3EFQA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-714
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
367
structure length
358
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl pyrophosphate synthase
publication title Lipophilic bisphosphonates as dual farnesyl/geranylgeranyl diphosphate synthase inhibitors: an X-ray and NMR investigation.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 147
structure length 358
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2008-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3efqA00
5DZ2A 5ILHA 3EGTA 5JV0F 3V1VA 4JXYA 4LUUA 2F94F 4RNQA 4XQSF 3N0FA 4F6VA 3ACXA 2Z78A 5DJVF 5B0JA 2OPMA 1RQIA 4DXJA 3AQCB 3NF2A 5IKAA 4DZWA 3WJKA 3WCMA 3LGZB 3AE0A 3OYRA 4LFGA 1WL3A 5EASA 5EATA 5B01A 3W7FA 3MZVA 2PS7A 3KB9A 1UBYA 4FP4A 4LTVA 5C05A 4NFKF 5A0IA 1N20A 3ACWA 5EAUA 2E4OA 3SAEA 3G4FA 3RYWA 5ILKA 4JZBA 4QXSF 1HXAA 3KRFB 5IMIA 4RYPA 1WMWA 4PVYF 4EA1A 3ZMCA 2ZCQA 4UMJA 1RTRA 4KQSA 5IL8A 3NPKA 2PS4A 3WJOA 3KRPA 5B0LA 4KPJA 5JA0F 3Q1OA 3WEGA 3LOMA 2E8VA 4HD1A 2I19A 3ASXA 3OACA 5B00A 3KBKA 4OMGA 4ZQ8A 3WSAA 4JZXA 4OMHA 3ZMBA 3TS7A 3LZ9A 3VJAA 2ZCSA 4FJQA 3N0GA 3BNXA 2E95A 3AQBB 4F62A 2Z4XA 5CG6A 3RMGA 3LK5A 3SDRA 1YJ4A 5DGSF 4GA3A 3N46F 4NKEA 3VJ8A 4L2XF 1YYSA 2E90A 1N1ZA 2ZCRA 3S4JA 2Z4YA 3KRPB 2AELA 1YV5A 2FTZA 2O1OA 4NFIF 3N5HF 2QISA 5DGNF 1WL1A 4LFEA 3WCBA 3OACB 2E92A 1N24A 3LG5A 5DJRF 5HN9A 1KIZA 5E8HA 3WCFA 2EWGA 4XQTF 4QPFA 4JYXA 3RYEA 2E8XA 4E1EA 2ONGA 3LVSA 5A0JA 4RXEA 4OGUA 5HNAA 1HXGA 4LLTA 3ICZA 3CP6A 5IK9A 3QKCA 5ILYA 3M9UA 3DYGA 3WJNA 5AYPA 2ZEVA 4NKFA 4LA6A 3V1XA 5E8LA 3Q2ZA 3WCJA 1V4HA 4NFJF 3WEKA 1WKZA 3ADZA 3KRAA 4E9ZA 2AETA 2AZJA 4KK2A 2Z50A 5IMPA 3UCAA 4LXWA 3BNYA 4N9UA 3LDWA 4WK5A 3WEFA 3ACYA 4PVXF 2Q80A 1WL0A 2F92F 3G4DA 1ZW5A 3B7LA 3Q2QA 4LZ0A 4H5EF 4P0WA 2Q9ZA 3SDUA 3M01A 2OA6A 3Q30A 3SDQA 2E93A 3KRAB 1UBXA 3PYBA 1JFGA 4KPDA 3LMDA 5DW7A 5HN8A 3WC9A 1UBVA 5B03A 3P5PA 4H5DF 3WCHA 2H8OA 3PYAA 4DEMF 2Q9YA 4H5CF 1V4KA 2F89F 1JFAA 3ICNA 2E8TA 3PDEA 3SDTA 3WCCA 1KIYA 4XQRF 3DYHA 3WCIA 2F9KF 2F8ZF 1RQJA 3VJBA 5IN8A 3WCDA 1FPSA 3TFPA 4DWBA 3WEIA 5IL3A 1V4IA 1YYTA 2Z7HA 2ONHA 3MAVA 2AEKA 4KVWA 4MC8A 4JVJF 4MC0A 1N22A 2E8WA 3KROA 2E94A 4LZCA 1V4JA 3N1WF 4JXNA 1YYQA 4LIXA 5AELA 5DGMF 5HN7A 1VG3A 2AZLA 4GP2A 5AHUB 3CKEA 1HM7A 3N6KF 4DWGA 5IVGA 5IKHA 2J1PA 5I1UA 1YHMA 3EFQA 1WL2A 4LPHF 3APZA 5IMNA 3TFVA 5ILZA 4E9UA 2Z52A 3LSNA 3IPIA 5ERMA 1EZFA 3ZOUA 4LLSA 3KROB 3RBMA 5B02A 1VG4A 4KVYA 3S9VA 3WEJA 5B0KA 3LJIA 2J5CA 2Z4WA 5DIQF 2Z4ZA 1V4EA 3KRCA 1YHLA 2OPNA 2PS5A 3VJ9A 4K10A 1DGPA 4KVDA 2ZEUA 3IBAA 5DHKA 1VG6A 3ICKA 3PKOA 4LPGF 3WCAA 2E91A 4F6XA 3PH7A 4P0XA 3OABA 2DH4A 3VJCA 3VJEA 3V66A 2P1CA 5A0KA 3AQ0A 2ZY1A 1HX9A 2OGDA 4LA5A 3ICMA 4KKMA 5B0MA 3WCLA 2FORA 3KRCB 4DI5A 4OKMA 3LLWA 4DHDA 3ID0A 5DJPF 4EA2A 4RXAA 3N3DA 5ERNA 2Z4VA 2Z7IA 2E8UA 4KQ5A 3M00A 3NPRA 4KVIA 4RXDA 2F8CF 4MC3A 3OABB 2VF6A 3ZL6A 3TFNA 5ILJA 2J1OA 1N1BA 1HXCA 5IM1A 3ZCDA 5E8KA 1N23A 2PS8A 1DI1A 5DHIA 5CG5A 2PS6A 4NUAA 5B0IA 5ILDA 5ILIA 2Q58A 3NRIA 5JUZF 4LFVF 1HM4A 5EROA 1VG7A 3N1VF 4EA0A 3CC9A 3P8RA 4KFAA 5H9DA 5KSXF 4KWDA 3P41A 1YHKA 3N3LF 4GP1A 3M02A 3LEEA 2RAHA 3M0GA 4Q23A 4N1ZF 3WCEA 1WY0A 1YYRA 3QQVA 3DYFA 3WSBA 3TC1A 4LZ3A 5IK0A 3WCGA 4LTZA 3SDVA 4NG6A 2F7MF 4GAXA 5JV2F 4KUXA 3N45F 4OKZA 1YYUA 1N21A 4KQUA 5JV1F 2ZCOA 2AZKA 3P8LA 3N5JF 4LOBA 5IK6A 3VJDA 1UBWA 3LGKA 1YQ7A 3EZ3A 5ER8A 4P0VA 3WE9A 4RXCA 1PS1A 1VG2A 3WEHA 5AFXA 3KRFA 3P5RA 3N49F
chains in the Genus database with same CATH superfamily
5DZ2A 5ILHA 3EGTA 5JV0F 3V1VA 4JXYA 4LUUA 2F94F 4RNQA 4XQSF 3N0FA 4F6VA 3ACXA 2Z78A 5DJVF 5B0JA 2OPMA 1RQIA 4DXJA 3AQCB 3NF2A 5IKAA 4DZWA 3WJKA 3WCMA 3LGZB 3AE0A 3OYRA 4LFGA 1WL3A 5EASA 5EATA 5B01A 3W7FA 3MZVA 2PS7A 3KB9A 1UBYA 4FP4A 4LTVA 5C05A 4NFKF 5A0IA 1N20A 3ACWA 5EAUA 2E4OA 3SAEA 3G4FA 3RYWA 5ILKA 4JZBA 4QXSF 1HXAA 3KRFB 5IMIA 4RYPA 1WMWA 4PVYF 4EA1A 3ZMCA 2ZCQA 4UMJA 1RTRA 4KQSA 5IL8A 3NPKA 2PS4A 3WJOA 3KRPA 5B0LA 4KPJA 5JA0F 3Q1OA 3WEGA 3LOMA 2E8VA 4HD1A 2I19A 3ASXA 3OACA 5B00A 3KBKA 4OMGA 4ZQ8A 3WSAA 4JZXA 4OMHA 3ZMBA 3TS7A 3LZ9A 3VJAA 2ZCSA 4FJQA 3N0GA 3BNXA 2E95A 3AQBB 4F62A 2Z4XA 5CG6A 3RMGA 3LK5A 3SDRA 1YJ4A 5DGSF 4GA3A 3N46F 4NKEA 3VJ8A 4L2XF 1YYSA 2E90A 1N1ZA 2ZCRA 3S4JA 2Z4YA 3KRPB 2AELA 1YV5A 2FTZA 2O1OA 4NFIF 3N5HF 2QISA 5DGNF 1WL1A 4LFEA 3WCBA 3OACB 2E92A 1N24A 3LG5A 5DJRF 5HN9A 1KIZA 5E8HA 3WCFA 2EWGA 4XQTF 4QPFA 4JYXA 3RYEA 2E8XA 4E1EA 2ONGA 3LVSA 5A0JA 4RXEA 4OGUA 5HNAA 1HXGA 4LLTA 3ICZA 3CP6A 5IK9A 3QKCA 5ILYA 3M9UA 3DYGA 3WJNA 5AYPA 2ZEVA 4NKFA 4LA6A 3V1XA 5E8LA 3Q2ZA 3WCJA 1V4HA 4NFJF 3WEKA 1WKZA 3ADZA 3KRAA 4E9ZA 2AETA 2AZJA 4KK2A 2Z50A 5IMPA 3UCAA 4LXWA 3BNYA 4N9UA 3LDWA 4WK5A 3WEFA 3ACYA 4PVXF 2Q80A 1WL0A 2F92F 3G4DA 1ZW5A 3B7LA 3Q2QA 4LZ0A 4H5EF 4P0WA 2Q9ZA 3SDUA 3M01A 2OA6A 3Q30A 3SDQA 2E93A 3KRAB 1UBXA 3PYBA 1JFGA 4KPDA 3LMDA 5DW7A 5HN8A 3WC9A 1UBVA 5B03A 3P5PA 4H5DF 3WCHA 2H8OA 3PYAA 4DEMF 2Q9YA 4H5CF 1V4KA 2F89F 1JFAA 3ICNA 2E8TA 3PDEA 3SDTA 3WCCA 1KIYA 4XQRF 3DYHA 3WCIA 2F9KF 2F8ZF 1RQJA 3VJBA 5IN8A 3WCDA 1FPSA 3TFPA 4DWBA 3WEIA 5IL3A 1V4IA 1YYTA 2Z7HA 2ONHA 3MAVA 2AEKA 4KVWA 4MC8A 4JVJF 4MC0A 1N22A 2E8WA 3KROA 2E94A 4LZCA 1V4JA 3N1WF 4JXNA 1YYQA 4LIXA 5AELA 5DGMF 5HN7A 1VG3A 2AZLA 4GP2A 5AHUB 3CKEA 1HM7A 3N6KF 4DWGA 5IVGA 5IKHA 2J1PA 5I1UA 1YHMA 3EFQA 1WL2A 4LPHF 3APZA 5IMNA 3TFVA 5ILZA 4E9UA 2Z52A 3LSNA 3IPIA 5ERMA 1EZFA 3ZOUA 4LLSA 3KROB 3RBMA 5B02A 1VG4A 4KVYA 3S9VA 3WEJA 5B0KA 3LJIA 2J5CA 2Z4WA 5DIQF 2Z4ZA 1V4EA 3KRCA 1YHLA 2OPNA 2PS5A 3VJ9A 4K10A 1DGPA 4KVDA 2ZEUA 3IBAA 5DHKA 1VG6A 3ICKA 3PKOA 4LPGF 3WCAA 2E91A 4F6XA 3PH7A 4P0XA 3OABA 2DH4A 3VJCA 3VJEA 3V66A 2P1CA 5A0KA 3AQ0A 2ZY1A 1HX9A 2OGDA 4LA5A 3ICMA 4KKMA 5B0MA 3WCLA 2FORA 3KRCB 4DI5A 4OKMA 3LLWA 4DHDA 3ID0A 5DJPF 4EA2A 4RXAA 3N3DA 5ERNA 2Z4VA 2Z7IA 2E8UA 4KQ5A 3M00A 3NPRA 4KVIA 4RXDA 2F8CF 4MC3A 3OABB 2VF6A 3ZL6A 3TFNA 5ILJA 2J1OA 1N1BA 1HXCA 5IM1A 3ZCDA 5E8KA 1N23A 2PS8A 1DI1A 5DHIA 5CG5A 2PS6A 4NUAA 5B0IA 5ILDA 5ILIA 2Q58A 3NRIA 5JUZF 4LFVF 1HM4A 5EROA 1VG7A 3N1VF 4EA0A 3CC9A 3P8RA 4KFAA 5H9DA 5KSXF 4KWDA 3P41A 1YHKA 3N3LF 4GP1A 3M02A 3LEEA 2RAHA 3M0GA 4Q23A 4N1ZF 3WCEA 1WY0A 1YYRA 3QQVA 3DYFA 3WSBA 3TC1A 4LZ3A 5IK0A 3WCGA 4LTZA 3SDVA 4NG6A 2F7MF 4GAXA 5JV2F 4KUXA 3N45F 4OKZA 1YYUA 1N21A 4KQUA 5JV1F 2ZCOA 2AZKA 3P8LA 3N5JF 4LOBA 5IK6A 3VJDA 1UBWA 3LGKA 1YQ7A 3EZ3A 5ER8A 4P0VA 3WE9A 4RXCA 1PS1A 1VG2A 3WEHA 5AFXA 3KRFA 3P5RA 3N49F
chains in the Genus database with same CATH topology
5DZ2A 5ILHA 3EGTA 5JV0F 3V1VA 4JXYA 4LUUA 2F94F 4RNQA 4XQSF 3N0FA 4F6VA 3ACXA 2Z78A 5DJVF 5B0JA 2OPMA 1RQIA 4DXJA 3AQCB 3NF2A 5IKAA 4DZWA 3WJKA 3WCMA 3LGZB 3AE0A 3OYRA 4LFGA 1WL3A 5EASA 5EATA 5B01A 3W7FA 3MZVA 2PS7A 3KB9A 1UBYA 4FP4A 4LTVA 5C05A 4NFKF 5A0IA 1N20A 3ACWA 5EAUA 2E4OA 3SAEA 3G4FA 3RYWA 5ILKA 4JZBA 4QXSF 1HXAA 3KRFB 5IMIA 4RYPA 1WMWA 4PVYF 4EA1A 3ZMCA 2ZCQA 4UMJA 1RTRA 4KQSA 5IL8A 3NPKA 2PS4A 3WJOA 3KRPA 5B0LA 4KPJA 5JA0F 3Q1OA 3WEGA 3LOMA 2E8VA 4HD1A 2I19A 3ASXA 3OACA 5B00A 3KBKA 4OMGA 4ZQ8A 3WSAA 4JZXA 4OMHA 3ZMBA 3TS7A 3LZ9A 3VJAA 2ZCSA 4FJQA 3N0GA 3BNXA 2E95A 3AQBB 4F62A 2Z4XA 5CG6A 3RMGA 3LK5A 3SDRA 1YJ4A 5DGSF 4GA3A 3N46F 4NKEA 3VJ8A 4L2XF 1YYSA 2E90A 1N1ZA 2ZCRA 3S4JA 2Z4YA 3KRPB 2AELA 1YV5A 2FTZA 2O1OA 4NFIF 3N5HF 2QISA 5DGNF 1WL1A 4LFEA 3WCBA 3OACB 2E92A 1N24A 3LG5A 5DJRF 5HN9A 1KIZA 5E8HA 3WCFA 2EWGA 4XQTF 4QPFA 4JYXA 3RYEA 2E8XA 4E1EA 2ONGA 3LVSA 5A0JA 4RXEA 4OGUA 5HNAA 1HXGA 4LLTA 3ICZA 3CP6A 5IK9A 3QKCA 5ILYA 3M9UA 3DYGA 3WJNA 5AYPA 2ZEVA 4NKFA 4LA6A 3V1XA 5E8LA 3Q2ZA 3WCJA 1V4HA 4NFJF 3WEKA 1WKZA 3ADZA 3KRAA 4E9ZA 2AETA 2AZJA 4KK2A 2Z50A 5IMPA 3UCAA 4LXWA 3BNYA 4N9UA 3LDWA 4WK5A 3WEFA 3ACYA 4PVXF 2Q80A 1WL0A 2F92F 3G4DA 1ZW5A 3B7LA 3Q2QA 4LZ0A 4H5EF 4P0WA 2Q9ZA 3SDUA 3M01A 2OA6A 3Q30A 3SDQA 2E93A 3KRAB 1UBXA 3PYBA 1JFGA 4KPDA 3LMDA 5DW7A 5HN8A 3WC9A 1UBVA 5B03A 3P5PA 4H5DF 3WCHA 2H8OA 3PYAA 4DEMF 2Q9YA 4H5CF 1V4KA 2F89F 1JFAA 3ICNA 2E8TA 3PDEA 3SDTA 3WCCA 1KIYA 4XQRF 3DYHA 3WCIA 2F9KF 2F8ZF 1RQJA 3VJBA 5IN8A 3WCDA 1FPSA 3TFPA 4DWBA 3WEIA 5IL3A 1V4IA 1YYTA 2Z7HA 2ONHA 3MAVA 2AEKA 4KVWA 4MC8A 4JVJF 4MC0A 1N22A 2E8WA 3KROA 2E94A 4LZCA 1V4JA 3N1WF 4JXNA 1YYQA 4LIXA 5AELA 5DGMF 5HN7A 1VG3A 2AZLA 4GP2A 5AHUB 3CKEA 1HM7A 3N6KF 4DWGA 5IVGA 5IKHA 2J1PA 5I1UA 1YHMA 3EFQA 1WL2A 4LPHF 3APZA 5IMNA 3TFVA 5ILZA 4E9UA 2Z52A 3LSNA 3IPIA 5ERMA 1EZFA 3ZOUA 4LLSA 3KROB 3RBMA 5B02A 1VG4A 4KVYA 3S9VA 3WEJA 5B0KA 3LJIA 2J5CA 2Z4WA 5DIQF 2Z4ZA 1V4EA 3KRCA 1YHLA 2OPNA 2PS5A 3VJ9A 4K10A 1DGPA 4KVDA 2ZEUA 3IBAA 5DHKA 1VG6A 3ICKA 3PKOA 4LPGF 3WCAA 2E91A 4F6XA 3PH7A 4P0XA 3OABA 2DH4A 3VJCA 3VJEA 3V66A 2P1CA 5A0KA 3AQ0A 2ZY1A 1HX9A 2OGDA 4LA5A 3ICMA 4KKMA 5B0MA 3WCLA 2FORA 3KRCB 4DI5A 4OKMA 3LLWA 4DHDA 3ID0A 5DJPF 4EA2A 4RXAA 3N3DA 5ERNA 2Z4VA 2Z7IA 2E8UA 4KQ5A 3M00A 3NPRA 4KVIA 4RXDA 2F8CF 4MC3A 3OABB 2VF6A 3ZL6A 3TFNA 5ILJA 2J1OA 1N1BA 1HXCA 5IM1A 3ZCDA 5E8KA 1N23A 2PS8A 1DI1A 5DHIA 5CG5A 2PS6A 4NUAA 5B0IA 5ILDA 5ILIA 2Q58A 3NRIA 5JUZF 4LFVF 1HM4A 5EROA 1VG7A 3N1VF 4EA0A 3CC9A 3P8RA 4KFAA 5H9DA 5KSXF 4KWDA 3P41A 1YHKA 3N3LF 4GP1A 3M02A 3LEEA 2RAHA 3M0GA 4Q23A 4N1ZF 3WCEA 1WY0A 1YYRA 3QQVA 3DYFA 3WSBA 3TC1A 4LZ3A 5IK0A 3WCGA 4LTZA 3SDVA 4NG6A 2F7MF 4GAXA 5JV2F 4KUXA 3N45F 4OKZA 1YYUA 1N21A 4KQUA 5JV1F 2ZCOA 2AZKA 3P8LA 3N5JF 4LOBA 5IK6A 3VJDA 1UBWA 3LGKA 1YQ7A 3EZ3A 5ER8A 4P0VA 3WE9A 4RXCA 1PS1A 1VG2A 3WEHA 5AFXA 3KRFA 3P5RA 3N49F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DZ2 A;  5ILH A;  3EGT A;  5JV0 F;  3V1V A;  4JXY A;  4LUU A;  2F94 F;  4RNQ A;  4XQS F;  3N0F A;  4F6V A;  3ACX A;  2Z78 A;  5DJV F;  5B0J A;  2OPM A;  1RQI A;  4DXJ A;  3AQC B;  3NF2 A;  5IKA A;  4DZW A;  3WJK A;  3WCM A;  3LGZ B;  3AE0 A;  3OYR A;  4LFG A;  1WL3 A;  5EAS A;  5EAT A;  5B01 A;  3W7F A;  3MZV A;  2PS7 A;  3KB9 A;  1UBY A;  4FP4 A;  4LTV A;  5C05 A;  4NFK F;  5A0I A;  1N20 A;  3ACW A;  5EAU A;  2E4O A;  3SAE A;  3G4F A;  3RYW A;  5ILK A;  4JZB A;  4QXS F;  1HXA A;  3KRF B;  5IMI A;  4RYP A;  1WMW A;  4PVY F;  4EA1 A;  3ZMC A;  2ZCQ A;  4UMJ A;  1RTR A;  4KQS A;  5IL8 A;  3NPK A;  2PS4 A;  3WJO A;  3KRP A;  5B0L A;  4KPJ A;  5JA0 F;  3Q1O A;  3WEG A;  3LOM A;  2E8V A;  4HD1 A;  2I19 A;  3ASX A;  3OAC A;  5B00 A;  3KBK A;  4OMG A;  4ZQ8 A;  3WSA A;  4JZX A;  4OMH A;  3ZMB A;  3TS7 A;  3LZ9 A;  3VJA A;  2ZCS A;  4FJQ A;  3N0G A;  3BNX A;  2E95 A;  3AQB B;  4F62 A;  2Z4X A;  5CG6 A;  3RMG A;  3LK5 A;  3SDR A;  1YJ4 A;  5DGS F;  4GA3 A;  3N46 F;  4NKE A;  3VJ8 A;  4L2X F;  1YYS A;  2E90 A;  1N1Z A;  2ZCR A;  3S4J A;  2Z4Y A;  3KRP B;  2AEL A;  1YV5 A;  2FTZ A;  2O1O A;  4NFI F;  3N5H F;  2QIS A;  5DGN F;  1WL1 A;  4LFE A;  3WCB A;  3OAC B;  2E92 A;  1N24 A;  3LG5 A;  5DJR F;  5HN9 A;  1KIZ A;  5E8H A;  3WCF A;  2EWG A;  4XQT F;  4QPF A;  4JYX A;  3RYE A;  2E8X A;  4E1E A;  2ONG A;  3LVS A;  5A0J A;  4RXE A;  4OGU A;  5HNA A;  1HXG A;  4LLT A;  3ICZ A;  3CP6 A;  5IK9 A;  3QKC A;  5ILY A;  3M9U A;  3DYG A;  3WJN A;  5AYP A;  2ZEV A;  4NKF A;  4LA6 A;  3V1X A;  5E8L A;  3Q2Z A;  3WCJ A;  1V4H A;  4NFJ F;  3WEK A;  1WKZ A;  3ADZ A;  3KRA A;  4E9Z A;  2AET A;  2AZJ A;  4KK2 A;  2Z50 A;  5IMP A;  3UCA A;  4LXW A;  3BNY A;  4N9U A;  3LDW A;  4WK5 A;  3WEF A;  3ACY A;  4PVX F;  2Q80 A;  1WL0 A;  2F92 F;  3G4D A;  1ZW5 A;  3B7L A;  3Q2Q A;  4LZ0 A;  4H5E F;  4P0W A;  2Q9Z A;  3SDU A;  3M01 A;  2OA6 A;  3Q30 A;  3SDQ A;  2E93 A;  3KRA B;  1UBX A;  3PYB A;  1JFG A;  4KPD A;  3LMD A;  5DW7 A;  5HN8 A;  3WC9 A;  1UBV A;  5B03 A;  3P5P A;  4H5D F;  3WCH A;  2H8O A;  3PYA A;  4DEM F;  2Q9Y A;  4H5C F;  1V4K A;  2F89 F;  1JFA A;  3ICN A;  2E8T A;  3PDE A;  3SDT A;  3WCC A;  1KIY A;  4XQR F;  3DYH A;  3WCI A;  2F9K F;  2F8Z F;  1RQJ A;  3VJB A;  5IN8 A;  3WCD A;  1FPS A;  3TFP A;  4DWB A;  3WEI A;  5IL3 A;  1V4I A;  1YYT A;  2Z7H A;  2ONH A;  3MAV A;  2AEK A;  4KVW A;  4MC8 A;  4JVJ F;  4MC0 A;  1N22 A;  2E8W A;  3KRO A;  2E94 A;  4LZC A;  1V4J A;  3N1W F;  4JXN A;  1YYQ A;  4LIX A;  5AEL A;  5DGM F;  5HN7 A;  1VG3 A;  2AZL A;  4GP2 A;  5AHU B;  3CKE A;  1HM7 A;  3N6K F;  4DWG A;  5IVG A;  5IKH A;  2J1P A;  5I1U A;  1YHM A;  3EFQ A;  1WL2 A;  4LPH F;  3APZ A;  5IMN A;  3TFV A;  5ILZ A;  4E9U A;  2Z52 A;  3LSN A;  3IPI A;  5ERM A;  1EZF A;  3ZOU A;  4LLS A;  3KRO B;  3RBM A;  5B02 A;  1VG4 A;  4KVY A;  3S9V A;  3WEJ A;  5B0K A;  3LJI A;  2J5C A;  2Z4W A;  5DIQ F;  2Z4Z A;  1V4E A;  3KRC A;  1YHL A;  2OPN A;  2PS5 A;  3VJ9 A;  4K10 A;  1DGP A;  4KVD A;  2ZEU A;  3IBA A;  5DHK A;  1VG6 A;  3ICK A;  3PKO A;  4LPG F;  3WCA A;  2E91 A;  4F6X A;  3PH7 A;  4P0X A;  3OAB A;  2DH4 A;  3VJC A;  3VJE A;  3V66 A;  2P1C A;  5A0K A;  3AQ0 A;  2ZY1 A;  1HX9 A;  2OGD A;  4LA5 A;  3ICM A;  4KKM A;  5B0M A;  3WCL A;  2FOR A;  3KRC B;  4DI5 A;  4OKM A;  3LLW A;  4DHD A;  3ID0 A;  5DJP F;  4EA2 A;  4RXA A;  3N3D A;  5ERN A;  2Z4V A;  2Z7I A;  2E8U A;  4KQ5 A;  3M00 A;  3NPR A;  4KVI A;  4RXD A;  2F8C F;  4MC3 A;  3OAB B;  2VF6 A;  3ZL6 A;  3TFN A;  5ILJ A;  2J1O A;  1N1B A;  1HXC A;  5IM1 A;  3ZCD A;  5E8K A;  1N23 A;  2PS8 A;  1DI1 A;  5DHI A;  5CG5 A;  2PS6 A;  4NUA A;  5B0I A;  5ILD A;  5ILI A;  2Q58 A;  3NRI A;  5JUZ F;  4LFV F;  1HM4 A;  5ERO A;  1VG7 A;  3N1V F;  4EA0 A;  3CC9 A;  3P8R A;  4KFA A;  5H9D A;  5KSX F;  4KWD A;  3P41 A;  1YHK A;  3N3L F;  4GP1 A;  3M02 A;  3LEE A;  2RAH A;  3M0G A;  4Q23 A;  4N1Z F;  3WCE A;  1WY0 A;  1YYR A;  3QQV A;  3DYF A;  3WSB A;  3TC1 A;  4LZ3 A;  5IK0 A;  3WCG A;  4LTZ A;  3SDV A;  4NG6 A;  2F7M F;  4GAX A;  5JV2 F;  4KUX A;  3N45 F;  4OKZ A;  1YYU A;  1N21 A;  4KQU A;  5JV1 F;  2ZCO A;  2AZK A;  3P8L A;  3N5J F;  4LOB A;  5IK6 A;  3VJD A;  1UBW A;  3LGK A;  1YQ7 A;  3EZ3 A;  5ER8 A;  4P0V A;  3WE9 A;  4RXC A;  1PS1 A;  1VG2 A;  3WEH A;  5AFX A;  3KRF A;  3P5R A;  3N49 F; 
#chains in the Genus database with same CATH topology
 5DZ2 A;  5ILH A;  3EGT A;  5JV0 F;  3V1V A;  4JXY A;  4LUU A;  2F94 F;  4RNQ A;  4XQS F;  3N0F A;  4F6V A;  3ACX A;  2Z78 A;  5DJV F;  5B0J A;  2OPM A;  1RQI A;  4DXJ A;  3AQC B;  3NF2 A;  5IKA A;  4DZW A;  3WJK A;  3WCM A;  3LGZ B;  3AE0 A;  3OYR A;  4LFG A;  1WL3 A;  5EAS A;  5EAT A;  5B01 A;  3W7F A;  3MZV A;  2PS7 A;  3KB9 A;  1UBY A;  4FP4 A;  4LTV A;  5C05 A;  4NFK F;  5A0I A;  1N20 A;  3ACW A;  5EAU A;  2E4O A;  3SAE A;  3G4F A;  3RYW A;  5ILK A;  4JZB A;  4QXS F;  1HXA A;  3KRF B;  5IMI A;  4RYP A;  1WMW A;  4PVY F;  4EA1 A;  3ZMC A;  2ZCQ A;  4UMJ A;  1RTR A;  4KQS A;  5IL8 A;  3NPK A;  2PS4 A;  3WJO A;  3KRP A;  5B0L A;  4KPJ A;  5JA0 F;  3Q1O A;  3WEG A;  3LOM A;  2E8V A;  4HD1 A;  2I19 A;  3ASX A;  3OAC A;  5B00 A;  3KBK A;  4OMG A;  4ZQ8 A;  3WSA A;  4JZX A;  4OMH A;  3ZMB A;  3TS7 A;  3LZ9 A;  3VJA A;  2ZCS A;  4FJQ A;  3N0G A;  3BNX A;  2E95 A;  3AQB B;  4F62 A;  2Z4X A;  5CG6 A;  3RMG A;  3LK5 A;  3SDR A;  1YJ4 A;  5DGS F;  4GA3 A;  3N46 F;  4NKE A;  3VJ8 A;  4L2X F;  1YYS A;  2E90 A;  1N1Z A;  2ZCR A;  3S4J A;  2Z4Y A;  3KRP B;  2AEL A;  1YV5 A;  2FTZ A;  2O1O A;  4NFI F;  3N5H F;  2QIS A;  5DGN F;  1WL1 A;  4LFE A;  3WCB A;  3OAC B;  2E92 A;  1N24 A;  3LG5 A;  5DJR F;  5HN9 A;  1KIZ A;  5E8H A;  3WCF A;  2EWG A;  4XQT F;  4QPF A;  4JYX A;  3RYE A;  2E8X A;  4E1E A;  2ONG A;  3LVS A;  5A0J A;  4RXE A;  4OGU A;  5HNA A;  1HXG A;  4LLT A;  3ICZ A;  3CP6 A;  5IK9 A;  3QKC A;  5ILY A;  3M9U A;  3DYG A;  3WJN A;  5AYP A;  2ZEV A;  4NKF A;  4LA6 A;  3V1X A;  5E8L A;  3Q2Z A;  3WCJ A;  1V4H A;  4NFJ F;  3WEK A;  1WKZ A;  3ADZ A;  3KRA A;  4E9Z A;  2AET A;  2AZJ A;  4KK2 A;  2Z50 A;  5IMP A;  3UCA A;  4LXW A;  3BNY A;  4N9U A;  3LDW A;  4WK5 A;  3WEF A;  3ACY A;  4PVX F;  2Q80 A;  1WL0 A;  2F92 F;  3G4D A;  1ZW5 A;  3B7L A;  3Q2Q A;  4LZ0 A;  4H5E F;  4P0W A;  2Q9Z A;  3SDU A;  3M01 A;  2OA6 A;  3Q30 A;  3SDQ A;  2E93 A;  3KRA B;  1UBX A;  3PYB A;  1JFG A;  4KPD A;  3LMD A;  5DW7 A;  5HN8 A;  3WC9 A;  1UBV A;  5B03 A;  3P5P A;  4H5D F;  3WCH A;  2H8O A;  3PYA A;  4DEM F;  2Q9Y A;  4H5C F;  1V4K A;  2F89 F;  1JFA A;  3ICN A;  2E8T A;  3PDE A;  3SDT A;  3WCC A;  1KIY A;  4XQR F;  3DYH A;  3WCI A;  2F9K F;  2F8Z F;  1RQJ A;  3VJB A;  5IN8 A;  3WCD A;  1FPS A;  3TFP A;  4DWB A;  3WEI A;  5IL3 A;  1V4I A;  1YYT A;  2Z7H A;  2ONH A;  3MAV A;  2AEK A;  4KVW A;  4MC8 A;  4JVJ F;  4MC0 A;  1N22 A;  2E8W A;  3KRO A;  2E94 A;  4LZC A;  1V4J A;  3N1W F;  4JXN A;  1YYQ A;  4LIX A;  5AEL A;  5DGM F;  5HN7 A;  1VG3 A;  2AZL A;  4GP2 A;  5AHU B;  3CKE A;  1HM7 A;  3N6K F;  4DWG A;  5IVG A;  5IKH A;  2J1P A;  5I1U A;  1YHM A;  3EFQ A;  1WL2 A;  4LPH F;  3APZ A;  5IMN A;  3TFV A;  5ILZ A;  4E9U A;  2Z52 A;  3LSN A;  3IPI A;  5ERM A;  1EZF A;  3ZOU A;  4LLS A;  3KRO B;  3RBM A;  5B02 A;  1VG4 A;  4KVY A;  3S9V A;  3WEJ A;  5B0K A;  3LJI A;  2J5C A;  2Z4W A;  5DIQ F;  2Z4Z A;  1V4E A;  3KRC A;  1YHL A;  2OPN A;  2PS5 A;  3VJ9 A;  4K10 A;  1DGP A;  4KVD A;  2ZEU A;  3IBA A;  5DHK A;  1VG6 A;  3ICK A;  3PKO A;  4LPG F;  3WCA A;  2E91 A;  4F6X A;  3PH7 A;  4P0X A;  3OAB A;  2DH4 A;  3VJC A;  3VJE A;  3V66 A;  2P1C A;  5A0K A;  3AQ0 A;  2ZY1 A;  1HX9 A;  2OGD A;  4LA5 A;  3ICM A;  4KKM A;  5B0M A;  3WCL A;  2FOR A;  3KRC B;  4DI5 A;  4OKM A;  3LLW A;  4DHD A;  3ID0 A;  5DJP F;  4EA2 A;  4RXA A;  3N3D A;  5ERN A;  2Z4V A;  2Z7I A;  2E8U A;  4KQ5 A;  3M00 A;  3NPR A;  4KVI A;  4RXD A;  2F8C F;  4MC3 A;  3OAB B;  2VF6 A;  3ZL6 A;  3TFN A;  5ILJ A;  2J1O A;  1N1B A;  1HXC A;  5IM1 A;  3ZCD A;  5E8K A;  1N23 A;  2PS8 A;  1DI1 A;  5DHI A;  5CG5 A;  2PS6 A;  4NUA A;  5B0I A;  5ILD A;  5ILI A;  2Q58 A;  3NRI A;  5JUZ F;  4LFV F;  1HM4 A;  5ERO A;  1VG7 A;  3N1V F;  4EA0 A;  3CC9 A;  3P8R A;  4KFA A;  5H9D A;  5KSX F;  4KWD A;  3P41 A;  1YHK A;  3N3L F;  4GP1 A;  3M02 A;  3LEE A;  2RAH A;  3M0G A;  4Q23 A;  4N1Z F;  3WCE A;  1WY0 A;  1YYR A;  3QQV A;  3DYF A;  3WSB A;  3TC1 A;  4LZ3 A;  5IK0 A;  3WCG A;  4LTZ A;  3SDV A;  4NG6 A;  2F7M F;  4GAX A;  5JV2 F;  4KUX A;  3N45 F;  4OKZ A;  1YYU A;  1N21 A;  4KQU A;  5JV1 F;  2ZCO A;  2AZK A;  3P8L A;  3N5J F;  4LOB A;  5IK6 A;  3VJD A;  1UBW A;  3LGK A;  1YQ7 A;  3EZ3 A;  5ER8 A;  4P0V A;  3WE9 A;  4RXC A;  1PS1 A;  1VG2 A;  3WEH A;  5AFX A;  3KRF A;  3P5R A;  3N49 F; 
#chains in the Genus database with same CATH homology
 5DZ2 A;  5ILH A;  3EGT A;  5JV0 F;  3V1V A;  4JXY A;  4LUU A;  2F94 F;  4RNQ A;  4XQS F;  3N0F A;  4F6V A;  3ACX A;  2Z78 A;  5DJV F;  5B0J A;  2OPM A;  1RQI A;  4DXJ A;  3AQC B;  3NF2 A;  5IKA A;  4DZW A;  3WJK A;  3WCM A;  3LGZ B;  3AE0 A;  3OYR A;  4LFG A;  1WL3 A;  5EAS A;  5EAT A;  5B01 A;  3W7F A;  3MZV A;  2PS7 A;  3KB9 A;  1UBY A;  4FP4 A;  4LTV A;  5C05 A;  4NFK F;  5A0I A;  1N20 A;  3ACW A;  5EAU A;  2E4O A;  3SAE A;  3G4F A;  3RYW A;  5ILK A;  4JZB A;  4QXS F;  1HXA A;  3KRF B;  5IMI A;  4RYP A;  1WMW A;  4PVY F;  4EA1 A;  3ZMC A;  2ZCQ A;  4UMJ A;  1RTR A;  4KQS A;  5IL8 A;  3NPK A;  2PS4 A;  3WJO A;  3KRP A;  5B0L A;  4KPJ A;  5JA0 F;  3Q1O A;  3WEG A;  3LOM A;  2E8V A;  4HD1 A;  2I19 A;  3ASX A;  3OAC A;  5B00 A;  3KBK A;  4OMG A;  4ZQ8 A;  3WSA A;  4JZX A;  4OMH A;  3ZMB A;  3TS7 A;  3LZ9 A;  3VJA A;  2ZCS A;  4FJQ A;  3N0G A;  3BNX A;  2E95 A;  3AQB B;  4F62 A;  2Z4X A;  5CG6 A;  3RMG A;  3LK5 A;  3SDR A;  1YJ4 A;  5DGS F;  4GA3 A;  3N46 F;  4NKE A;  3VJ8 A;  4L2X F;  1YYS A;  2E90 A;  1N1Z A;  2ZCR A;  3S4J A;  2Z4Y A;  3KRP B;  2AEL A;  1YV5 A;  2FTZ A;  2O1O A;  4NFI F;  3N5H F;  2QIS A;  5DGN F;  1WL1 A;  4LFE A;  3WCB A;  3OAC B;  2E92 A;  1N24 A;  3LG5 A;  5DJR F;  5HN9 A;  1KIZ A;  5E8H A;  3WCF A;  2EWG A;  4XQT F;  4QPF A;  4JYX A;  3RYE A;  2E8X A;  4E1E A;  2ONG A;  3LVS A;  5A0J A;  4RXE A;  4OGU A;  5HNA A;  1HXG A;  4LLT A;  3ICZ A;  3CP6 A;  5IK9 A;  3QKC A;  5ILY A;  3M9U A;  3DYG A;  3WJN A;  5AYP A;  2ZEV A;  4NKF A;  4LA6 A;  3V1X A;  5E8L A;  3Q2Z A;  3WCJ A;  1V4H A;  4NFJ F;  3WEK A;  1WKZ A;  3ADZ A;  3KRA A;  4E9Z A;  2AET A;  2AZJ A;  4KK2 A;  2Z50 A;  5IMP A;  3UCA A;  4LXW A;  3BNY A;  4N9U A;  3LDW A;  4WK5 A;  3WEF A;  3ACY A;  4PVX F;  2Q80 A;  1WL0 A;  2F92 F;  3G4D A;  1ZW5 A;  3B7L A;  3Q2Q A;  4LZ0 A;  4H5E F;  4P0W A;  2Q9Z A;  3SDU A;  3M01 A;  2OA6 A;  3Q30 A;  3SDQ A;  2E93 A;  3KRA B;  1UBX A;  3PYB A;  1JFG A;  4KPD A;  3LMD A;  5DW7 A;  5HN8 A;  3WC9 A;  1UBV A;  5B03 A;  3P5P A;  4H5D F;  3WCH A;  2H8O A;  3PYA A;  4DEM F;  2Q9Y A;  4H5C F;  1V4K A;  2F89 F;  1JFA A;  3ICN A;  2E8T A;  3PDE A;  3SDT A;  3WCC A;  1KIY A;  4XQR F;  3DYH A;  3WCI A;  2F9K F;  2F8Z F;  1RQJ A;  3VJB A;  5IN8 A;  3WCD A;  1FPS A;  3TFP A;  4DWB A;  3WEI A;  5IL3 A;  1V4I A;  1YYT A;  2Z7H A;  2ONH A;  3MAV A;  2AEK A;  4KVW A;  4MC8 A;  4JVJ F;  4MC0 A;  1N22 A;  2E8W A;  3KRO A;  2E94 A;  4LZC A;  1V4J A;  3N1W F;  4JXN A;  1YYQ A;  4LIX A;  5AEL A;  5DGM F;  5HN7 A;  1VG3 A;  2AZL A;  4GP2 A;  5AHU B;  3CKE A;  1HM7 A;  3N6K F;  4DWG A;  5IVG A;  5IKH A;  2J1P A;  5I1U A;  1YHM A;  3EFQ A;  1WL2 A;  4LPH F;  3APZ A;  5IMN A;  3TFV A;  5ILZ A;  4E9U A;  2Z52 A;  3LSN A;  3IPI A;  5ERM A;  1EZF A;  3ZOU A;  4LLS A;  3KRO B;  3RBM A;  5B02 A;  1VG4 A;  4KVY A;  3S9V A;  3WEJ A;  5B0K A;  3LJI A;  2J5C A;  2Z4W A;  5DIQ F;  2Z4Z A;  1V4E A;  3KRC A;  1YHL A;  2OPN A;  2PS5 A;  3VJ9 A;  4K10 A;  1DGP A;  4KVD A;  2ZEU A;  3IBA A;  5DHK A;  1VG6 A;  3ICK A;  3PKO A;  4LPG F;  3WCA A;  2E91 A;  4F6X A;  3PH7 A;  4P0X A;  3OAB A;  2DH4 A;  3VJC A;  3VJE A;  3V66 A;  2P1C A;  5A0K A;  3AQ0 A;  2ZY1 A;  1HX9 A;  2OGD A;  4LA5 A;  3ICM A;  4KKM A;  5B0M A;  3WCL A;  2FOR A;  3KRC B;  4DI5 A;  4OKM A;  3LLW A;  4DHD A;  3ID0 A;  5DJP F;  4EA2 A;  4RXA A;  3N3D A;  5ERN A;  2Z4V A;  2Z7I A;  2E8U A;  4KQ5 A;  3M00 A;  3NPR A;  4KVI A;  4RXD A;  2F8C F;  4MC3 A;  3OAB B;  2VF6 A;  3ZL6 A;  3TFN A;  5ILJ A;  2J1O A;  1N1B A;  1HXC A;  5IM1 A;  3ZCD A;  5E8K A;  1N23 A;  2PS8 A;  1DI1 A;  5DHI A;  5CG5 A;  2PS6 A;  4NUA A;  5B0I A;  5ILD A;  5ILI A;  2Q58 A;  3NRI A;  5JUZ F;  4LFV F;  1HM4 A;  5ERO A;  1VG7 A;  3N1V F;  4EA0 A;  3CC9 A;  3P8R A;  4KFA A;  5H9D A;  5KSX F;  4KWD A;  3P41 A;  1YHK A;  3N3L F;  4GP1 A;  3M02 A;  3LEE A;  2RAH A;  3M0G A;  4Q23 A;  4N1Z F;  3WCE A;  1WY0 A;  1YYR A;  3QQV A;  3DYF A;  3WSB A;  3TC1 A;  4LZ3 A;  5IK0 A;  3WCG A;  4LTZ A;  3SDV A;  4NG6 A;  2F7M F;  4GAX A;  5JV2 F;  4KUX A;  3N45 F;  4OKZ A;  1YYU A;  1N21 A;  4KQU A;  5JV1 F;  2ZCO A;  2AZK A;  3P8L A;  3N5J F;  4LOB A;  5IK6 A;  3VJD A;  1UBW A;  3LGK A;  1YQ7 A;  3EZ3 A;  5ER8 A;  4P0V A;  3WE9 A;  4RXC A;  1PS1 A;  1VG2 A;  3WEH A;  5AFX A;  3KRF A;  3P5R A;  3N49 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...