTFATLFNKQQLEEEIAVHYQIAMDSLRLFGSKAAALIELTKQLQNRSNLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranyltranstransferase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Transferase
total genus 108
structure length 288
sequence length 303
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3lomA00
2Q9ZA 3ZCDA 5AYPA 5JV1F 3WCDA 4RNQA 2ZCSA 3NPRA 5B02A 1WMWA 2F92F 3WEIA 4QPFA 5IL8A 2PS6A 3G4FA 3DYFA 2E94A 1YHKA 2Q80A 4GAXA 5ILZA 4KVIA 2AZJA 3B7LA 4KQSA 2QISA 4LFEA 4H5EF 2PS4A 3OABB 1WL1A 4GA3A 3ZL6A 3G4DA 5JV2F 4RXCA 3P8RA 2ZY1A 4KKMA 2E8WA 4KVDA 3WCJA 1VG3A 2J1OA 3VJEA 4LLTA 2F89F 3KRPB 2Z50A 1YYRA 1V4JA 4P0VA 2ONHA 3S9VA 3ACWA 5B00A 3WCEA 5HNAA 2Z52A 3LGKA 2E93A 2E8XA 2PS7A 2PS8A 2Z7HA 1FPSA 4F62A 1RQIA 5DHKA 4PVXF 3RMGA 1N22A 2DH4A 2F8CF 3LK5A 1UBXA 2F7MF 4P0XA 5EASA 5EROA 5B0JA 4JXYA 4NUAA 3UCAA 3Q30A 3WEHA 3WEJA 2E8TA 3SAEA 4XQSF 1N1ZA 4KVYA 3VJ8A 2ZCQA 4LFVF 5DGSF 2OA6A 3LLWA 3S4JA 3ZMBA 5ILYA 4LTZA 5E8KA 4ZQ8A 1UBVA 3OACA 3WEKA 4DWBA 4MC8A 5AELA 3KRAA 1HM7A 3RBMA 3ZMCA 1YYTA 3KRCA 5DJPF 3QKCA 3KROB 5ILDA 4KWDA 3WJNA 3ADZA 3APZA 3WJOA 1WY0A 1PS1A 4LA6A 2ZEUA 4L2XF 4RXAA 5ER8A 3N45F 4GP1A 3ICNA 2E90A 3SDRA 1UBWA 1KIYA 1HX9A 3LMDA 2AEKA 5IN8A 2OPNA 4E9ZA 5IMIA 3WCMA 1HXCA 3ZOUA 4DEMF 5HN8A 5E8HA 3V1XA 1N23A 3WCHA 2Z4XA 3NRIA 1VG4A 3AQCB 4GP2A 5E8LA 5A0IA 3ICZA 5ILIA 1EZFA 1YYSA 3ACXA 3NPKA 2O1OA 5IMNA 1RTRA 3ICKA 3M01A 3Q2QA 5DGNF 5DJVF 3AE0A 1N1BA 5JUZF 3KROA 3ID0A 3LDWA 3N6KF 2PS5A 3LEEA 2AELA 2FORA 1N20A 3W7FA 3MAVA 3N46F 4MC0A 1HXAA 3LGZB 5A0JA 2Z4YA 4E1EA 3VJAA 4KUXA 3VJCA 2OGDA 1RQJA 3OACB 5I1UA 3P5PA 4FP4A 3KRAB 1HXGA 3LOMA 3WEGA 3KRCB 3N1WF 4N1ZF 2E8VA 1VG6A 3SDQA 3N5JF 3EGTA 3N3LF 3VJBA 4RXEA 4OMGA 5DW7A 3CKEA 4F6VA 3WCLA 5DGMF 2J5CA 3LVSA 3RYWA 4JVJF 3WCCA 5IL3A 2AZLA 3TFNA 3N1VF 4NG6A 3CP6A 3BNXA 4LOBA 5IMPA 4DWGA 2RAHA 4KVWA 4JXNA 5DJRF 3PDEA 4OMHA 3WSAA 4KK2A 5CG5A 4RXDA 5ERNA 2EWGA 4F6XA 1DI1A 3AQBB 5B01A 1WL2A 1V4HA 5ILHA 3V1VA 2E4OA 2OPMA 4QXSF 2E95A 4KPJA 4DI5A 4LUUA 3WCIA 3WJKA 4H5DF 1KIZA 1DGPA 3IPIA 5AFXA 5B03A 4KPDA 5CG6A 3M0GA 3N49F 4LZCA 3VJ9A 3WEFA 5HN7A 1VG2A 3CC9A 2ZEVA 2Z78A 3KBKA 4FJQA 3SDVA 1ZW5A 3WSBA 4KFAA 5AHUB 3Q1OA 4EA2A 3TC1A 3N0FA 2FTZA 3BNYA 1YJ4A 5IM1A 2H8OA 4PVYF 3EFQA 5EATA 3WCGA 5JV0F 2E91A 3QQVA 4Q23A 1N24A 2Q58A 3PKOA 3LSNA 5ILJA 3RYEA 5IK6A 1VG7A 5DHIA 4N9UA 4LA5A 3N0GA 2E8UA 3N3DA 5KSXF 4NKFA 5DZ2A 4LLSA 4RYPA 3V66A 4DHDA 3IBAA 3TFPA 4JZXA 4XQRF 1WL0A 2E92A 5A0KA 4K10A 5HN9A 5IK0A 5DIQF 2F8ZF 5EAUA 5B0KA 4JZBA 3WC9A 3M02A 1HM4A 4H5CF 4OKZA 4DZWA 4JYXA 4LFGA 3LZ9A 3KRFB 4OKMA 5IK9A 3LJIA 3P8LA 4LZ0A 3ASXA 4LTVA 4UMJA 1JFAA 2ZCRA 5IKAA 1YV5A 4KQUA 3WCAA 3DYGA 1YQ7A 3N5HF 3PH7A 2AZKA 4NFJF 1V4EA 4MC3A 1YYUA 2ZCOA 3TS7A 3M00A 4LPGF 3TFVA 1N21A 5B0MA 3DYHA 5B0IA 5JA0F 2AETA 4OGUA 4P0WA 3WCBA 3KB9A 2VF6A 3ACYA 2Z4WA 4EA0A 4EA1A 2Z4ZA 1YHLA 3OABA 3P5RA 2ONGA 3AQ0A 4E9UA 3SDUA 5B0LA 3KRPA 5IKHA 2Z7IA 2I19A 3KRFA 1JFGA 4KQ5A 4NFKF 1WL3A 1V4IA 4NKEA 4XQTF 3PYAA 5ILKA 4DXJA 3P41A 3M9UA 5IVGA 2F94F 5ERMA 1YHMA 1UBYA 4WK5A 4LPHF 3WCFA 3WE9A 2P1CA 2J1PA 5C05A 3PYBA 4HD1A 4LIXA 3ICMA 1WKZA 1V4KA 3OYRA 3LG5A 4LXWA 3EZ3A 3VJDA 3NF2A 2Q9YA 3SDTA 4NFIF 5H9DA 4LZ3A 1YYQA 2F9KF 2Z4VA 3MZVA 3Q2ZA
chains in the Genus database with same CATH superfamily
2Q9ZA 3ZCDA 5AYPA 5JV1F 3WCDA 4RNQA 2ZCSA 3NPRA 5B02A 1WMWA 2F92F 3WEIA 4QPFA 5IL8A 2PS6A 3G4FA 3DYFA 2E94A 1YHKA 2Q80A 4GAXA 5ILZA 4KVIA 2AZJA 3B7LA 4KQSA 2QISA 4LFEA 4H5EF 2PS4A 3OABB 1WL1A 4GA3A 3ZL6A 3G4DA 5JV2F 4RXCA 3P8RA 2ZY1A 4KKMA 2E8WA 4KVDA 3WCJA 1VG3A 2J1OA 3VJEA 4LLTA 2F89F 3KRPB 2Z50A 1YYRA 1V4JA 4P0VA 2ONHA 3S9VA 3ACWA 5B00A 3WCEA 5HNAA 2Z52A 3LGKA 2E93A 2E8XA 2PS7A 2PS8A 2Z7HA 1FPSA 4F62A 1RQIA 5DHKA 4PVXF 3RMGA 1N22A 2DH4A 2F8CF 3LK5A 1UBXA 2F7MF 4P0XA 5EASA 5EROA 5B0JA 4JXYA 4NUAA 3UCAA 3Q30A 3WEHA 3WEJA 2E8TA 3SAEA 4XQSF 1N1ZA 4KVYA 3VJ8A 2ZCQA 4LFVF 5DGSF 2OA6A 3LLWA 3S4JA 3ZMBA 5ILYA 4LTZA 5E8KA 4ZQ8A 1UBVA 3OACA 3WEKA 4DWBA 4MC8A 5AELA 3KRAA 1HM7A 3RBMA 3ZMCA 1YYTA 3KRCA 5DJPF 3QKCA 3KROB 5ILDA 4KWDA 3WJNA 3ADZA 3APZA 3WJOA 1WY0A 1PS1A 4LA6A 2ZEUA 4L2XF 4RXAA 5ER8A 3N45F 4GP1A 3ICNA 2E90A 3SDRA 1UBWA 1KIYA 1HX9A 3LMDA 2AEKA 5IN8A 2OPNA 4E9ZA 5IMIA 3WCMA 1HXCA 3ZOUA 4DEMF 5HN8A 5E8HA 3V1XA 1N23A 3WCHA 2Z4XA 3NRIA 1VG4A 3AQCB 4GP2A 5E8LA 5A0IA 3ICZA 5ILIA 1EZFA 1YYSA 3ACXA 3NPKA 2O1OA 5IMNA 1RTRA 3ICKA 3M01A 3Q2QA 5DGNF 5DJVF 3AE0A 1N1BA 5JUZF 3KROA 3ID0A 3LDWA 3N6KF 2PS5A 3LEEA 2AELA 2FORA 1N20A 3W7FA 3MAVA 3N46F 4MC0A 1HXAA 3LGZB 5A0JA 2Z4YA 4E1EA 3VJAA 4KUXA 3VJCA 2OGDA 1RQJA 3OACB 5I1UA 3P5PA 4FP4A 3KRAB 1HXGA 3LOMA 3WEGA 3KRCB 3N1WF 4N1ZF 2E8VA 1VG6A 3SDQA 3N5JF 3EGTA 3N3LF 3VJBA 4RXEA 4OMGA 5DW7A 3CKEA 4F6VA 3WCLA 5DGMF 2J5CA 3LVSA 3RYWA 4JVJF 3WCCA 5IL3A 2AZLA 3TFNA 3N1VF 4NG6A 3CP6A 3BNXA 4LOBA 5IMPA 4DWGA 2RAHA 4KVWA 4JXNA 5DJRF 3PDEA 4OMHA 3WSAA 4KK2A 5CG5A 4RXDA 5ERNA 2EWGA 4F6XA 1DI1A 3AQBB 5B01A 1WL2A 1V4HA 5ILHA 3V1VA 2E4OA 2OPMA 4QXSF 2E95A 4KPJA 4DI5A 4LUUA 3WCIA 3WJKA 4H5DF 1KIZA 1DGPA 3IPIA 5AFXA 5B03A 4KPDA 5CG6A 3M0GA 3N49F 4LZCA 3VJ9A 3WEFA 5HN7A 1VG2A 3CC9A 2ZEVA 2Z78A 3KBKA 4FJQA 3SDVA 1ZW5A 3WSBA 4KFAA 5AHUB 3Q1OA 4EA2A 3TC1A 3N0FA 2FTZA 3BNYA 1YJ4A 5IM1A 2H8OA 4PVYF 3EFQA 5EATA 3WCGA 5JV0F 2E91A 3QQVA 4Q23A 1N24A 2Q58A 3PKOA 3LSNA 5ILJA 3RYEA 5IK6A 1VG7A 5DHIA 4N9UA 4LA5A 3N0GA 2E8UA 3N3DA 5KSXF 4NKFA 5DZ2A 4LLSA 4RYPA 3V66A 4DHDA 3IBAA 3TFPA 4JZXA 4XQRF 1WL0A 2E92A 5A0KA 4K10A 5HN9A 5IK0A 5DIQF 2F8ZF 5EAUA 5B0KA 4JZBA 3WC9A 3M02A 1HM4A 4H5CF 4OKZA 4DZWA 4JYXA 4LFGA 3LZ9A 3KRFB 4OKMA 5IK9A 3LJIA 3P8LA 4LZ0A 3ASXA 4LTVA 4UMJA 1JFAA 2ZCRA 5IKAA 1YV5A 4KQUA 3WCAA 3DYGA 1YQ7A 3N5HF 3PH7A 2AZKA 4NFJF 1V4EA 4MC3A 1YYUA 2ZCOA 3TS7A 3M00A 4LPGF 3TFVA 1N21A 5B0MA 3DYHA 5B0IA 5JA0F 2AETA 4OGUA 4P0WA 3WCBA 3KB9A 2VF6A 3ACYA 2Z4WA 4EA0A 4EA1A 2Z4ZA 1YHLA 3OABA 3P5RA 2ONGA 3AQ0A 4E9UA 3SDUA 5B0LA 3KRPA 5IKHA 2Z7IA 2I19A 3KRFA 1JFGA 4KQ5A 4NFKF 1WL3A 1V4IA 4NKEA 4XQTF 3PYAA 5ILKA 4DXJA 3P41A 3M9UA 5IVGA 2F94F 5ERMA 1YHMA 1UBYA 4WK5A 4LPHF 3WCFA 3WE9A 2P1CA 2J1PA 5C05A 3PYBA 4HD1A 4LIXA 3ICMA 1WKZA 1V4KA 3OYRA 3LG5A 4LXWA 3EZ3A 3VJDA 3NF2A 2Q9YA 3SDTA 4NFIF 5H9DA 4LZ3A 1YYQA 2F9KF 2Z4VA 3MZVA 3Q2ZA
chains in the Genus database with same CATH topology
2Q9ZA 3ZCDA 5AYPA 5JV1F 3WCDA 4RNQA 2ZCSA 3NPRA 5B02A 1WMWA 2F92F 3WEIA 4QPFA 5IL8A 2PS6A 3G4FA 3DYFA 2E94A 1YHKA 2Q80A 4GAXA 5ILZA 4KVIA 2AZJA 3B7LA 4KQSA 2QISA 4LFEA 4H5EF 2PS4A 3OABB 1WL1A 4GA3A 3ZL6A 3G4DA 5JV2F 4RXCA 3P8RA 2ZY1A 4KKMA 2E8WA 4KVDA 3WCJA 1VG3A 2J1OA 3VJEA 4LLTA 2F89F 3KRPB 2Z50A 1YYRA 1V4JA 4P0VA 2ONHA 3S9VA 3ACWA 5B00A 3WCEA 5HNAA 2Z52A 3LGKA 2E93A 2E8XA 2PS7A 2PS8A 2Z7HA 1FPSA 4F62A 1RQIA 5DHKA 4PVXF 3RMGA 1N22A 2DH4A 2F8CF 3LK5A 1UBXA 2F7MF 4P0XA 5EASA 5EROA 5B0JA 4JXYA 4NUAA 3UCAA 3Q30A 3WEHA 3WEJA 2E8TA 3SAEA 4XQSF 1N1ZA 4KVYA 3VJ8A 2ZCQA 4LFVF 5DGSF 2OA6A 3LLWA 3S4JA 3ZMBA 5ILYA 4LTZA 5E8KA 4ZQ8A 1UBVA 3OACA 3WEKA 4DWBA 4MC8A 5AELA 3KRAA 1HM7A 3RBMA 3ZMCA 1YYTA 3KRCA 5DJPF 3QKCA 3KROB 5ILDA 4KWDA 3WJNA 3ADZA 3APZA 3WJOA 1WY0A 1PS1A 4LA6A 2ZEUA 4L2XF 4RXAA 5ER8A 3N45F 4GP1A 3ICNA 2E90A 3SDRA 1UBWA 1KIYA 1HX9A 3LMDA 2AEKA 5IN8A 2OPNA 4E9ZA 5IMIA 3WCMA 1HXCA 3ZOUA 4DEMF 5HN8A 5E8HA 3V1XA 1N23A 3WCHA 2Z4XA 3NRIA 1VG4A 3AQCB 4GP2A 5E8LA 5A0IA 3ICZA 5ILIA 1EZFA 1YYSA 3ACXA 3NPKA 2O1OA 5IMNA 1RTRA 3ICKA 3M01A 3Q2QA 5DGNF 5DJVF 3AE0A 1N1BA 5JUZF 3KROA 3ID0A 3LDWA 3N6KF 2PS5A 3LEEA 2AELA 2FORA 1N20A 3W7FA 3MAVA 3N46F 4MC0A 1HXAA 3LGZB 5A0JA 2Z4YA 4E1EA 3VJAA 4KUXA 3VJCA 2OGDA 1RQJA 3OACB 5I1UA 3P5PA 4FP4A 3KRAB 1HXGA 3LOMA 3WEGA 3KRCB 3N1WF 4N1ZF 2E8VA 1VG6A 3SDQA 3N5JF 3EGTA 3N3LF 3VJBA 4RXEA 4OMGA 5DW7A 3CKEA 4F6VA 3WCLA 5DGMF 2J5CA 3LVSA 3RYWA 4JVJF 3WCCA 5IL3A 2AZLA 3TFNA 3N1VF 4NG6A 3CP6A 3BNXA 4LOBA 5IMPA 4DWGA 2RAHA 4KVWA 4JXNA 5DJRF 3PDEA 4OMHA 3WSAA 4KK2A 5CG5A 4RXDA 5ERNA 2EWGA 4F6XA 1DI1A 3AQBB 5B01A 1WL2A 1V4HA 5ILHA 3V1VA 2E4OA 2OPMA 4QXSF 2E95A 4KPJA 4DI5A 4LUUA 3WCIA 3WJKA 4H5DF 1KIZA 1DGPA 3IPIA 5AFXA 5B03A 4KPDA 5CG6A 3M0GA 3N49F 4LZCA 3VJ9A 3WEFA 5HN7A 1VG2A 3CC9A 2ZEVA 2Z78A 3KBKA 4FJQA 3SDVA 1ZW5A 3WSBA 4KFAA 5AHUB 3Q1OA 4EA2A 3TC1A 3N0FA 2FTZA 3BNYA 1YJ4A 5IM1A 2H8OA 4PVYF 3EFQA 5EATA 3WCGA 5JV0F 2E91A 3QQVA 4Q23A 1N24A 2Q58A 3PKOA 3LSNA 5ILJA 3RYEA 5IK6A 1VG7A 5DHIA 4N9UA 4LA5A 3N0GA 2E8UA 3N3DA 5KSXF 4NKFA 5DZ2A 4LLSA 4RYPA 3V66A 4DHDA 3IBAA 3TFPA 4JZXA 4XQRF 1WL0A 2E92A 5A0KA 4K10A 5HN9A 5IK0A 5DIQF 2F8ZF 5EAUA 5B0KA 4JZBA 3WC9A 3M02A 1HM4A 4H5CF 4OKZA 4DZWA 4JYXA 4LFGA 3LZ9A 3KRFB 4OKMA 5IK9A 3LJIA 3P8LA 4LZ0A 3ASXA 4LTVA 4UMJA 1JFAA 2ZCRA 5IKAA 1YV5A 4KQUA 3WCAA 3DYGA 1YQ7A 3N5HF 3PH7A 2AZKA 4NFJF 1V4EA 4MC3A 1YYUA 2ZCOA 3TS7A 3M00A 4LPGF 3TFVA 1N21A 5B0MA 3DYHA 5B0IA 5JA0F 2AETA 4OGUA 4P0WA 3WCBA 3KB9A 2VF6A 3ACYA 2Z4WA 4EA0A 4EA1A 2Z4ZA 1YHLA 3OABA 3P5RA 2ONGA 3AQ0A 4E9UA 3SDUA 5B0LA 3KRPA 5IKHA 2Z7IA 2I19A 3KRFA 1JFGA 4KQ5A 4NFKF 1WL3A 1V4IA 4NKEA 4XQTF 3PYAA 5ILKA 4DXJA 3P41A 3M9UA 5IVGA 2F94F 5ERMA 1YHMA 1UBYA 4WK5A 4LPHF 3WCFA 3WE9A 2P1CA 2J1PA 5C05A 3PYBA 4HD1A 4LIXA 3ICMA 1WKZA 1V4KA 3OYRA 3LG5A 4LXWA 3EZ3A 3VJDA 3NF2A 2Q9YA 3SDTA 4NFIF 5H9DA 4LZ3A 1YYQA 2F9KF 2Z4VA 3MZVA 3Q2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9Z A;  3ZCD A;  5AYP A;  5JV1 F;  3WCD A;  4RNQ A;  2ZCS A;  3NPR A;  5B02 A;  1WMW A;  2F92 F;  3WEI A;  4QPF A;  5IL8 A;  2PS6 A;  3G4F A;  3DYF A;  2E94 A;  1YHK A;  2Q80 A;  4GAX A;  5ILZ A;  4KVI A;  2AZJ A;  3B7L A;  4KQS A;  2QIS A;  4LFE A;  4H5E F;  2PS4 A;  3OAB B;  1WL1 A;  4GA3 A;  3ZL6 A;  3G4D A;  5JV2 F;  4RXC A;  3P8R A;  2ZY1 A;  4KKM A;  2E8W A;  4KVD A;  3WCJ A;  1VG3 A;  2J1O A;  3VJE A;  4LLT A;  2F89 F;  3KRP B;  2Z50 A;  1YYR A;  1V4J A;  4P0V A;  2ONH A;  3S9V A;  3ACW A;  5B00 A;  3WCE A;  5HNA A;  2Z52 A;  3LGK A;  2E93 A;  2E8X A;  2PS7 A;  2PS8 A;  2Z7H A;  1FPS A;  4F62 A;  1RQI A;  5DHK A;  4PVX F;  3RMG A;  1N22 A;  2DH4 A;  2F8C F;  3LK5 A;  1UBX A;  2F7M F;  4P0X A;  5EAS A;  5ERO A;  5B0J A;  4JXY A;  4NUA A;  3UCA A;  3Q30 A;  3WEH A;  3WEJ A;  2E8T A;  3SAE A;  4XQS F;  1N1Z A;  4KVY A;  3VJ8 A;  2ZCQ A;  4LFV F;  5DGS F;  2OA6 A;  3LLW A;  3S4J A;  3ZMB A;  5ILY A;  4LTZ A;  5E8K A;  4ZQ8 A;  1UBV A;  3OAC A;  3WEK A;  4DWB A;  4MC8 A;  5AEL A;  3KRA A;  1HM7 A;  3RBM A;  3ZMC A;  1YYT A;  3KRC A;  5DJP F;  3QKC A;  3KRO B;  5ILD A;  4KWD A;  3WJN A;  3ADZ A;  3APZ A;  3WJO A;  1WY0 A;  1PS1 A;  4LA6 A;  2ZEU A;  4L2X F;  4RXA A;  5ER8 A;  3N45 F;  4GP1 A;  3ICN A;  2E90 A;  3SDR A;  1UBW A;  1KIY A;  1HX9 A;  3LMD A;  2AEK A;  5IN8 A;  2OPN A;  4E9Z A;  5IMI A;  3WCM A;  1HXC A;  3ZOU A;  4DEM F;  5HN8 A;  5E8H A;  3V1X A;  1N23 A;  3WCH A;  2Z4X A;  3NRI A;  1VG4 A;  3AQC B;  4GP2 A;  5E8L A;  5A0I A;  3ICZ A;  5ILI A;  1EZF A;  1YYS A;  3ACX A;  3NPK A;  2O1O A;  5IMN A;  1RTR A;  3ICK A;  3M01 A;  3Q2Q A;  5DGN F;  5DJV F;  3AE0 A;  1N1B A;  5JUZ F;  3KRO A;  3ID0 A;  3LDW A;  3N6K F;  2PS5 A;  3LEE A;  2AEL A;  2FOR A;  1N20 A;  3W7F A;  3MAV A;  3N46 F;  4MC0 A;  1HXA A;  3LGZ B;  5A0J A;  2Z4Y A;  4E1E A;  3VJA A;  4KUX A;  3VJC A;  2OGD A;  1RQJ A;  3OAC B;  5I1U A;  3P5P A;  4FP4 A;  3KRA B;  1HXG A;  3LOM A;  3WEG A;  3KRC B;  3N1W F;  4N1Z F;  2E8V A;  1VG6 A;  3SDQ A;  3N5J F;  3EGT A;  3N3L F;  3VJB A;  4RXE A;  4OMG A;  5DW7 A;  3CKE A;  4F6V A;  3WCL A;  5DGM F;  2J5C A;  3LVS A;  3RYW A;  4JVJ F;  3WCC A;  5IL3 A;  2AZL A;  3TFN A;  3N1V F;  4NG6 A;  3CP6 A;  3BNX A;  4LOB A;  5IMP A;  4DWG A;  2RAH A;  4KVW A;  4JXN A;  5DJR F;  3PDE A;  4OMH A;  3WSA A;  4KK2 A;  5CG5 A;  4RXD A;  5ERN A;  2EWG A;  4F6X A;  1DI1 A;  3AQB B;  5B01 A;  1WL2 A;  1V4H A;  5ILH A;  3V1V A;  2E4O A;  2OPM A;  4QXS F;  2E95 A;  4KPJ A;  4DI5 A;  4LUU A;  3WCI A;  3WJK A;  4H5D F;  1KIZ A;  1DGP A;  3IPI A;  5AFX A;  5B03 A;  4KPD A;  5CG6 A;  3M0G A;  3N49 F;  4LZC A;  3VJ9 A;  3WEF A;  5HN7 A;  1VG2 A;  3CC9 A;  2ZEV A;  2Z78 A;  3KBK A;  4FJQ A;  3SDV A;  1ZW5 A;  3WSB A;  4KFA A;  5AHU B;  3Q1O A;  4EA2 A;  3TC1 A;  3N0F A;  2FTZ A;  3BNY A;  1YJ4 A;  5IM1 A;  2H8O A;  4PVY F;  3EFQ A;  5EAT A;  3WCG A;  5JV0 F;  2E91 A;  3QQV A;  4Q23 A;  1N24 A;  2Q58 A;  3PKO A;  3LSN A;  5ILJ A;  3RYE A;  5IK6 A;  1VG7 A;  5DHI A;  4N9U A;  4LA5 A;  3N0G A;  2E8U A;  3N3D A;  5KSX F;  4NKF A;  5DZ2 A;  4LLS A;  4RYP A;  3V66 A;  4DHD A;  3IBA A;  3TFP A;  4JZX A;  4XQR F;  1WL0 A;  2E92 A;  5A0K A;  4K10 A;  5HN9 A;  5IK0 A;  5DIQ F;  2F8Z F;  5EAU A;  5B0K A;  4JZB A;  3WC9 A;  3M02 A;  1HM4 A;  4H5C F;  4OKZ A;  4DZW A;  4JYX A;  4LFG A;  3LZ9 A;  3KRF B;  4OKM A;  5IK9 A;  3LJI A;  3P8L A;  4LZ0 A;  3ASX A;  4LTV A;  4UMJ A;  1JFA A;  2ZCR A;  5IKA A;  1YV5 A;  4KQU A;  3WCA A;  3DYG A;  1YQ7 A;  3N5H F;  3PH7 A;  2AZK A;  4NFJ F;  1V4E A;  4MC3 A;  1YYU A;  2ZCO A;  3TS7 A;  3M00 A;  4LPG F;  3TFV A;  1N21 A;  5B0M A;  3DYH A;  5B0I A;  5JA0 F;  2AET A;  4OGU A;  4P0W A;  3WCB A;  3KB9 A;  2VF6 A;  3ACY A;  2Z4W A;  4EA0 A;  4EA1 A;  2Z4Z A;  1YHL A;  3OAB A;  3P5R A;  2ONG A;  3AQ0 A;  4E9U A;  3SDU A;  5B0L A;  3KRP A;  5IKH A;  2Z7I A;  2I19 A;  3KRF A;  1JFG A;  4KQ5 A;  4NFK F;  1WL3 A;  1V4I A;  4NKE A;  4XQT F;  3PYA A;  5ILK A;  4DXJ A;  3P41 A;  3M9U A;  5IVG A;  2F94 F;  5ERM A;  1YHM A;  1UBY A;  4WK5 A;  4LPH F;  3WCF A;  3WE9 A;  2P1C A;  2J1P A;  5C05 A;  3PYB A;  4HD1 A;  4LIX A;  3ICM A;  1WKZ A;  1V4K A;  3OYR A;  3LG5 A;  4LXW A;  3EZ3 A;  3VJD A;  3NF2 A;  2Q9Y A;  3SDT A;  4NFI F;  5H9D A;  4LZ3 A;  1YYQ A;  2F9K F;  2Z4V A;  3MZV A;  3Q2Z A; 
#chains in the Genus database with same CATH topology
 2Q9Z A;  3ZCD A;  5AYP A;  5JV1 F;  3WCD A;  4RNQ A;  2ZCS A;  3NPR A;  5B02 A;  1WMW A;  2F92 F;  3WEI A;  4QPF A;  5IL8 A;  2PS6 A;  3G4F A;  3DYF A;  2E94 A;  1YHK A;  2Q80 A;  4GAX A;  5ILZ A;  4KVI A;  2AZJ A;  3B7L A;  4KQS A;  2QIS A;  4LFE A;  4H5E F;  2PS4 A;  3OAB B;  1WL1 A;  4GA3 A;  3ZL6 A;  3G4D A;  5JV2 F;  4RXC A;  3P8R A;  2ZY1 A;  4KKM A;  2E8W A;  4KVD A;  3WCJ A;  1VG3 A;  2J1O A;  3VJE A;  4LLT A;  2F89 F;  3KRP B;  2Z50 A;  1YYR A;  1V4J A;  4P0V A;  2ONH A;  3S9V A;  3ACW A;  5B00 A;  3WCE A;  5HNA A;  2Z52 A;  3LGK A;  2E93 A;  2E8X A;  2PS7 A;  2PS8 A;  2Z7H A;  1FPS A;  4F62 A;  1RQI A;  5DHK A;  4PVX F;  3RMG A;  1N22 A;  2DH4 A;  2F8C F;  3LK5 A;  1UBX A;  2F7M F;  4P0X A;  5EAS A;  5ERO A;  5B0J A;  4JXY A;  4NUA A;  3UCA A;  3Q30 A;  3WEH A;  3WEJ A;  2E8T A;  3SAE A;  4XQS F;  1N1Z A;  4KVY A;  3VJ8 A;  2ZCQ A;  4LFV F;  5DGS F;  2OA6 A;  3LLW A;  3S4J A;  3ZMB A;  5ILY A;  4LTZ A;  5E8K A;  4ZQ8 A;  1UBV A;  3OAC A;  3WEK A;  4DWB A;  4MC8 A;  5AEL A;  3KRA A;  1HM7 A;  3RBM A;  3ZMC A;  1YYT A;  3KRC A;  5DJP F;  3QKC A;  3KRO B;  5ILD A;  4KWD A;  3WJN A;  3ADZ A;  3APZ A;  3WJO A;  1WY0 A;  1PS1 A;  4LA6 A;  2ZEU A;  4L2X F;  4RXA A;  5ER8 A;  3N45 F;  4GP1 A;  3ICN A;  2E90 A;  3SDR A;  1UBW A;  1KIY A;  1HX9 A;  3LMD A;  2AEK A;  5IN8 A;  2OPN A;  4E9Z A;  5IMI A;  3WCM A;  1HXC A;  3ZOU A;  4DEM F;  5HN8 A;  5E8H A;  3V1X A;  1N23 A;  3WCH A;  2Z4X A;  3NRI A;  1VG4 A;  3AQC B;  4GP2 A;  5E8L A;  5A0I A;  3ICZ A;  5ILI A;  1EZF A;  1YYS A;  3ACX A;  3NPK A;  2O1O A;  5IMN A;  1RTR A;  3ICK A;  3M01 A;  3Q2Q A;  5DGN F;  5DJV F;  3AE0 A;  1N1B A;  5JUZ F;  3KRO A;  3ID0 A;  3LDW A;  3N6K F;  2PS5 A;  3LEE A;  2AEL A;  2FOR A;  1N20 A;  3W7F A;  3MAV A;  3N46 F;  4MC0 A;  1HXA A;  3LGZ B;  5A0J A;  2Z4Y A;  4E1E A;  3VJA A;  4KUX A;  3VJC A;  2OGD A;  1RQJ A;  3OAC B;  5I1U A;  3P5P A;  4FP4 A;  3KRA B;  1HXG A;  3LOM A;  3WEG A;  3KRC B;  3N1W F;  4N1Z F;  2E8V A;  1VG6 A;  3SDQ A;  3N5J F;  3EGT A;  3N3L F;  3VJB A;  4RXE A;  4OMG A;  5DW7 A;  3CKE A;  4F6V A;  3WCL A;  5DGM F;  2J5C A;  3LVS A;  3RYW A;  4JVJ F;  3WCC A;  5IL3 A;  2AZL A;  3TFN A;  3N1V F;  4NG6 A;  3CP6 A;  3BNX A;  4LOB A;  5IMP A;  4DWG A;  2RAH A;  4KVW A;  4JXN A;  5DJR F;  3PDE A;  4OMH A;  3WSA A;  4KK2 A;  5CG5 A;  4RXD A;  5ERN A;  2EWG A;  4F6X A;  1DI1 A;  3AQB B;  5B01 A;  1WL2 A;  1V4H A;  5ILH A;  3V1V A;  2E4O A;  2OPM A;  4QXS F;  2E95 A;  4KPJ A;  4DI5 A;  4LUU A;  3WCI A;  3WJK A;  4H5D F;  1KIZ A;  1DGP A;  3IPI A;  5AFX A;  5B03 A;  4KPD A;  5CG6 A;  3M0G A;  3N49 F;  4LZC A;  3VJ9 A;  3WEF A;  5HN7 A;  1VG2 A;  3CC9 A;  2ZEV A;  2Z78 A;  3KBK A;  4FJQ A;  3SDV A;  1ZW5 A;  3WSB A;  4KFA A;  5AHU B;  3Q1O A;  4EA2 A;  3TC1 A;  3N0F A;  2FTZ A;  3BNY A;  1YJ4 A;  5IM1 A;  2H8O A;  4PVY F;  3EFQ A;  5EAT A;  3WCG A;  5JV0 F;  2E91 A;  3QQV A;  4Q23 A;  1N24 A;  2Q58 A;  3PKO A;  3LSN A;  5ILJ A;  3RYE A;  5IK6 A;  1VG7 A;  5DHI A;  4N9U A;  4LA5 A;  3N0G A;  2E8U A;  3N3D A;  5KSX F;  4NKF A;  5DZ2 A;  4LLS A;  4RYP A;  3V66 A;  4DHD A;  3IBA A;  3TFP A;  4JZX A;  4XQR F;  1WL0 A;  2E92 A;  5A0K A;  4K10 A;  5HN9 A;  5IK0 A;  5DIQ F;  2F8Z F;  5EAU A;  5B0K A;  4JZB A;  3WC9 A;  3M02 A;  1HM4 A;  4H5C F;  4OKZ A;  4DZW A;  4JYX A;  4LFG A;  3LZ9 A;  3KRF B;  4OKM A;  5IK9 A;  3LJI A;  3P8L A;  4LZ0 A;  3ASX A;  4LTV A;  4UMJ A;  1JFA A;  2ZCR A;  5IKA A;  1YV5 A;  4KQU A;  3WCA A;  3DYG A;  1YQ7 A;  3N5H F;  3PH7 A;  2AZK A;  4NFJ F;  1V4E A;  4MC3 A;  1YYU A;  2ZCO A;  3TS7 A;  3M00 A;  4LPG F;  3TFV A;  1N21 A;  5B0M A;  3DYH A;  5B0I A;  5JA0 F;  2AET A;  4OGU A;  4P0W A;  3WCB A;  3KB9 A;  2VF6 A;  3ACY A;  2Z4W A;  4EA0 A;  4EA1 A;  2Z4Z A;  1YHL A;  3OAB A;  3P5R A;  2ONG A;  3AQ0 A;  4E9U A;  3SDU A;  5B0L A;  3KRP A;  5IKH A;  2Z7I A;  2I19 A;  3KRF A;  1JFG A;  4KQ5 A;  4NFK F;  1WL3 A;  1V4I A;  4NKE A;  4XQT F;  3PYA A;  5ILK A;  4DXJ A;  3P41 A;  3M9U A;  5IVG A;  2F94 F;  5ERM A;  1YHM A;  1UBY A;  4WK5 A;  4LPH F;  3WCF A;  3WE9 A;  2P1C A;  2J1P A;  5C05 A;  3PYB A;  4HD1 A;  4LIX A;  3ICM A;  1WKZ A;  1V4K A;  3OYR A;  3LG5 A;  4LXW A;  3EZ3 A;  3VJD A;  3NF2 A;  2Q9Y A;  3SDT A;  4NFI F;  5H9D A;  4LZ3 A;  1YYQ A;  2F9K F;  2Z4V A;  3MZV A;  3Q2Z A; 
#chains in the Genus database with same CATH homology
 2Q9Z A;  3ZCD A;  5AYP A;  5JV1 F;  3WCD A;  4RNQ A;  2ZCS A;  3NPR A;  5B02 A;  1WMW A;  2F92 F;  3WEI A;  4QPF A;  5IL8 A;  2PS6 A;  3G4F A;  3DYF A;  2E94 A;  1YHK A;  2Q80 A;  4GAX A;  5ILZ A;  4KVI A;  2AZJ A;  3B7L A;  4KQS A;  2QIS A;  4LFE A;  4H5E F;  2PS4 A;  3OAB B;  1WL1 A;  4GA3 A;  3ZL6 A;  3G4D A;  5JV2 F;  4RXC A;  3P8R A;  2ZY1 A;  4KKM A;  2E8W A;  4KVD A;  3WCJ A;  1VG3 A;  2J1O A;  3VJE A;  4LLT A;  2F89 F;  3KRP B;  2Z50 A;  1YYR A;  1V4J A;  4P0V A;  2ONH A;  3S9V A;  3ACW A;  5B00 A;  3WCE A;  5HNA A;  2Z52 A;  3LGK A;  2E93 A;  2E8X A;  2PS7 A;  2PS8 A;  2Z7H A;  1FPS A;  4F62 A;  1RQI A;  5DHK A;  4PVX F;  3RMG A;  1N22 A;  2DH4 A;  2F8C F;  3LK5 A;  1UBX A;  2F7M F;  4P0X A;  5EAS A;  5ERO A;  5B0J A;  4JXY A;  4NUA A;  3UCA A;  3Q30 A;  3WEH A;  3WEJ A;  2E8T A;  3SAE A;  4XQS F;  1N1Z A;  4KVY A;  3VJ8 A;  2ZCQ A;  4LFV F;  5DGS F;  2OA6 A;  3LLW A;  3S4J A;  3ZMB A;  5ILY A;  4LTZ A;  5E8K A;  4ZQ8 A;  1UBV A;  3OAC A;  3WEK A;  4DWB A;  4MC8 A;  5AEL A;  3KRA A;  1HM7 A;  3RBM A;  3ZMC A;  1YYT A;  3KRC A;  5DJP F;  3QKC A;  3KRO B;  5ILD A;  4KWD A;  3WJN A;  3ADZ A;  3APZ A;  3WJO A;  1WY0 A;  1PS1 A;  4LA6 A;  2ZEU A;  4L2X F;  4RXA A;  5ER8 A;  3N45 F;  4GP1 A;  3ICN A;  2E90 A;  3SDR A;  1UBW A;  1KIY A;  1HX9 A;  3LMD A;  2AEK A;  5IN8 A;  2OPN A;  4E9Z A;  5IMI A;  3WCM A;  1HXC A;  3ZOU A;  4DEM F;  5HN8 A;  5E8H A;  3V1X A;  1N23 A;  3WCH A;  2Z4X A;  3NRI A;  1VG4 A;  3AQC B;  4GP2 A;  5E8L A;  5A0I A;  3ICZ A;  5ILI A;  1EZF A;  1YYS A;  3ACX A;  3NPK A;  2O1O A;  5IMN A;  1RTR A;  3ICK A;  3M01 A;  3Q2Q A;  5DGN F;  5DJV F;  3AE0 A;  1N1B A;  5JUZ F;  3KRO A;  3ID0 A;  3LDW A;  3N6K F;  2PS5 A;  3LEE A;  2AEL A;  2FOR A;  1N20 A;  3W7F A;  3MAV A;  3N46 F;  4MC0 A;  1HXA A;  3LGZ B;  5A0J A;  2Z4Y A;  4E1E A;  3VJA A;  4KUX A;  3VJC A;  2OGD A;  1RQJ A;  3OAC B;  5I1U A;  3P5P A;  4FP4 A;  3KRA B;  1HXG A;  3LOM A;  3WEG A;  3KRC B;  3N1W F;  4N1Z F;  2E8V A;  1VG6 A;  3SDQ A;  3N5J F;  3EGT A;  3N3L F;  3VJB A;  4RXE A;  4OMG A;  5DW7 A;  3CKE A;  4F6V A;  3WCL A;  5DGM F;  2J5C A;  3LVS A;  3RYW A;  4JVJ F;  3WCC A;  5IL3 A;  2AZL A;  3TFN A;  3N1V F;  4NG6 A;  3CP6 A;  3BNX A;  4LOB A;  5IMP A;  4DWG A;  2RAH A;  4KVW A;  4JXN A;  5DJR F;  3PDE A;  4OMH A;  3WSA A;  4KK2 A;  5CG5 A;  4RXD A;  5ERN A;  2EWG A;  4F6X A;  1DI1 A;  3AQB B;  5B01 A;  1WL2 A;  1V4H A;  5ILH A;  3V1V A;  2E4O A;  2OPM A;  4QXS F;  2E95 A;  4KPJ A;  4DI5 A;  4LUU A;  3WCI A;  3WJK A;  4H5D F;  1KIZ A;  1DGP A;  3IPI A;  5AFX A;  5B03 A;  4KPD A;  5CG6 A;  3M0G A;  3N49 F;  4LZC A;  3VJ9 A;  3WEF A;  5HN7 A;  1VG2 A;  3CC9 A;  2ZEV A;  2Z78 A;  3KBK A;  4FJQ A;  3SDV A;  1ZW5 A;  3WSB A;  4KFA A;  5AHU B;  3Q1O A;  4EA2 A;  3TC1 A;  3N0F A;  2FTZ A;  3BNY A;  1YJ4 A;  5IM1 A;  2H8O A;  4PVY F;  3EFQ A;  5EAT A;  3WCG A;  5JV0 F;  2E91 A;  3QQV A;  4Q23 A;  1N24 A;  2Q58 A;  3PKO A;  3LSN A;  5ILJ A;  3RYE A;  5IK6 A;  1VG7 A;  5DHI A;  4N9U A;  4LA5 A;  3N0G A;  2E8U A;  3N3D A;  5KSX F;  4NKF A;  5DZ2 A;  4LLS A;  4RYP A;  3V66 A;  4DHD A;  3IBA A;  3TFP A;  4JZX A;  4XQR F;  1WL0 A;  2E92 A;  5A0K A;  4K10 A;  5HN9 A;  5IK0 A;  5DIQ F;  2F8Z F;  5EAU A;  5B0K A;  4JZB A;  3WC9 A;  3M02 A;  1HM4 A;  4H5C F;  4OKZ A;  4DZW A;  4JYX A;  4LFG A;  3LZ9 A;  3KRF B;  4OKM A;  5IK9 A;  3LJI A;  3P8L A;  4LZ0 A;  3ASX A;  4LTV A;  4UMJ A;  1JFA A;  2ZCR A;  5IKA A;  1YV5 A;  4KQU A;  3WCA A;  3DYG A;  1YQ7 A;  3N5H F;  3PH7 A;  2AZK A;  4NFJ F;  1V4E A;  4MC3 A;  1YYU A;  2ZCO A;  3TS7 A;  3M00 A;  4LPG F;  3TFV A;  1N21 A;  5B0M A;  3DYH A;  5B0I A;  5JA0 F;  2AET A;  4OGU A;  4P0W A;  3WCB A;  3KB9 A;  2VF6 A;  3ACY A;  2Z4W A;  4EA0 A;  4EA1 A;  2Z4Z A;  1YHL A;  3OAB A;  3P5R A;  2ONG A;  3AQ0 A;  4E9U A;  3SDU A;  5B0L A;  3KRP A;  5IKH A;  2Z7I A;  2I19 A;  3KRF A;  1JFG A;  4KQ5 A;  4NFK F;  1WL3 A;  1V4I A;  4NKE A;  4XQT F;  3PYA A;  5ILK A;  4DXJ A;  3P41 A;  3M9U A;  5IVG A;  2F94 F;  5ERM A;  1YHM A;  1UBY A;  4WK5 A;  4LPH F;  3WCF A;  3WE9 A;  2P1C A;  2J1P A;  5C05 A;  3PYB A;  4HD1 A;  4LIX A;  3ICM A;  1WKZ A;  1V4K A;  3OYR A;  3LG5 A;  4LXW A;  3EZ3 A;  3VJD A;  3NF2 A;  2Q9Y A;  3SDT A;  4NFI F;  5H9D A;  4LZ3 A;  1YYQ A;  2F9K F;  2Z4V A;  3MZV A;  3Q2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...