3LOMA

Crystal structure of geranyltransferase from legionella pneumophila
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
303
structure length
288
Chain Sequence
NSTQMNKQVIDKYTQRHELYLEQLLNEIIIPAPQIRSALHYALFSGGKRIRPILVYLAGDLIDVDQGVLDIIAAALELTHCYSLIHDDLPAMDNDDLRRGKPSCHKAFDEATAILVGDGMQALAIEVLLMRLSPLLPAAQVVAITQVLVNASGISGMVSGQSLDLSELAKSSVTEEQLREIHLLKTGKLILACFEMVLAAQHEVSEQIKSALRTYGKHIGLVFQMQDDYLDLYAPKTTFATLFNKQQLEEEIAVHYQIAMDSLRLFGSKAAALIELTKQLQNRSNLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 108
structure length 288
sequence length 303
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3lomA00
5EAUA 2ONGA 4DWGA 3AQCB 3N1WF 4LUUA 4PVXF 3ZCDA 3CP6A 2Z4VA 1UBXA 4H5CF 1HX9A 3ADZA 4KQSA 5HNAA 1N20A 4KUXA 4UMJA 3WCLA 3SDRA 3NF2A 5E8KA 2VF6A 3LZ9A 2H8OA 2ONHA 5DGMF 3PYAA 1FPSA 2F89F 1HXCA 2Z7HA 4OKMA 5IMNA 3KRPA 4GA3A 4RXDA 3BNXA 4GAXA 3KROA 5ILIA 3WCEA 3M0GA 4KPDA 2E8VA 3V1XA 5C05A 1DGPA 3ZMBA 4NKFA 2OGDA 1JFAA 3Q2ZA 3VJ9A 2Q9ZA 4N9UA 5A0JA 5IM1A 2F7MF 4OMHA 3KRAA 5I1UA 3WCHA 4DI5A 3ASXA 3AE0A 1VG7A 4KVYA 1VG2A 3P41A 5DZ2A 1VG6A 3DYHA 5JV2F 4K10A 3NPRA 4LFGA 2E92A 4KVDA 3G4DA 4LTVA 5AFXA 3V66A 1N24A 5ERMA 2ZCRA 5IL3A 5AELA 1N1ZA 4H5EF 4P0WA 1VG4A 5DIQF 4JXYA 3P8RA 3EGTA 4RNQA 2I19A 2PS8A 3LK5A 5CG5A 3ZMCA 3P5PA 2RAHA 4EA2A 3OACA 5B02A 4LA5A 2ZY1A 4OKZA 4F6XA 4RXEA 2E8WA 4DZWA 4F62A 5IKHA 2ZEUA 3OABA 3WEKA 4OMGA 3AQ0A 1VG3A 4NFKF 4N1ZF 1DI1A 3WJNA 2EWGA 2J1PA 5ER8A 3ICKA 4JZXA 4NFIF 3CKEA 3LGZB 3LOMA 1ZW5A 3N46F 2PS7A 3S4JA 5DGSF 4LXWA 2AEKA 3ACXA 3WE9A 1V4HA 1N22A 3LEEA 4HD1A 1WL1A 5H9DA 3N0FA 4KQ5A 4MC3A 4RXAA 5DJPF 1HM4A 1N23A 4JXNA 3RYEA 5IMPA 5DGNF 4XQTF 3PKOA 3KB9A 3W7FA 2Z4ZA 4KFAA 1YHMA 3TS7A 1HXGA 3KRPB 5IMIA 5IK0A 2Q9YA 5IKAA 3SDUA 3LGKA 3KROB 2Z78A 4ZQ8A 1WKZA 5ILKA 4EA1A 3N3LF 5EASA 1V4EA 3ACWA 3NRIA 1RQIA 2DH4A 4L2XF 3BNYA 1YYUA 2AZKA 1WL0A 2ZCQA 3P5RA 3SDTA 5E8LA 3RBMA 4NG6A 3QQVA 4EA0A 3WC9A 2F9KF 3M02A 3EFQA 4LZ3A 3KRFA 5B0LA 4LLTA 3VJBA 3UCAA 5IN8A 1HXAA 4MC8A 3WCIA 2Q80A 3WEFA 5DJRF 1V4KA 1RQJA 2E4OA 1UBVA 2E93A 2Z52A 4E9ZA 2O1OA 4RYPA 5ILDA 2E8UA 1YYQA 5ILYA 5IL8A 3WEHA 3N45F 4DEMF 3M00A 2E8TA 3OACB 2PS6A 4GP1A 5A0KA 2AZLA 4LPGF 3RYWA 2E90A 4F6VA 1KIZA 3ZL6A 2F94F 2F92F 5B0IA 4E1EA 2E94A 3KRCA 3VJCA 4JVJF 3N6KF 3PYBA 4LFEA 3G4FA 4LIXA 4QXSF 3RMGA 3M9UA 4KPJA 1RTRA 4KWDA 1YYRA 2PS5A 3M01A 5JV0F 1WY0A 4FJQA 2J5CA 4JYXA 4H5DF 4DXJA 2J1OA 4DWBA 2ZCOA 3N5JF 3Q2QA 4LPHF 5EATA 3WJOA 3ACYA 4KQUA 2Z4YA 4XQSF 4NFJF 3MZVA 4DHDA 4NKEA 3ID0A 5AYPA 4QPFA 3WCCA 3EZ3A 2PS4A 2AELA 4Q23A 3WSAA 5ILJA 3SAEA 2QISA 2E91A 5JA0F 5B0KA 3IBAA 3WEGA 1YJ4A 5B0JA 1UBYA 4KKMA 3ICZA 3LVSA 3VJ8A 4LTZA 5JUZF 3N49F 3DYFA 1KIYA 5CG6A 1UBWA 3WEJA 3WCAA 3LSNA 1YQ7A 4WK5A 3PDEA 4LZCA 3KRAB 3KRFB 2P1CA 2F8CF 1YYSA 2E95A 4NUAA 3TFVA 3V1VA 4LZ0A 4LA6A 1JFGA 5HN9A 4P0XA 3WCFA 2OPMA 3DYGA 3VJDA 1WL3A 5A0IA 4E9UA 2ZEVA 3LG5A 2Z50A 5B03A 1WMWA 5KSXF 4RXCA 1YHLA 1WL2A 3MAVA 3OYRA 5DHIA 3WCBA 4LFVF 3N0GA 2Z4XA 3WCJA 4FP4A 4JZBA 3WSBA 3TFNA 3Q30A 3QKCA 3KRCB 3Q1OA 2FORA 2FTZA 4P0VA 5EROA 5B0MA 3KBKA 2OA6A 3OABB 1YV5A 4KVIA 1PS1A 5B01A 3ICMA 3WEIA 5B00A 1YYTA 4MC0A 3LJIA 1HM7A 2Z4WA 4XQRF 1N1BA 3S9VA 3VJEA 5ILHA 5IK9A 2E8XA 3SDVA 4PVYF 3WCMA 4LLSA 2Z7IA 3ICNA 4LOBA 2OPNA 3SDQA 1V4IA 1N21A 3WJKA 3NPKA 1EZFA 3IPIA 5AHUB 4KVWA 5E8HA 3WCGA 1V4JA 3PH7A 3P8LA 3N5HF 5ERNA 2AZJA 5IK6A 5JV1F 3AQBB 3N3DA 5DJVF 4KK2A 5DW7A 5DHKA 3TFPA 5HN8A 4GP2A 4OGUA 5ILZA 5IVGA 1YHKA 3TC1A 2ZCSA 3B7LA 2AETA 2F8ZF 3LDWA 3ZOUA 3CC9A 3WCDA 3LLWA 3N1VF 5HN7A 3VJAA 3LMDA 2Q58A 3APZA
chains in the Genus database with same CATH superfamily
5EAUA 2ONGA 4DWGA 3AQCB 3N1WF 4LUUA 4PVXF 3ZCDA 3CP6A 2Z4VA 1UBXA 4H5CF 1HX9A 3ADZA 4KQSA 5HNAA 1N20A 4KUXA 4UMJA 3WCLA 3SDRA 3NF2A 5E8KA 2VF6A 3LZ9A 2H8OA 2ONHA 5DGMF 3PYAA 1FPSA 2F89F 1HXCA 2Z7HA 4OKMA 5IMNA 3KRPA 4GA3A 4RXDA 3BNXA 4GAXA 3KROA 5ILIA 3WCEA 3M0GA 4KPDA 2E8VA 3V1XA 5C05A 1DGPA 3ZMBA 4NKFA 2OGDA 1JFAA 3Q2ZA 3VJ9A 2Q9ZA 4N9UA 5A0JA 5IM1A 2F7MF 4OMHA 3KRAA 5I1UA 3WCHA 4DI5A 3ASXA 3AE0A 1VG7A 4KVYA 1VG2A 3P41A 5DZ2A 1VG6A 3DYHA 5JV2F 4K10A 3NPRA 4LFGA 2E92A 4KVDA 3G4DA 4LTVA 5AFXA 3V66A 1N24A 5ERMA 2ZCRA 5IL3A 5AELA 1N1ZA 4H5EF 4P0WA 1VG4A 5DIQF 4JXYA 3P8RA 3EGTA 4RNQA 2I19A 2PS8A 3LK5A 5CG5A 3ZMCA 3P5PA 2RAHA 4EA2A 3OACA 5B02A 4LA5A 2ZY1A 4OKZA 4F6XA 4RXEA 2E8WA 4DZWA 4F62A 5IKHA 2ZEUA 3OABA 3WEKA 4OMGA 3AQ0A 1VG3A 4NFKF 4N1ZF 1DI1A 3WJNA 2EWGA 2J1PA 5ER8A 3ICKA 4JZXA 4NFIF 3CKEA 3LGZB 3LOMA 1ZW5A 3N46F 2PS7A 3S4JA 5DGSF 4LXWA 2AEKA 3ACXA 3WE9A 1V4HA 1N22A 3LEEA 4HD1A 1WL1A 5H9DA 3N0FA 4KQ5A 4MC3A 4RXAA 5DJPF 1HM4A 1N23A 4JXNA 3RYEA 5IMPA 5DGNF 4XQTF 3PKOA 3KB9A 3W7FA 2Z4ZA 4KFAA 1YHMA 3TS7A 1HXGA 3KRPB 5IMIA 5IK0A 2Q9YA 5IKAA 3SDUA 3LGKA 3KROB 2Z78A 4ZQ8A 1WKZA 5ILKA 4EA1A 3N3LF 5EASA 1V4EA 3ACWA 3NRIA 1RQIA 2DH4A 4L2XF 3BNYA 1YYUA 2AZKA 1WL0A 2ZCQA 3P5RA 3SDTA 5E8LA 3RBMA 4NG6A 3QQVA 4EA0A 3WC9A 2F9KF 3M02A 3EFQA 4LZ3A 3KRFA 5B0LA 4LLTA 3VJBA 3UCAA 5IN8A 1HXAA 4MC8A 3WCIA 2Q80A 3WEFA 5DJRF 1V4KA 1RQJA 2E4OA 1UBVA 2E93A 2Z52A 4E9ZA 2O1OA 4RYPA 5ILDA 2E8UA 1YYQA 5ILYA 5IL8A 3WEHA 3N45F 4DEMF 3M00A 2E8TA 3OACB 2PS6A 4GP1A 5A0KA 2AZLA 4LPGF 3RYWA 2E90A 4F6VA 1KIZA 3ZL6A 2F94F 2F92F 5B0IA 4E1EA 2E94A 3KRCA 3VJCA 4JVJF 3N6KF 3PYBA 4LFEA 3G4FA 4LIXA 4QXSF 3RMGA 3M9UA 4KPJA 1RTRA 4KWDA 1YYRA 2PS5A 3M01A 5JV0F 1WY0A 4FJQA 2J5CA 4JYXA 4H5DF 4DXJA 2J1OA 4DWBA 2ZCOA 3N5JF 3Q2QA 4LPHF 5EATA 3WJOA 3ACYA 4KQUA 2Z4YA 4XQSF 4NFJF 3MZVA 4DHDA 4NKEA 3ID0A 5AYPA 4QPFA 3WCCA 3EZ3A 2PS4A 2AELA 4Q23A 3WSAA 5ILJA 3SAEA 2QISA 2E91A 5JA0F 5B0KA 3IBAA 3WEGA 1YJ4A 5B0JA 1UBYA 4KKMA 3ICZA 3LVSA 3VJ8A 4LTZA 5JUZF 3N49F 3DYFA 1KIYA 5CG6A 1UBWA 3WEJA 3WCAA 3LSNA 1YQ7A 4WK5A 3PDEA 4LZCA 3KRAB 3KRFB 2P1CA 2F8CF 1YYSA 2E95A 4NUAA 3TFVA 3V1VA 4LZ0A 4LA6A 1JFGA 5HN9A 4P0XA 3WCFA 2OPMA 3DYGA 3VJDA 1WL3A 5A0IA 4E9UA 2ZEVA 3LG5A 2Z50A 5B03A 1WMWA 5KSXF 4RXCA 1YHLA 1WL2A 3MAVA 3OYRA 5DHIA 3WCBA 4LFVF 3N0GA 2Z4XA 3WCJA 4FP4A 4JZBA 3WSBA 3TFNA 3Q30A 3QKCA 3KRCB 3Q1OA 2FORA 2FTZA 4P0VA 5EROA 5B0MA 3KBKA 2OA6A 3OABB 1YV5A 4KVIA 1PS1A 5B01A 3ICMA 3WEIA 5B00A 1YYTA 4MC0A 3LJIA 1HM7A 2Z4WA 4XQRF 1N1BA 3S9VA 3VJEA 5ILHA 5IK9A 2E8XA 3SDVA 4PVYF 3WCMA 4LLSA 2Z7IA 3ICNA 4LOBA 2OPNA 3SDQA 1V4IA 1N21A 3WJKA 3NPKA 1EZFA 3IPIA 5AHUB 4KVWA 5E8HA 3WCGA 1V4JA 3PH7A 3P8LA 3N5HF 5ERNA 2AZJA 5IK6A 5JV1F 3AQBB 3N3DA 5DJVF 4KK2A 5DW7A 5DHKA 3TFPA 5HN8A 4GP2A 4OGUA 5ILZA 5IVGA 1YHKA 3TC1A 2ZCSA 3B7LA 2AETA 2F8ZF 3LDWA 3ZOUA 3CC9A 3WCDA 3LLWA 3N1VF 5HN7A 3VJAA 3LMDA 2Q58A 3APZA
chains in the Genus database with same CATH topology
5EAUA 2ONGA 4DWGA 3AQCB 3N1WF 4LUUA 4PVXF 3ZCDA 3CP6A 2Z4VA 1UBXA 4H5CF 1HX9A 3ADZA 4KQSA 5HNAA 1N20A 4KUXA 4UMJA 3WCLA 3SDRA 3NF2A 5E8KA 2VF6A 3LZ9A 2H8OA 2ONHA 5DGMF 3PYAA 1FPSA 2F89F 1HXCA 2Z7HA 4OKMA 5IMNA 3KRPA 4GA3A 4RXDA 3BNXA 4GAXA 3KROA 5ILIA 3WCEA 3M0GA 4KPDA 2E8VA 3V1XA 5C05A 1DGPA 3ZMBA 4NKFA 2OGDA 1JFAA 3Q2ZA 3VJ9A 2Q9ZA 4N9UA 5A0JA 5IM1A 2F7MF 4OMHA 3KRAA 5I1UA 3WCHA 4DI5A 3ASXA 3AE0A 1VG7A 4KVYA 1VG2A 3P41A 5DZ2A 1VG6A 3DYHA 5JV2F 4K10A 3NPRA 4LFGA 2E92A 4KVDA 3G4DA 4LTVA 5AFXA 3V66A 1N24A 5ERMA 2ZCRA 5IL3A 5AELA 1N1ZA 4H5EF 4P0WA 1VG4A 5DIQF 4JXYA 3P8RA 3EGTA 4RNQA 2I19A 2PS8A 3LK5A 5CG5A 3ZMCA 3P5PA 2RAHA 4EA2A 3OACA 5B02A 4LA5A 2ZY1A 4OKZA 4F6XA 4RXEA 2E8WA 4DZWA 4F62A 5IKHA 2ZEUA 3OABA 3WEKA 4OMGA 3AQ0A 1VG3A 4NFKF 4N1ZF 1DI1A 3WJNA 2EWGA 2J1PA 5ER8A 3ICKA 4JZXA 4NFIF 3CKEA 3LGZB 3LOMA 1ZW5A 3N46F 2PS7A 3S4JA 5DGSF 4LXWA 2AEKA 3ACXA 3WE9A 1V4HA 1N22A 3LEEA 4HD1A 1WL1A 5H9DA 3N0FA 4KQ5A 4MC3A 4RXAA 5DJPF 1HM4A 1N23A 4JXNA 3RYEA 5IMPA 5DGNF 4XQTF 3PKOA 3KB9A 3W7FA 2Z4ZA 4KFAA 1YHMA 3TS7A 1HXGA 3KRPB 5IMIA 5IK0A 2Q9YA 5IKAA 3SDUA 3LGKA 3KROB 2Z78A 4ZQ8A 1WKZA 5ILKA 4EA1A 3N3LF 5EASA 1V4EA 3ACWA 3NRIA 1RQIA 2DH4A 4L2XF 3BNYA 1YYUA 2AZKA 1WL0A 2ZCQA 3P5RA 3SDTA 5E8LA 3RBMA 4NG6A 3QQVA 4EA0A 3WC9A 2F9KF 3M02A 3EFQA 4LZ3A 3KRFA 5B0LA 4LLTA 3VJBA 3UCAA 5IN8A 1HXAA 4MC8A 3WCIA 2Q80A 3WEFA 5DJRF 1V4KA 1RQJA 2E4OA 1UBVA 2E93A 2Z52A 4E9ZA 2O1OA 4RYPA 5ILDA 2E8UA 1YYQA 5ILYA 5IL8A 3WEHA 3N45F 4DEMF 3M00A 2E8TA 3OACB 2PS6A 4GP1A 5A0KA 2AZLA 4LPGF 3RYWA 2E90A 4F6VA 1KIZA 3ZL6A 2F94F 2F92F 5B0IA 4E1EA 2E94A 3KRCA 3VJCA 4JVJF 3N6KF 3PYBA 4LFEA 3G4FA 4LIXA 4QXSF 3RMGA 3M9UA 4KPJA 1RTRA 4KWDA 1YYRA 2PS5A 3M01A 5JV0F 1WY0A 4FJQA 2J5CA 4JYXA 4H5DF 4DXJA 2J1OA 4DWBA 2ZCOA 3N5JF 3Q2QA 4LPHF 5EATA 3WJOA 3ACYA 4KQUA 2Z4YA 4XQSF 4NFJF 3MZVA 4DHDA 4NKEA 3ID0A 5AYPA 4QPFA 3WCCA 3EZ3A 2PS4A 2AELA 4Q23A 3WSAA 5ILJA 3SAEA 2QISA 2E91A 5JA0F 5B0KA 3IBAA 3WEGA 1YJ4A 5B0JA 1UBYA 4KKMA 3ICZA 3LVSA 3VJ8A 4LTZA 5JUZF 3N49F 3DYFA 1KIYA 5CG6A 1UBWA 3WEJA 3WCAA 3LSNA 1YQ7A 4WK5A 3PDEA 4LZCA 3KRAB 3KRFB 2P1CA 2F8CF 1YYSA 2E95A 4NUAA 3TFVA 3V1VA 4LZ0A 4LA6A 1JFGA 5HN9A 4P0XA 3WCFA 2OPMA 3DYGA 3VJDA 1WL3A 5A0IA 4E9UA 2ZEVA 3LG5A 2Z50A 5B03A 1WMWA 5KSXF 4RXCA 1YHLA 1WL2A 3MAVA 3OYRA 5DHIA 3WCBA 4LFVF 3N0GA 2Z4XA 3WCJA 4FP4A 4JZBA 3WSBA 3TFNA 3Q30A 3QKCA 3KRCB 3Q1OA 2FORA 2FTZA 4P0VA 5EROA 5B0MA 3KBKA 2OA6A 3OABB 1YV5A 4KVIA 1PS1A 5B01A 3ICMA 3WEIA 5B00A 1YYTA 4MC0A 3LJIA 1HM7A 2Z4WA 4XQRF 1N1BA 3S9VA 3VJEA 5ILHA 5IK9A 2E8XA 3SDVA 4PVYF 3WCMA 4LLSA 2Z7IA 3ICNA 4LOBA 2OPNA 3SDQA 1V4IA 1N21A 3WJKA 3NPKA 1EZFA 3IPIA 5AHUB 4KVWA 5E8HA 3WCGA 1V4JA 3PH7A 3P8LA 3N5HF 5ERNA 2AZJA 5IK6A 5JV1F 3AQBB 3N3DA 5DJVF 4KK2A 5DW7A 5DHKA 3TFPA 5HN8A 4GP2A 4OGUA 5ILZA 5IVGA 1YHKA 3TC1A 2ZCSA 3B7LA 2AETA 2F8ZF 3LDWA 3ZOUA 3CC9A 3WCDA 3LLWA 3N1VF 5HN7A 3VJAA 3LMDA 2Q58A 3APZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EAU A;  2ONG A;  4DWG A;  3AQC B;  3N1W F;  4LUU A;  4PVX F;  3ZCD A;  3CP6 A;  2Z4V A;  1UBX A;  4H5C F;  1HX9 A;  3ADZ A;  4KQS A;  5HNA A;  1N20 A;  4KUX A;  4UMJ A;  3WCL A;  3SDR A;  3NF2 A;  5E8K A;  2VF6 A;  3LZ9 A;  2H8O A;  2ONH A;  5DGM F;  3PYA A;  1FPS A;  2F89 F;  1HXC A;  2Z7H A;  4OKM A;  5IMN A;  3KRP A;  4GA3 A;  4RXD A;  3BNX A;  4GAX A;  3KRO A;  5ILI A;  3WCE A;  3M0G A;  4KPD A;  2E8V A;  3V1X A;  5C05 A;  1DGP A;  3ZMB A;  4NKF A;  2OGD A;  1JFA A;  3Q2Z A;  3VJ9 A;  2Q9Z A;  4N9U A;  5A0J A;  5IM1 A;  2F7M F;  4OMH A;  3KRA A;  5I1U A;  3WCH A;  4DI5 A;  3ASX A;  3AE0 A;  1VG7 A;  4KVY A;  1VG2 A;  3P41 A;  5DZ2 A;  1VG6 A;  3DYH A;  5JV2 F;  4K10 A;  3NPR A;  4LFG A;  2E92 A;  4KVD A;  3G4D A;  4LTV A;  5AFX A;  3V66 A;  1N24 A;  5ERM A;  2ZCR A;  5IL3 A;  5AEL A;  1N1Z A;  4H5E F;  4P0W A;  1VG4 A;  5DIQ F;  4JXY A;  3P8R A;  3EGT A;  4RNQ A;  2I19 A;  2PS8 A;  3LK5 A;  5CG5 A;  3ZMC A;  3P5P A;  2RAH A;  4EA2 A;  3OAC A;  5B02 A;  4LA5 A;  2ZY1 A;  4OKZ A;  4F6X A;  4RXE A;  2E8W A;  4DZW A;  4F62 A;  5IKH A;  2ZEU A;  3OAB A;  3WEK A;  4OMG A;  3AQ0 A;  1VG3 A;  4NFK F;  4N1Z F;  1DI1 A;  3WJN A;  2EWG A;  2J1P A;  5ER8 A;  3ICK A;  4JZX A;  4NFI F;  3CKE A;  3LGZ B;  3LOM A;  1ZW5 A;  3N46 F;  2PS7 A;  3S4J A;  5DGS F;  4LXW A;  2AEK A;  3ACX A;  3WE9 A;  1V4H A;  1N22 A;  3LEE A;  4HD1 A;  1WL1 A;  5H9D A;  3N0F A;  4KQ5 A;  4MC3 A;  4RXA A;  5DJP F;  1HM4 A;  1N23 A;  4JXN A;  3RYE A;  5IMP A;  5DGN F;  4XQT F;  3PKO A;  3KB9 A;  3W7F A;  2Z4Z A;  4KFA A;  1YHM A;  3TS7 A;  1HXG A;  3KRP B;  5IMI A;  5IK0 A;  2Q9Y A;  5IKA A;  3SDU A;  3LGK A;  3KRO B;  2Z78 A;  4ZQ8 A;  1WKZ A;  5ILK A;  4EA1 A;  3N3L F;  5EAS A;  1V4E A;  3ACW A;  3NRI A;  1RQI A;  2DH4 A;  4L2X F;  3BNY A;  1YYU A;  2AZK A;  1WL0 A;  2ZCQ A;  3P5R A;  3SDT A;  5E8L A;  3RBM A;  4NG6 A;  3QQV A;  4EA0 A;  3WC9 A;  2F9K F;  3M02 A;  3EFQ A;  4LZ3 A;  3KRF A;  5B0L A;  4LLT A;  3VJB A;  3UCA A;  5IN8 A;  1HXA A;  4MC8 A;  3WCI A;  2Q80 A;  3WEF A;  5DJR F;  1V4K A;  1RQJ A;  2E4O A;  1UBV A;  2E93 A;  2Z52 A;  4E9Z A;  2O1O A;  4RYP A;  5ILD A;  2E8U A;  1YYQ A;  5ILY A;  5IL8 A;  3WEH A;  3N45 F;  4DEM F;  3M00 A;  2E8T A;  3OAC B;  2PS6 A;  4GP1 A;  5A0K A;  2AZL A;  4LPG F;  3RYW A;  2E90 A;  4F6V A;  1KIZ A;  3ZL6 A;  2F94 F;  2F92 F;  5B0I A;  4E1E A;  2E94 A;  3KRC A;  3VJC A;  4JVJ F;  3N6K F;  3PYB A;  4LFE A;  3G4F A;  4LIX A;  4QXS F;  3RMG A;  3M9U A;  4KPJ A;  1RTR A;  4KWD A;  1YYR A;  2PS5 A;  3M01 A;  5JV0 F;  1WY0 A;  4FJQ A;  2J5C A;  4JYX A;  4H5D F;  4DXJ A;  2J1O A;  4DWB A;  2ZCO A;  3N5J F;  3Q2Q A;  4LPH F;  5EAT A;  3WJO A;  3ACY A;  4KQU A;  2Z4Y A;  4XQS F;  4NFJ F;  3MZV A;  4DHD A;  4NKE A;  3ID0 A;  5AYP A;  4QPF A;  3WCC A;  3EZ3 A;  2PS4 A;  2AEL A;  4Q23 A;  3WSA A;  5ILJ A;  3SAE A;  2QIS A;  2E91 A;  5JA0 F;  5B0K A;  3IBA A;  3WEG A;  1YJ4 A;  5B0J A;  1UBY A;  4KKM A;  3ICZ A;  3LVS A;  3VJ8 A;  4LTZ A;  5JUZ F;  3N49 F;  3DYF A;  1KIY A;  5CG6 A;  1UBW A;  3WEJ A;  3WCA A;  3LSN A;  1YQ7 A;  4WK5 A;  3PDE A;  4LZC A;  3KRA B;  3KRF B;  2P1C A;  2F8C F;  1YYS A;  2E95 A;  4NUA A;  3TFV A;  3V1V A;  4LZ0 A;  4LA6 A;  1JFG A;  5HN9 A;  4P0X A;  3WCF A;  2OPM A;  3DYG A;  3VJD A;  1WL3 A;  5A0I A;  4E9U A;  2ZEV A;  3LG5 A;  2Z50 A;  5B03 A;  1WMW A;  5KSX F;  4RXC A;  1YHL A;  1WL2 A;  3MAV A;  3OYR A;  5DHI A;  3WCB A;  4LFV F;  3N0G A;  2Z4X A;  3WCJ A;  4FP4 A;  4JZB A;  3WSB A;  3TFN A;  3Q30 A;  3QKC A;  3KRC B;  3Q1O A;  2FOR A;  2FTZ A;  4P0V A;  5ERO A;  5B0M A;  3KBK A;  2OA6 A;  3OAB B;  1YV5 A;  4KVI A;  1PS1 A;  5B01 A;  3ICM A;  3WEI A;  5B00 A;  1YYT A;  4MC0 A;  3LJI A;  1HM7 A;  2Z4W A;  4XQR F;  1N1B A;  3S9V A;  3VJE A;  5ILH A;  5IK9 A;  2E8X A;  3SDV A;  4PVY F;  3WCM A;  4LLS A;  2Z7I A;  3ICN A;  4LOB A;  2OPN A;  3SDQ A;  1V4I A;  1N21 A;  3WJK A;  3NPK A;  1EZF A;  3IPI A;  5AHU B;  4KVW A;  5E8H A;  3WCG A;  1V4J A;  3PH7 A;  3P8L A;  3N5H F;  5ERN A;  2AZJ A;  5IK6 A;  5JV1 F;  3AQB B;  3N3D A;  5DJV F;  4KK2 A;  5DW7 A;  5DHK A;  3TFP A;  5HN8 A;  4GP2 A;  4OGU A;  5ILZ A;  5IVG A;  1YHK A;  3TC1 A;  2ZCS A;  3B7L A;  2AET A;  2F8Z F;  3LDW A;  3ZOU A;  3CC9 A;  3WCD A;  3LLW A;  3N1V F;  5HN7 A;  3VJA A;  3LMD A;  2Q58 A;  3APZ A; 
#chains in the Genus database with same CATH topology
 5EAU A;  2ONG A;  4DWG A;  3AQC B;  3N1W F;  4LUU A;  4PVX F;  3ZCD A;  3CP6 A;  2Z4V A;  1UBX A;  4H5C F;  1HX9 A;  3ADZ A;  4KQS A;  5HNA A;  1N20 A;  4KUX A;  4UMJ A;  3WCL A;  3SDR A;  3NF2 A;  5E8K A;  2VF6 A;  3LZ9 A;  2H8O A;  2ONH A;  5DGM F;  3PYA A;  1FPS A;  2F89 F;  1HXC A;  2Z7H A;  4OKM A;  5IMN A;  3KRP A;  4GA3 A;  4RXD A;  3BNX A;  4GAX A;  3KRO A;  5ILI A;  3WCE A;  3M0G A;  4KPD A;  2E8V A;  3V1X A;  5C05 A;  1DGP A;  3ZMB A;  4NKF A;  2OGD A;  1JFA A;  3Q2Z A;  3VJ9 A;  2Q9Z A;  4N9U A;  5A0J A;  5IM1 A;  2F7M F;  4OMH A;  3KRA A;  5I1U A;  3WCH A;  4DI5 A;  3ASX A;  3AE0 A;  1VG7 A;  4KVY A;  1VG2 A;  3P41 A;  5DZ2 A;  1VG6 A;  3DYH A;  5JV2 F;  4K10 A;  3NPR A;  4LFG A;  2E92 A;  4KVD A;  3G4D A;  4LTV A;  5AFX A;  3V66 A;  1N24 A;  5ERM A;  2ZCR A;  5IL3 A;  5AEL A;  1N1Z A;  4H5E F;  4P0W A;  1VG4 A;  5DIQ F;  4JXY A;  3P8R A;  3EGT A;  4RNQ A;  2I19 A;  2PS8 A;  3LK5 A;  5CG5 A;  3ZMC A;  3P5P A;  2RAH A;  4EA2 A;  3OAC A;  5B02 A;  4LA5 A;  2ZY1 A;  4OKZ A;  4F6X A;  4RXE A;  2E8W A;  4DZW A;  4F62 A;  5IKH A;  2ZEU A;  3OAB A;  3WEK A;  4OMG A;  3AQ0 A;  1VG3 A;  4NFK F;  4N1Z F;  1DI1 A;  3WJN A;  2EWG A;  2J1P A;  5ER8 A;  3ICK A;  4JZX A;  4NFI F;  3CKE A;  3LGZ B;  3LOM A;  1ZW5 A;  3N46 F;  2PS7 A;  3S4J A;  5DGS F;  4LXW A;  2AEK A;  3ACX A;  3WE9 A;  1V4H A;  1N22 A;  3LEE A;  4HD1 A;  1WL1 A;  5H9D A;  3N0F A;  4KQ5 A;  4MC3 A;  4RXA A;  5DJP F;  1HM4 A;  1N23 A;  4JXN A;  3RYE A;  5IMP A;  5DGN F;  4XQT F;  3PKO A;  3KB9 A;  3W7F A;  2Z4Z A;  4KFA A;  1YHM A;  3TS7 A;  1HXG A;  3KRP B;  5IMI A;  5IK0 A;  2Q9Y A;  5IKA A;  3SDU A;  3LGK A;  3KRO B;  2Z78 A;  4ZQ8 A;  1WKZ A;  5ILK A;  4EA1 A;  3N3L F;  5EAS A;  1V4E A;  3ACW A;  3NRI A;  1RQI A;  2DH4 A;  4L2X F;  3BNY A;  1YYU A;  2AZK A;  1WL0 A;  2ZCQ A;  3P5R A;  3SDT A;  5E8L A;  3RBM A;  4NG6 A;  3QQV A;  4EA0 A;  3WC9 A;  2F9K F;  3M02 A;  3EFQ A;  4LZ3 A;  3KRF A;  5B0L A;  4LLT A;  3VJB A;  3UCA A;  5IN8 A;  1HXA A;  4MC8 A;  3WCI A;  2Q80 A;  3WEF A;  5DJR F;  1V4K A;  1RQJ A;  2E4O A;  1UBV A;  2E93 A;  2Z52 A;  4E9Z A;  2O1O A;  4RYP A;  5ILD A;  2E8U A;  1YYQ A;  5ILY A;  5IL8 A;  3WEH A;  3N45 F;  4DEM F;  3M00 A;  2E8T A;  3OAC B;  2PS6 A;  4GP1 A;  5A0K A;  2AZL A;  4LPG F;  3RYW A;  2E90 A;  4F6V A;  1KIZ A;  3ZL6 A;  2F94 F;  2F92 F;  5B0I A;  4E1E A;  2E94 A;  3KRC A;  3VJC A;  4JVJ F;  3N6K F;  3PYB A;  4LFE A;  3G4F A;  4LIX A;  4QXS F;  3RMG A;  3M9U A;  4KPJ A;  1RTR A;  4KWD A;  1YYR A;  2PS5 A;  3M01 A;  5JV0 F;  1WY0 A;  4FJQ A;  2J5C A;  4JYX A;  4H5D F;  4DXJ A;  2J1O A;  4DWB A;  2ZCO A;  3N5J F;  3Q2Q A;  4LPH F;  5EAT A;  3WJO A;  3ACY A;  4KQU A;  2Z4Y A;  4XQS F;  4NFJ F;  3MZV A;  4DHD A;  4NKE A;  3ID0 A;  5AYP A;  4QPF A;  3WCC A;  3EZ3 A;  2PS4 A;  2AEL A;  4Q23 A;  3WSA A;  5ILJ A;  3SAE A;  2QIS A;  2E91 A;  5JA0 F;  5B0K A;  3IBA A;  3WEG A;  1YJ4 A;  5B0J A;  1UBY A;  4KKM A;  3ICZ A;  3LVS A;  3VJ8 A;  4LTZ A;  5JUZ F;  3N49 F;  3DYF A;  1KIY A;  5CG6 A;  1UBW A;  3WEJ A;  3WCA A;  3LSN A;  1YQ7 A;  4WK5 A;  3PDE A;  4LZC A;  3KRA B;  3KRF B;  2P1C A;  2F8C F;  1YYS A;  2E95 A;  4NUA A;  3TFV A;  3V1V A;  4LZ0 A;  4LA6 A;  1JFG A;  5HN9 A;  4P0X A;  3WCF A;  2OPM A;  3DYG A;  3VJD A;  1WL3 A;  5A0I A;  4E9U A;  2ZEV A;  3LG5 A;  2Z50 A;  5B03 A;  1WMW A;  5KSX F;  4RXC A;  1YHL A;  1WL2 A;  3MAV A;  3OYR A;  5DHI A;  3WCB A;  4LFV F;  3N0G A;  2Z4X A;  3WCJ A;  4FP4 A;  4JZB A;  3WSB A;  3TFN A;  3Q30 A;  3QKC A;  3KRC B;  3Q1O A;  2FOR A;  2FTZ A;  4P0V A;  5ERO A;  5B0M A;  3KBK A;  2OA6 A;  3OAB B;  1YV5 A;  4KVI A;  1PS1 A;  5B01 A;  3ICM A;  3WEI A;  5B00 A;  1YYT A;  4MC0 A;  3LJI A;  1HM7 A;  2Z4W A;  4XQR F;  1N1B A;  3S9V A;  3VJE A;  5ILH A;  5IK9 A;  2E8X A;  3SDV A;  4PVY F;  3WCM A;  4LLS A;  2Z7I A;  3ICN A;  4LOB A;  2OPN A;  3SDQ A;  1V4I A;  1N21 A;  3WJK A;  3NPK A;  1EZF A;  3IPI A;  5AHU B;  4KVW A;  5E8H A;  3WCG A;  1V4J A;  3PH7 A;  3P8L A;  3N5H F;  5ERN A;  2AZJ A;  5IK6 A;  5JV1 F;  3AQB B;  3N3D A;  5DJV F;  4KK2 A;  5DW7 A;  5DHK A;  3TFP A;  5HN8 A;  4GP2 A;  4OGU A;  5ILZ A;  5IVG A;  1YHK A;  3TC1 A;  2ZCS A;  3B7L A;  2AET A;  2F8Z F;  3LDW A;  3ZOU A;  3CC9 A;  3WCD A;  3LLW A;  3N1V F;  5HN7 A;  3VJA A;  3LMD A;  2Q58 A;  3APZ A; 
#chains in the Genus database with same CATH homology
 5EAU A;  2ONG A;  4DWG A;  3AQC B;  3N1W F;  4LUU A;  4PVX F;  3ZCD A;  3CP6 A;  2Z4V A;  1UBX A;  4H5C F;  1HX9 A;  3ADZ A;  4KQS A;  5HNA A;  1N20 A;  4KUX A;  4UMJ A;  3WCL A;  3SDR A;  3NF2 A;  5E8K A;  2VF6 A;  3LZ9 A;  2H8O A;  2ONH A;  5DGM F;  3PYA A;  1FPS A;  2F89 F;  1HXC A;  2Z7H A;  4OKM A;  5IMN A;  3KRP A;  4GA3 A;  4RXD A;  3BNX A;  4GAX A;  3KRO A;  5ILI A;  3WCE A;  3M0G A;  4KPD A;  2E8V A;  3V1X A;  5C05 A;  1DGP A;  3ZMB A;  4NKF A;  2OGD A;  1JFA A;  3Q2Z A;  3VJ9 A;  2Q9Z A;  4N9U A;  5A0J A;  5IM1 A;  2F7M F;  4OMH A;  3KRA A;  5I1U A;  3WCH A;  4DI5 A;  3ASX A;  3AE0 A;  1VG7 A;  4KVY A;  1VG2 A;  3P41 A;  5DZ2 A;  1VG6 A;  3DYH A;  5JV2 F;  4K10 A;  3NPR A;  4LFG A;  2E92 A;  4KVD A;  3G4D A;  4LTV A;  5AFX A;  3V66 A;  1N24 A;  5ERM A;  2ZCR A;  5IL3 A;  5AEL A;  1N1Z A;  4H5E F;  4P0W A;  1VG4 A;  5DIQ F;  4JXY A;  3P8R A;  3EGT A;  4RNQ A;  2I19 A;  2PS8 A;  3LK5 A;  5CG5 A;  3ZMC A;  3P5P A;  2RAH A;  4EA2 A;  3OAC A;  5B02 A;  4LA5 A;  2ZY1 A;  4OKZ A;  4F6X A;  4RXE A;  2E8W A;  4DZW A;  4F62 A;  5IKH A;  2ZEU A;  3OAB A;  3WEK A;  4OMG A;  3AQ0 A;  1VG3 A;  4NFK F;  4N1Z F;  1DI1 A;  3WJN A;  2EWG A;  2J1P A;  5ER8 A;  3ICK A;  4JZX A;  4NFI F;  3CKE A;  3LGZ B;  3LOM A;  1ZW5 A;  3N46 F;  2PS7 A;  3S4J A;  5DGS F;  4LXW A;  2AEK A;  3ACX A;  3WE9 A;  1V4H A;  1N22 A;  3LEE A;  4HD1 A;  1WL1 A;  5H9D A;  3N0F A;  4KQ5 A;  4MC3 A;  4RXA A;  5DJP F;  1HM4 A;  1N23 A;  4JXN A;  3RYE A;  5IMP A;  5DGN F;  4XQT F;  3PKO A;  3KB9 A;  3W7F A;  2Z4Z A;  4KFA A;  1YHM A;  3TS7 A;  1HXG A;  3KRP B;  5IMI A;  5IK0 A;  2Q9Y A;  5IKA A;  3SDU A;  3LGK A;  3KRO B;  2Z78 A;  4ZQ8 A;  1WKZ A;  5ILK A;  4EA1 A;  3N3L F;  5EAS A;  1V4E A;  3ACW A;  3NRI A;  1RQI A;  2DH4 A;  4L2X F;  3BNY A;  1YYU A;  2AZK A;  1WL0 A;  2ZCQ A;  3P5R A;  3SDT A;  5E8L A;  3RBM A;  4NG6 A;  3QQV A;  4EA0 A;  3WC9 A;  2F9K F;  3M02 A;  3EFQ A;  4LZ3 A;  3KRF A;  5B0L A;  4LLT A;  3VJB A;  3UCA A;  5IN8 A;  1HXA A;  4MC8 A;  3WCI A;  2Q80 A;  3WEF A;  5DJR F;  1V4K A;  1RQJ A;  2E4O A;  1UBV A;  2E93 A;  2Z52 A;  4E9Z A;  2O1O A;  4RYP A;  5ILD A;  2E8U A;  1YYQ A;  5ILY A;  5IL8 A;  3WEH A;  3N45 F;  4DEM F;  3M00 A;  2E8T A;  3OAC B;  2PS6 A;  4GP1 A;  5A0K A;  2AZL A;  4LPG F;  3RYW A;  2E90 A;  4F6V A;  1KIZ A;  3ZL6 A;  2F94 F;  2F92 F;  5B0I A;  4E1E A;  2E94 A;  3KRC A;  3VJC A;  4JVJ F;  3N6K F;  3PYB A;  4LFE A;  3G4F A;  4LIX A;  4QXS F;  3RMG A;  3M9U A;  4KPJ A;  1RTR A;  4KWD A;  1YYR A;  2PS5 A;  3M01 A;  5JV0 F;  1WY0 A;  4FJQ A;  2J5C A;  4JYX A;  4H5D F;  4DXJ A;  2J1O A;  4DWB A;  2ZCO A;  3N5J F;  3Q2Q A;  4LPH F;  5EAT A;  3WJO A;  3ACY A;  4KQU A;  2Z4Y A;  4XQS F;  4NFJ F;  3MZV A;  4DHD A;  4NKE A;  3ID0 A;  5AYP A;  4QPF A;  3WCC A;  3EZ3 A;  2PS4 A;  2AEL A;  4Q23 A;  3WSA A;  5ILJ A;  3SAE A;  2QIS A;  2E91 A;  5JA0 F;  5B0K A;  3IBA A;  3WEG A;  1YJ4 A;  5B0J A;  1UBY A;  4KKM A;  3ICZ A;  3LVS A;  3VJ8 A;  4LTZ A;  5JUZ F;  3N49 F;  3DYF A;  1KIY A;  5CG6 A;  1UBW A;  3WEJ A;  3WCA A;  3LSN A;  1YQ7 A;  4WK5 A;  3PDE A;  4LZC A;  3KRA B;  3KRF B;  2P1C A;  2F8C F;  1YYS A;  2E95 A;  4NUA A;  3TFV A;  3V1V A;  4LZ0 A;  4LA6 A;  1JFG A;  5HN9 A;  4P0X A;  3WCF A;  2OPM A;  3DYG A;  3VJD A;  1WL3 A;  5A0I A;  4E9U A;  2ZEV A;  3LG5 A;  2Z50 A;  5B03 A;  1WMW A;  5KSX F;  4RXC A;  1YHL A;  1WL2 A;  3MAV A;  3OYR A;  5DHI A;  3WCB A;  4LFV F;  3N0G A;  2Z4X A;  3WCJ A;  4FP4 A;  4JZB A;  3WSB A;  3TFN A;  3Q30 A;  3QKC A;  3KRC B;  3Q1O A;  2FOR A;  2FTZ A;  4P0V A;  5ERO A;  5B0M A;  3KBK A;  2OA6 A;  3OAB B;  1YV5 A;  4KVI A;  1PS1 A;  5B01 A;  3ICM A;  3WEI A;  5B00 A;  1YYT A;  4MC0 A;  3LJI A;  1HM7 A;  2Z4W A;  4XQR F;  1N1B A;  3S9V A;  3VJE A;  5ILH A;  5IK9 A;  2E8X A;  3SDV A;  4PVY F;  3WCM A;  4LLS A;  2Z7I A;  3ICN A;  4LOB A;  2OPN A;  3SDQ A;  1V4I A;  1N21 A;  3WJK A;  3NPK A;  1EZF A;  3IPI A;  5AHU B;  4KVW A;  5E8H A;  3WCG A;  1V4J A;  3PH7 A;  3P8L A;  3N5H F;  5ERN A;  2AZJ A;  5IK6 A;  5JV1 F;  3AQB B;  3N3D A;  5DJV F;  4KK2 A;  5DW7 A;  5DHK A;  3TFP A;  5HN8 A;  4GP2 A;  4OGU A;  5ILZ A;  5IVG A;  1YHK A;  3TC1 A;  2ZCS A;  3B7L A;  2AET A;  2F8Z F;  3LDW A;  3ZOU A;  3CC9 A;  3WCD A;  3LLW A;  3N1V F;  5HN7 A;  3VJA A;  3LMD A;  2Q58 A;  3APZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...