3EFQA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-714
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
367
structure length
358
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyl pyrophosphate synthase
publication title Lipophilic bisphosphonates as dual farnesyl/geranylgeranyl diphosphate synthase inhibitors: an X-ray and NMR investigation.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 147
structure length 358
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2008-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3efqA00
3WEHA 5A0JA 4PVYF 3N5HF 5JV1F 2E8TA 1N24A 3M0GA 4DWGA 3CKEA 4PVXF 1YHMA 3VJDA 1HX9A 5DJPF 4KK2A 1YYQA 3DYFA 3V1VA 5AHUB 3ACYA 3KRAB 4RXEA 4UMJA 2OGDA 2ONGA 4LPHF 5IMIA 5E8KA 2Q80A 2PS8A 4KPDA 1VG7A 3MZVA 4EA1A 2PS6A 3DYGA 3PYAA 2Q9ZA 4LZCA 4E1EA 3ICKA 4LA5A 4MC0A 3LJIA 5DHIA 4NFKF 4OKZA 3RYWA 2Q9YA 4LTZA 2J1OA 4JZBA 5KSXF 1YHKA 1KIYA 4KQSA 4LOBA 5DZ2A 3P5RA 3WSAA 5JUZF 2F89F 3AQBB 3N1VF 2QISA 2DH4A 4LA6A 4OGUA 4OMGA 5EAUA 5IVGA 5ILZA 4GAXA 3N0FA 3N46F 3G4FA 1WMWA 3N6KF 3SDQA 3TFNA 2F8CF 3P41A 4EA2A 4QXSF 5JV0F 2FTZA 5ERNA 5IKHA 1N20A 1ZW5A 3WEFA 4DXJA 3WCJA 3LGZB 3ACWA 2Z7IA 3NRIA 4JXYA 3KRFA 3RYEA 3LMDA 3SAEA 2Z4WA 3WCAA 3Q1OA 1UBWA 2Z4ZA 4JVJF 2AZJA 1WY0A 3KRPA 1N21A 5DGNF 5B01A 3PH7A 2AEKA 3TFPA 5E8LA 1KIZA 2E93A 5ER8A 3VJCA 3Q2ZA 2E8XA 3G4DA 1VG2A 2F92F 3OACB 4LFGA 3PYBA 3VJAA 3N5JF 2Z4VA 4XQRF 5DHKA 5ERMA 3KRCA 5CG6A 5IK9A 4K10A 3AQCB 5EATA 3ACXA 3ADZA 1N1BA 2AETA 3AQ0A 3ZMBA 2J1PA 3LZ9A 1YYRA 2OPNA 3AE0A 3KROA 4JZXA 4E9ZA 2EWGA 1WL3A 4F6VA 3PKOA 3OYRA 4NG6A 1VG3A 1N23A 5B0LA 3NPKA 4JYXA 4KQ5A 4P0VA 5JV2F 2J5CA 3M9UA 5IM1A 2OPMA 2E95A 3M00A 2ZCSA 5ILIA 3TC1A 3LLWA 4F6XA 4KUXA 3PDEA 4LLSA 3VJBA 4HD1A 5B0IA 3ZL6A 1WL1A 4LXWA 5EASA 5B0JA 5IKAA 3BNYA 5IL8A 3QQVA 3SDVA 3SDUA 1YHLA 3KRAA 4NFIF 3VJ9A 1YJ4A 3NPRA 2Z50A 3WCDA 5B02A 3TS7A 4QPFA 3WCIA 3WE9A 5B03A 2VF6A 4KKMA 2Q58A 5DJRF 5ILYA 3P8RA 1VG6A 5IK0A 1DGPA 1UBXA 5H9DA 4F62A 3OABB 3KRFB 1EZFA 4GA3A 1YYTA 1V4IA 3Q30A 3MAVA 2E8VA 3LSNA 3LEEA 4EA0A 3S4JA 5HN8A 5A0KA 1YQ7A 5B0KA 4KVYA 4LZ3A 5ILDA 1JFGA 3LVSA 2PS4A 4KQUA 2AELA 2F7MF 3WCCA 3WCMA 5I1UA 4MC8A 2Z78A 2ZEVA 4H5EF 4NKEA 4DWBA 1HM7A 5DJVF 1WL2A 5AELA 2Z4YA 3Q2QA 4NFJF 3S9VA 3WC9A 3P5PA 4GP2A 2I19A 4KVIA 3KRCB 3NF2A 5B0MA 2ZCRA 3M02A 2F9KF 4DHDA 2ZCOA 3KBKA 3VJEA 1V4KA 1RTRA 2RAHA 1N1ZA 4LUUA 4NKFA 4LFEA 1JFAA 1FPSA 3TFVA 4FP4A 2E94A 5EROA 4KWDA 3EZ3A 4RXAA 1PS1A 3CP6A 3ZOUA 3M01A 3N1WF 4H5DF 3WCBA 1V4EA 1N22A 4KVDA 4LLTA 2ZCQA 4E9UA 2OA6A 3WCFA 3EGTA 4OMHA 5DW7A 4LZ0A 3UCAA 3WEGA 3IPIA 5IMPA 3WEIA 2ZEUA 4MC3A 3WEJA 3WJOA 3N3DA 3IBAA 3N3LF 3N49F 5ILHA 3DYHA 5IL3A 2O1OA 3ASXA 3V1XA 4N9UA 4XQSF 3WSBA 2PS7A 1WL0A 5AFXA 4LIXA 4RNQA 3EFQA 3ICMA 4KPJA 4N1ZF 3WJKA 2F8ZF 1YYUA 5ILKA 5E8HA 3RBMA 4DEMF 2ZY1A 4KFAA 4OKMA 4KVWA 2Z4XA 4LTVA 4RXDA 2E91A 3N0GA 5HNAA 5HN9A 4NUAA 5A0IA 5JA0F 5C05A 3B7LA 3ICNA 2Z52A 1UBVA 3SDTA 5IMNA 1UBYA 4XQTF 3ZMCA 4DI5A 1HM4A 5DIQF 2E8UA 3WCLA 4ZQ8A 3VJ8A 1HXGA 1HXAA 3KRPB 5AYPA 2AZKA 3ZCDA 3WCGA 2FORA 1YV5A 1V4HA 3W7FA 3WCEA 5HN7A 3OABA 3LGKA 3P8LA 4WK5A 3LK5A 5B00A 5DGMF 3WCHA 3WEKA 4JXNA 2PS5A 3APZA 5CG5A 1WKZA 2E4OA 3ICZA 3N45F 3CC9A 1V4JA 2E90A 3LG5A 1RQIA 2P1CA 4LPGF 4DZWA 1YYSA 3OACA 3V66A 2F94F 2ONHA 3KROB 1HXCA 4H5CF 3KB9A 4L2XF 1VG4A 3WJNA 3BNXA 4GP1A 4FJQA 1RQJA 2H8OA 4LFVF 3SDRA 5IN8A 4RXCA 4P0WA 5IK6A 2E8WA 1DI1A 2AZLA 2Z7HA 3LOMA 2E92A 4RYPA 4P0XA 4Q23A 5DGSF 3ID0A 3RMGA 5ILJA 3QKCA 3LDWA
chains in the Genus database with same CATH superfamily
3WEHA 5A0JA 4PVYF 3N5HF 5JV1F 2E8TA 1N24A 3M0GA 4DWGA 3CKEA 4PVXF 1YHMA 3VJDA 1HX9A 5DJPF 4KK2A 1YYQA 3DYFA 3V1VA 5AHUB 3ACYA 3KRAB 4RXEA 4UMJA 2OGDA 2ONGA 4LPHF 5IMIA 5E8KA 2Q80A 2PS8A 4KPDA 1VG7A 3MZVA 4EA1A 2PS6A 3DYGA 3PYAA 2Q9ZA 4LZCA 4E1EA 3ICKA 4LA5A 4MC0A 3LJIA 5DHIA 4NFKF 4OKZA 3RYWA 2Q9YA 4LTZA 2J1OA 4JZBA 5KSXF 1YHKA 1KIYA 4KQSA 4LOBA 5DZ2A 3P5RA 3WSAA 5JUZF 2F89F 3AQBB 3N1VF 2QISA 2DH4A 4LA6A 4OGUA 4OMGA 5EAUA 5IVGA 5ILZA 4GAXA 3N0FA 3N46F 3G4FA 1WMWA 3N6KF 3SDQA 3TFNA 2F8CF 3P41A 4EA2A 4QXSF 5JV0F 2FTZA 5ERNA 5IKHA 1N20A 1ZW5A 3WEFA 4DXJA 3WCJA 3LGZB 3ACWA 2Z7IA 3NRIA 4JXYA 3KRFA 3RYEA 3LMDA 3SAEA 2Z4WA 3WCAA 3Q1OA 1UBWA 2Z4ZA 4JVJF 2AZJA 1WY0A 3KRPA 1N21A 5DGNF 5B01A 3PH7A 2AEKA 3TFPA 5E8LA 1KIZA 2E93A 5ER8A 3VJCA 3Q2ZA 2E8XA 3G4DA 1VG2A 2F92F 3OACB 4LFGA 3PYBA 3VJAA 3N5JF 2Z4VA 4XQRF 5DHKA 5ERMA 3KRCA 5CG6A 5IK9A 4K10A 3AQCB 5EATA 3ACXA 3ADZA 1N1BA 2AETA 3AQ0A 3ZMBA 2J1PA 3LZ9A 1YYRA 2OPNA 3AE0A 3KROA 4JZXA 4E9ZA 2EWGA 1WL3A 4F6VA 3PKOA 3OYRA 4NG6A 1VG3A 1N23A 5B0LA 3NPKA 4JYXA 4KQ5A 4P0VA 5JV2F 2J5CA 3M9UA 5IM1A 2OPMA 2E95A 3M00A 2ZCSA 5ILIA 3TC1A 3LLWA 4F6XA 4KUXA 3PDEA 4LLSA 3VJBA 4HD1A 5B0IA 3ZL6A 1WL1A 4LXWA 5EASA 5B0JA 5IKAA 3BNYA 5IL8A 3QQVA 3SDVA 3SDUA 1YHLA 3KRAA 4NFIF 3VJ9A 1YJ4A 3NPRA 2Z50A 3WCDA 5B02A 3TS7A 4QPFA 3WCIA 3WE9A 5B03A 2VF6A 4KKMA 2Q58A 5DJRF 5ILYA 3P8RA 1VG6A 5IK0A 1DGPA 1UBXA 5H9DA 4F62A 3OABB 3KRFB 1EZFA 4GA3A 1YYTA 1V4IA 3Q30A 3MAVA 2E8VA 3LSNA 3LEEA 4EA0A 3S4JA 5HN8A 5A0KA 1YQ7A 5B0KA 4KVYA 4LZ3A 5ILDA 1JFGA 3LVSA 2PS4A 4KQUA 2AELA 2F7MF 3WCCA 3WCMA 5I1UA 4MC8A 2Z78A 2ZEVA 4H5EF 4NKEA 4DWBA 1HM7A 5DJVF 1WL2A 5AELA 2Z4YA 3Q2QA 4NFJF 3S9VA 3WC9A 3P5PA 4GP2A 2I19A 4KVIA 3KRCB 3NF2A 5B0MA 2ZCRA 3M02A 2F9KF 4DHDA 2ZCOA 3KBKA 3VJEA 1V4KA 1RTRA 2RAHA 1N1ZA 4LUUA 4NKFA 4LFEA 1JFAA 1FPSA 3TFVA 4FP4A 2E94A 5EROA 4KWDA 3EZ3A 4RXAA 1PS1A 3CP6A 3ZOUA 3M01A 3N1WF 4H5DF 3WCBA 1V4EA 1N22A 4KVDA 4LLTA 2ZCQA 4E9UA 2OA6A 3WCFA 3EGTA 4OMHA 5DW7A 4LZ0A 3UCAA 3WEGA 3IPIA 5IMPA 3WEIA 2ZEUA 4MC3A 3WEJA 3WJOA 3N3DA 3IBAA 3N3LF 3N49F 5ILHA 3DYHA 5IL3A 2O1OA 3ASXA 3V1XA 4N9UA 4XQSF 3WSBA 2PS7A 1WL0A 5AFXA 4LIXA 4RNQA 3EFQA 3ICMA 4KPJA 4N1ZF 3WJKA 2F8ZF 1YYUA 5ILKA 5E8HA 3RBMA 4DEMF 2ZY1A 4KFAA 4OKMA 4KVWA 2Z4XA 4LTVA 4RXDA 2E91A 3N0GA 5HNAA 5HN9A 4NUAA 5A0IA 5JA0F 5C05A 3B7LA 3ICNA 2Z52A 1UBVA 3SDTA 5IMNA 1UBYA 4XQTF 3ZMCA 4DI5A 1HM4A 5DIQF 2E8UA 3WCLA 4ZQ8A 3VJ8A 1HXGA 1HXAA 3KRPB 5AYPA 2AZKA 3ZCDA 3WCGA 2FORA 1YV5A 1V4HA 3W7FA 3WCEA 5HN7A 3OABA 3LGKA 3P8LA 4WK5A 3LK5A 5B00A 5DGMF 3WCHA 3WEKA 4JXNA 2PS5A 3APZA 5CG5A 1WKZA 2E4OA 3ICZA 3N45F 3CC9A 1V4JA 2E90A 3LG5A 1RQIA 2P1CA 4LPGF 4DZWA 1YYSA 3OACA 3V66A 2F94F 2ONHA 3KROB 1HXCA 4H5CF 3KB9A 4L2XF 1VG4A 3WJNA 3BNXA 4GP1A 4FJQA 1RQJA 2H8OA 4LFVF 3SDRA 5IN8A 4RXCA 4P0WA 5IK6A 2E8WA 1DI1A 2AZLA 2Z7HA 3LOMA 2E92A 4RYPA 4P0XA 4Q23A 5DGSF 3ID0A 3RMGA 5ILJA 3QKCA 3LDWA
chains in the Genus database with same CATH topology
3WEHA 5A0JA 4PVYF 3N5HF 5JV1F 2E8TA 1N24A 3M0GA 4DWGA 3CKEA 4PVXF 1YHMA 3VJDA 1HX9A 5DJPF 4KK2A 1YYQA 3DYFA 3V1VA 5AHUB 3ACYA 3KRAB 4RXEA 4UMJA 2OGDA 2ONGA 4LPHF 5IMIA 5E8KA 2Q80A 2PS8A 4KPDA 1VG7A 3MZVA 4EA1A 2PS6A 3DYGA 3PYAA 2Q9ZA 4LZCA 4E1EA 3ICKA 4LA5A 4MC0A 3LJIA 5DHIA 4NFKF 4OKZA 3RYWA 2Q9YA 4LTZA 2J1OA 4JZBA 5KSXF 1YHKA 1KIYA 4KQSA 4LOBA 5DZ2A 3P5RA 3WSAA 5JUZF 2F89F 3AQBB 3N1VF 2QISA 2DH4A 4LA6A 4OGUA 4OMGA 5EAUA 5IVGA 5ILZA 4GAXA 3N0FA 3N46F 3G4FA 1WMWA 3N6KF 3SDQA 3TFNA 2F8CF 3P41A 4EA2A 4QXSF 5JV0F 2FTZA 5ERNA 5IKHA 1N20A 1ZW5A 3WEFA 4DXJA 3WCJA 3LGZB 3ACWA 2Z7IA 3NRIA 4JXYA 3KRFA 3RYEA 3LMDA 3SAEA 2Z4WA 3WCAA 3Q1OA 1UBWA 2Z4ZA 4JVJF 2AZJA 1WY0A 3KRPA 1N21A 5DGNF 5B01A 3PH7A 2AEKA 3TFPA 5E8LA 1KIZA 2E93A 5ER8A 3VJCA 3Q2ZA 2E8XA 3G4DA 1VG2A 2F92F 3OACB 4LFGA 3PYBA 3VJAA 3N5JF 2Z4VA 4XQRF 5DHKA 5ERMA 3KRCA 5CG6A 5IK9A 4K10A 3AQCB 5EATA 3ACXA 3ADZA 1N1BA 2AETA 3AQ0A 3ZMBA 2J1PA 3LZ9A 1YYRA 2OPNA 3AE0A 3KROA 4JZXA 4E9ZA 2EWGA 1WL3A 4F6VA 3PKOA 3OYRA 4NG6A 1VG3A 1N23A 5B0LA 3NPKA 4JYXA 4KQ5A 4P0VA 5JV2F 2J5CA 3M9UA 5IM1A 2OPMA 2E95A 3M00A 2ZCSA 5ILIA 3TC1A 3LLWA 4F6XA 4KUXA 3PDEA 4LLSA 3VJBA 4HD1A 5B0IA 3ZL6A 1WL1A 4LXWA 5EASA 5B0JA 5IKAA 3BNYA 5IL8A 3QQVA 3SDVA 3SDUA 1YHLA 3KRAA 4NFIF 3VJ9A 1YJ4A 3NPRA 2Z50A 3WCDA 5B02A 3TS7A 4QPFA 3WCIA 3WE9A 5B03A 2VF6A 4KKMA 2Q58A 5DJRF 5ILYA 3P8RA 1VG6A 5IK0A 1DGPA 1UBXA 5H9DA 4F62A 3OABB 3KRFB 1EZFA 4GA3A 1YYTA 1V4IA 3Q30A 3MAVA 2E8VA 3LSNA 3LEEA 4EA0A 3S4JA 5HN8A 5A0KA 1YQ7A 5B0KA 4KVYA 4LZ3A 5ILDA 1JFGA 3LVSA 2PS4A 4KQUA 2AELA 2F7MF 3WCCA 3WCMA 5I1UA 4MC8A 2Z78A 2ZEVA 4H5EF 4NKEA 4DWBA 1HM7A 5DJVF 1WL2A 5AELA 2Z4YA 3Q2QA 4NFJF 3S9VA 3WC9A 3P5PA 4GP2A 2I19A 4KVIA 3KRCB 3NF2A 5B0MA 2ZCRA 3M02A 2F9KF 4DHDA 2ZCOA 3KBKA 3VJEA 1V4KA 1RTRA 2RAHA 1N1ZA 4LUUA 4NKFA 4LFEA 1JFAA 1FPSA 3TFVA 4FP4A 2E94A 5EROA 4KWDA 3EZ3A 4RXAA 1PS1A 3CP6A 3ZOUA 3M01A 3N1WF 4H5DF 3WCBA 1V4EA 1N22A 4KVDA 4LLTA 2ZCQA 4E9UA 2OA6A 3WCFA 3EGTA 4OMHA 5DW7A 4LZ0A 3UCAA 3WEGA 3IPIA 5IMPA 3WEIA 2ZEUA 4MC3A 3WEJA 3WJOA 3N3DA 3IBAA 3N3LF 3N49F 5ILHA 3DYHA 5IL3A 2O1OA 3ASXA 3V1XA 4N9UA 4XQSF 3WSBA 2PS7A 1WL0A 5AFXA 4LIXA 4RNQA 3EFQA 3ICMA 4KPJA 4N1ZF 3WJKA 2F8ZF 1YYUA 5ILKA 5E8HA 3RBMA 4DEMF 2ZY1A 4KFAA 4OKMA 4KVWA 2Z4XA 4LTVA 4RXDA 2E91A 3N0GA 5HNAA 5HN9A 4NUAA 5A0IA 5JA0F 5C05A 3B7LA 3ICNA 2Z52A 1UBVA 3SDTA 5IMNA 1UBYA 4XQTF 3ZMCA 4DI5A 1HM4A 5DIQF 2E8UA 3WCLA 4ZQ8A 3VJ8A 1HXGA 1HXAA 3KRPB 5AYPA 2AZKA 3ZCDA 3WCGA 2FORA 1YV5A 1V4HA 3W7FA 3WCEA 5HN7A 3OABA 3LGKA 3P8LA 4WK5A 3LK5A 5B00A 5DGMF 3WCHA 3WEKA 4JXNA 2PS5A 3APZA 5CG5A 1WKZA 2E4OA 3ICZA 3N45F 3CC9A 1V4JA 2E90A 3LG5A 1RQIA 2P1CA 4LPGF 4DZWA 1YYSA 3OACA 3V66A 2F94F 2ONHA 3KROB 1HXCA 4H5CF 3KB9A 4L2XF 1VG4A 3WJNA 3BNXA 4GP1A 4FJQA 1RQJA 2H8OA 4LFVF 3SDRA 5IN8A 4RXCA 4P0WA 5IK6A 2E8WA 1DI1A 2AZLA 2Z7HA 3LOMA 2E92A 4RYPA 4P0XA 4Q23A 5DGSF 3ID0A 3RMGA 5ILJA 3QKCA 3LDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WEH A;  5A0J A;  4PVY F;  3N5H F;  5JV1 F;  2E8T A;  1N24 A;  3M0G A;  4DWG A;  3CKE A;  4PVX F;  1YHM A;  3VJD A;  1HX9 A;  5DJP F;  4KK2 A;  1YYQ A;  3DYF A;  3V1V A;  5AHU B;  3ACY A;  3KRA B;  4RXE A;  4UMJ A;  2OGD A;  2ONG A;  4LPH F;  5IMI A;  5E8K A;  2Q80 A;  2PS8 A;  4KPD A;  1VG7 A;  3MZV A;  4EA1 A;  2PS6 A;  3DYG A;  3PYA A;  2Q9Z A;  4LZC A;  4E1E A;  3ICK A;  4LA5 A;  4MC0 A;  3LJI A;  5DHI A;  4NFK F;  4OKZ A;  3RYW A;  2Q9Y A;  4LTZ A;  2J1O A;  4JZB A;  5KSX F;  1YHK A;  1KIY A;  4KQS A;  4LOB A;  5DZ2 A;  3P5R A;  3WSA A;  5JUZ F;  2F89 F;  3AQB B;  3N1V F;  2QIS A;  2DH4 A;  4LA6 A;  4OGU A;  4OMG A;  5EAU A;  5IVG A;  5ILZ A;  4GAX A;  3N0F A;  3N46 F;  3G4F A;  1WMW A;  3N6K F;  3SDQ A;  3TFN A;  2F8C F;  3P41 A;  4EA2 A;  4QXS F;  5JV0 F;  2FTZ A;  5ERN A;  5IKH A;  1N20 A;  1ZW5 A;  3WEF A;  4DXJ A;  3WCJ A;  3LGZ B;  3ACW A;  2Z7I A;  3NRI A;  4JXY A;  3KRF A;  3RYE A;  3LMD A;  3SAE A;  2Z4W A;  3WCA A;  3Q1O A;  1UBW A;  2Z4Z A;  4JVJ F;  2AZJ A;  1WY0 A;  3KRP A;  1N21 A;  5DGN F;  5B01 A;  3PH7 A;  2AEK A;  3TFP A;  5E8L A;  1KIZ A;  2E93 A;  5ER8 A;  3VJC A;  3Q2Z A;  2E8X A;  3G4D A;  1VG2 A;  2F92 F;  3OAC B;  4LFG A;  3PYB A;  3VJA A;  3N5J F;  2Z4V A;  4XQR F;  5DHK A;  5ERM A;  3KRC A;  5CG6 A;  5IK9 A;  4K10 A;  3AQC B;  5EAT A;  3ACX A;  3ADZ A;  1N1B A;  2AET A;  3AQ0 A;  3ZMB A;  2J1P A;  3LZ9 A;  1YYR A;  2OPN A;  3AE0 A;  3KRO A;  4JZX A;  4E9Z A;  2EWG A;  1WL3 A;  4F6V A;  3PKO A;  3OYR A;  4NG6 A;  1VG3 A;  1N23 A;  5B0L A;  3NPK A;  4JYX A;  4KQ5 A;  4P0V A;  5JV2 F;  2J5C A;  3M9U A;  5IM1 A;  2OPM A;  2E95 A;  3M00 A;  2ZCS A;  5ILI A;  3TC1 A;  3LLW A;  4F6X A;  4KUX A;  3PDE A;  4LLS A;  3VJB A;  4HD1 A;  5B0I A;  3ZL6 A;  1WL1 A;  4LXW A;  5EAS A;  5B0J A;  5IKA A;  3BNY A;  5IL8 A;  3QQV A;  3SDV A;  3SDU A;  1YHL A;  3KRA A;  4NFI F;  3VJ9 A;  1YJ4 A;  3NPR A;  2Z50 A;  3WCD A;  5B02 A;  3TS7 A;  4QPF A;  3WCI A;  3WE9 A;  5B03 A;  2VF6 A;  4KKM A;  2Q58 A;  5DJR F;  5ILY A;  3P8R A;  1VG6 A;  5IK0 A;  1DGP A;  1UBX A;  5H9D A;  4F62 A;  3OAB B;  3KRF B;  1EZF A;  4GA3 A;  1YYT A;  1V4I A;  3Q30 A;  3MAV A;  2E8V A;  3LSN A;  3LEE A;  4EA0 A;  3S4J A;  5HN8 A;  5A0K A;  1YQ7 A;  5B0K A;  4KVY A;  4LZ3 A;  5ILD A;  1JFG A;  3LVS A;  2PS4 A;  4KQU A;  2AEL A;  2F7M F;  3WCC A;  3WCM A;  5I1U A;  4MC8 A;  2Z78 A;  2ZEV A;  4H5E F;  4NKE A;  4DWB A;  1HM7 A;  5DJV F;  1WL2 A;  5AEL A;  2Z4Y A;  3Q2Q A;  4NFJ F;  3S9V A;  3WC9 A;  3P5P A;  4GP2 A;  2I19 A;  4KVI A;  3KRC B;  3NF2 A;  5B0M A;  2ZCR A;  3M02 A;  2F9K F;  4DHD A;  2ZCO A;  3KBK A;  3VJE A;  1V4K A;  1RTR A;  2RAH A;  1N1Z A;  4LUU A;  4NKF A;  4LFE A;  1JFA A;  1FPS A;  3TFV A;  4FP4 A;  2E94 A;  5ERO A;  4KWD A;  3EZ3 A;  4RXA A;  1PS1 A;  3CP6 A;  3ZOU A;  3M01 A;  3N1W F;  4H5D F;  3WCB A;  1V4E A;  1N22 A;  4KVD A;  4LLT A;  2ZCQ A;  4E9U A;  2OA6 A;  3WCF A;  3EGT A;  4OMH A;  5DW7 A;  4LZ0 A;  3UCA A;  3WEG A;  3IPI A;  5IMP A;  3WEI A;  2ZEU A;  4MC3 A;  3WEJ A;  3WJO A;  3N3D A;  3IBA A;  3N3L F;  3N49 F;  5ILH A;  3DYH A;  5IL3 A;  2O1O A;  3ASX A;  3V1X A;  4N9U A;  4XQS F;  3WSB A;  2PS7 A;  1WL0 A;  5AFX A;  4LIX A;  4RNQ A;  3EFQ A;  3ICM A;  4KPJ A;  4N1Z F;  3WJK A;  2F8Z F;  1YYU A;  5ILK A;  5E8H A;  3RBM A;  4DEM F;  2ZY1 A;  4KFA A;  4OKM A;  4KVW A;  2Z4X A;  4LTV A;  4RXD A;  2E91 A;  3N0G A;  5HNA A;  5HN9 A;  4NUA A;  5A0I A;  5JA0 F;  5C05 A;  3B7L A;  3ICN A;  2Z52 A;  1UBV A;  3SDT A;  5IMN A;  1UBY A;  4XQT F;  3ZMC A;  4DI5 A;  1HM4 A;  5DIQ F;  2E8U A;  3WCL A;  4ZQ8 A;  3VJ8 A;  1HXG A;  1HXA A;  3KRP B;  5AYP A;  2AZK A;  3ZCD A;  3WCG A;  2FOR A;  1YV5 A;  1V4H A;  3W7F A;  3WCE A;  5HN7 A;  3OAB A;  3LGK A;  3P8L A;  4WK5 A;  3LK5 A;  5B00 A;  5DGM F;  3WCH A;  3WEK A;  4JXN A;  2PS5 A;  3APZ A;  5CG5 A;  1WKZ A;  2E4O A;  3ICZ A;  3N45 F;  3CC9 A;  1V4J A;  2E90 A;  3LG5 A;  1RQI A;  2P1C A;  4LPG F;  4DZW A;  1YYS A;  3OAC A;  3V66 A;  2F94 F;  2ONH A;  3KRO B;  1HXC A;  4H5C F;  3KB9 A;  4L2X F;  1VG4 A;  3WJN A;  3BNX A;  4GP1 A;  4FJQ A;  1RQJ A;  2H8O A;  4LFV F;  3SDR A;  5IN8 A;  4RXC A;  4P0W A;  5IK6 A;  2E8W A;  1DI1 A;  2AZL A;  2Z7H A;  3LOM A;  2E92 A;  4RYP A;  4P0X A;  4Q23 A;  5DGS F;  3ID0 A;  3RMG A;  5ILJ A;  3QKC A;  3LDW A; 
#chains in the Genus database with same CATH topology
 3WEH A;  5A0J A;  4PVY F;  3N5H F;  5JV1 F;  2E8T A;  1N24 A;  3M0G A;  4DWG A;  3CKE A;  4PVX F;  1YHM A;  3VJD A;  1HX9 A;  5DJP F;  4KK2 A;  1YYQ A;  3DYF A;  3V1V A;  5AHU B;  3ACY A;  3KRA B;  4RXE A;  4UMJ A;  2OGD A;  2ONG A;  4LPH F;  5IMI A;  5E8K A;  2Q80 A;  2PS8 A;  4KPD A;  1VG7 A;  3MZV A;  4EA1 A;  2PS6 A;  3DYG A;  3PYA A;  2Q9Z A;  4LZC A;  4E1E A;  3ICK A;  4LA5 A;  4MC0 A;  3LJI A;  5DHI A;  4NFK F;  4OKZ A;  3RYW A;  2Q9Y A;  4LTZ A;  2J1O A;  4JZB A;  5KSX F;  1YHK A;  1KIY A;  4KQS A;  4LOB A;  5DZ2 A;  3P5R A;  3WSA A;  5JUZ F;  2F89 F;  3AQB B;  3N1V F;  2QIS A;  2DH4 A;  4LA6 A;  4OGU A;  4OMG A;  5EAU A;  5IVG A;  5ILZ A;  4GAX A;  3N0F A;  3N46 F;  3G4F A;  1WMW A;  3N6K F;  3SDQ A;  3TFN A;  2F8C F;  3P41 A;  4EA2 A;  4QXS F;  5JV0 F;  2FTZ A;  5ERN A;  5IKH A;  1N20 A;  1ZW5 A;  3WEF A;  4DXJ A;  3WCJ A;  3LGZ B;  3ACW A;  2Z7I A;  3NRI A;  4JXY A;  3KRF A;  3RYE A;  3LMD A;  3SAE A;  2Z4W A;  3WCA A;  3Q1O A;  1UBW A;  2Z4Z A;  4JVJ F;  2AZJ A;  1WY0 A;  3KRP A;  1N21 A;  5DGN F;  5B01 A;  3PH7 A;  2AEK A;  3TFP A;  5E8L A;  1KIZ A;  2E93 A;  5ER8 A;  3VJC A;  3Q2Z A;  2E8X A;  3G4D A;  1VG2 A;  2F92 F;  3OAC B;  4LFG A;  3PYB A;  3VJA A;  3N5J F;  2Z4V A;  4XQR F;  5DHK A;  5ERM A;  3KRC A;  5CG6 A;  5IK9 A;  4K10 A;  3AQC B;  5EAT A;  3ACX A;  3ADZ A;  1N1B A;  2AET A;  3AQ0 A;  3ZMB A;  2J1P A;  3LZ9 A;  1YYR A;  2OPN A;  3AE0 A;  3KRO A;  4JZX A;  4E9Z A;  2EWG A;  1WL3 A;  4F6V A;  3PKO A;  3OYR A;  4NG6 A;  1VG3 A;  1N23 A;  5B0L A;  3NPK A;  4JYX A;  4KQ5 A;  4P0V A;  5JV2 F;  2J5C A;  3M9U A;  5IM1 A;  2OPM A;  2E95 A;  3M00 A;  2ZCS A;  5ILI A;  3TC1 A;  3LLW A;  4F6X A;  4KUX A;  3PDE A;  4LLS A;  3VJB A;  4HD1 A;  5B0I A;  3ZL6 A;  1WL1 A;  4LXW A;  5EAS A;  5B0J A;  5IKA A;  3BNY A;  5IL8 A;  3QQV A;  3SDV A;  3SDU A;  1YHL A;  3KRA A;  4NFI F;  3VJ9 A;  1YJ4 A;  3NPR A;  2Z50 A;  3WCD A;  5B02 A;  3TS7 A;  4QPF A;  3WCI A;  3WE9 A;  5B03 A;  2VF6 A;  4KKM A;  2Q58 A;  5DJR F;  5ILY A;  3P8R A;  1VG6 A;  5IK0 A;  1DGP A;  1UBX A;  5H9D A;  4F62 A;  3OAB B;  3KRF B;  1EZF A;  4GA3 A;  1YYT A;  1V4I A;  3Q30 A;  3MAV A;  2E8V A;  3LSN A;  3LEE A;  4EA0 A;  3S4J A;  5HN8 A;  5A0K A;  1YQ7 A;  5B0K A;  4KVY A;  4LZ3 A;  5ILD A;  1JFG A;  3LVS A;  2PS4 A;  4KQU A;  2AEL A;  2F7M F;  3WCC A;  3WCM A;  5I1U A;  4MC8 A;  2Z78 A;  2ZEV A;  4H5E F;  4NKE A;  4DWB A;  1HM7 A;  5DJV F;  1WL2 A;  5AEL A;  2Z4Y A;  3Q2Q A;  4NFJ F;  3S9V A;  3WC9 A;  3P5P A;  4GP2 A;  2I19 A;  4KVI A;  3KRC B;  3NF2 A;  5B0M A;  2ZCR A;  3M02 A;  2F9K F;  4DHD A;  2ZCO A;  3KBK A;  3VJE A;  1V4K A;  1RTR A;  2RAH A;  1N1Z A;  4LUU A;  4NKF A;  4LFE A;  1JFA A;  1FPS A;  3TFV A;  4FP4 A;  2E94 A;  5ERO A;  4KWD A;  3EZ3 A;  4RXA A;  1PS1 A;  3CP6 A;  3ZOU A;  3M01 A;  3N1W F;  4H5D F;  3WCB A;  1V4E A;  1N22 A;  4KVD A;  4LLT A;  2ZCQ A;  4E9U A;  2OA6 A;  3WCF A;  3EGT A;  4OMH A;  5DW7 A;  4LZ0 A;  3UCA A;  3WEG A;  3IPI A;  5IMP A;  3WEI A;  2ZEU A;  4MC3 A;  3WEJ A;  3WJO A;  3N3D A;  3IBA A;  3N3L F;  3N49 F;  5ILH A;  3DYH A;  5IL3 A;  2O1O A;  3ASX A;  3V1X A;  4N9U A;  4XQS F;  3WSB A;  2PS7 A;  1WL0 A;  5AFX A;  4LIX A;  4RNQ A;  3EFQ A;  3ICM A;  4KPJ A;  4N1Z F;  3WJK A;  2F8Z F;  1YYU A;  5ILK A;  5E8H A;  3RBM A;  4DEM F;  2ZY1 A;  4KFA A;  4OKM A;  4KVW A;  2Z4X A;  4LTV A;  4RXD A;  2E91 A;  3N0G A;  5HNA A;  5HN9 A;  4NUA A;  5A0I A;  5JA0 F;  5C05 A;  3B7L A;  3ICN A;  2Z52 A;  1UBV A;  3SDT A;  5IMN A;  1UBY A;  4XQT F;  3ZMC A;  4DI5 A;  1HM4 A;  5DIQ F;  2E8U A;  3WCL A;  4ZQ8 A;  3VJ8 A;  1HXG A;  1HXA A;  3KRP B;  5AYP A;  2AZK A;  3ZCD A;  3WCG A;  2FOR A;  1YV5 A;  1V4H A;  3W7F A;  3WCE A;  5HN7 A;  3OAB A;  3LGK A;  3P8L A;  4WK5 A;  3LK5 A;  5B00 A;  5DGM F;  3WCH A;  3WEK A;  4JXN A;  2PS5 A;  3APZ A;  5CG5 A;  1WKZ A;  2E4O A;  3ICZ A;  3N45 F;  3CC9 A;  1V4J A;  2E90 A;  3LG5 A;  1RQI A;  2P1C A;  4LPG F;  4DZW A;  1YYS A;  3OAC A;  3V66 A;  2F94 F;  2ONH A;  3KRO B;  1HXC A;  4H5C F;  3KB9 A;  4L2X F;  1VG4 A;  3WJN A;  3BNX A;  4GP1 A;  4FJQ A;  1RQJ A;  2H8O A;  4LFV F;  3SDR A;  5IN8 A;  4RXC A;  4P0W A;  5IK6 A;  2E8W A;  1DI1 A;  2AZL A;  2Z7H A;  3LOM A;  2E92 A;  4RYP A;  4P0X A;  4Q23 A;  5DGS F;  3ID0 A;  3RMG A;  5ILJ A;  3QKC A;  3LDW A; 
#chains in the Genus database with same CATH homology
 3WEH A;  5A0J A;  4PVY F;  3N5H F;  5JV1 F;  2E8T A;  1N24 A;  3M0G A;  4DWG A;  3CKE A;  4PVX F;  1YHM A;  3VJD A;  1HX9 A;  5DJP F;  4KK2 A;  1YYQ A;  3DYF A;  3V1V A;  5AHU B;  3ACY A;  3KRA B;  4RXE A;  4UMJ A;  2OGD A;  2ONG A;  4LPH F;  5IMI A;  5E8K A;  2Q80 A;  2PS8 A;  4KPD A;  1VG7 A;  3MZV A;  4EA1 A;  2PS6 A;  3DYG A;  3PYA A;  2Q9Z A;  4LZC A;  4E1E A;  3ICK A;  4LA5 A;  4MC0 A;  3LJI A;  5DHI A;  4NFK F;  4OKZ A;  3RYW A;  2Q9Y A;  4LTZ A;  2J1O A;  4JZB A;  5KSX F;  1YHK A;  1KIY A;  4KQS A;  4LOB A;  5DZ2 A;  3P5R A;  3WSA A;  5JUZ F;  2F89 F;  3AQB B;  3N1V F;  2QIS A;  2DH4 A;  4LA6 A;  4OGU A;  4OMG A;  5EAU A;  5IVG A;  5ILZ A;  4GAX A;  3N0F A;  3N46 F;  3G4F A;  1WMW A;  3N6K F;  3SDQ A;  3TFN A;  2F8C F;  3P41 A;  4EA2 A;  4QXS F;  5JV0 F;  2FTZ A;  5ERN A;  5IKH A;  1N20 A;  1ZW5 A;  3WEF A;  4DXJ A;  3WCJ A;  3LGZ B;  3ACW A;  2Z7I A;  3NRI A;  4JXY A;  3KRF A;  3RYE A;  3LMD A;  3SAE A;  2Z4W A;  3WCA A;  3Q1O A;  1UBW A;  2Z4Z A;  4JVJ F;  2AZJ A;  1WY0 A;  3KRP A;  1N21 A;  5DGN F;  5B01 A;  3PH7 A;  2AEK A;  3TFP A;  5E8L A;  1KIZ A;  2E93 A;  5ER8 A;  3VJC A;  3Q2Z A;  2E8X A;  3G4D A;  1VG2 A;  2F92 F;  3OAC B;  4LFG A;  3PYB A;  3VJA A;  3N5J F;  2Z4V A;  4XQR F;  5DHK A;  5ERM A;  3KRC A;  5CG6 A;  5IK9 A;  4K10 A;  3AQC B;  5EAT A;  3ACX A;  3ADZ A;  1N1B A;  2AET A;  3AQ0 A;  3ZMB A;  2J1P A;  3LZ9 A;  1YYR A;  2OPN A;  3AE0 A;  3KRO A;  4JZX A;  4E9Z A;  2EWG A;  1WL3 A;  4F6V A;  3PKO A;  3OYR A;  4NG6 A;  1VG3 A;  1N23 A;  5B0L A;  3NPK A;  4JYX A;  4KQ5 A;  4P0V A;  5JV2 F;  2J5C A;  3M9U A;  5IM1 A;  2OPM A;  2E95 A;  3M00 A;  2ZCS A;  5ILI A;  3TC1 A;  3LLW A;  4F6X A;  4KUX A;  3PDE A;  4LLS A;  3VJB A;  4HD1 A;  5B0I A;  3ZL6 A;  1WL1 A;  4LXW A;  5EAS A;  5B0J A;  5IKA A;  3BNY A;  5IL8 A;  3QQV A;  3SDV A;  3SDU A;  1YHL A;  3KRA A;  4NFI F;  3VJ9 A;  1YJ4 A;  3NPR A;  2Z50 A;  3WCD A;  5B02 A;  3TS7 A;  4QPF A;  3WCI A;  3WE9 A;  5B03 A;  2VF6 A;  4KKM A;  2Q58 A;  5DJR F;  5ILY A;  3P8R A;  1VG6 A;  5IK0 A;  1DGP A;  1UBX A;  5H9D A;  4F62 A;  3OAB B;  3KRF B;  1EZF A;  4GA3 A;  1YYT A;  1V4I A;  3Q30 A;  3MAV A;  2E8V A;  3LSN A;  3LEE A;  4EA0 A;  3S4J A;  5HN8 A;  5A0K A;  1YQ7 A;  5B0K A;  4KVY A;  4LZ3 A;  5ILD A;  1JFG A;  3LVS A;  2PS4 A;  4KQU A;  2AEL A;  2F7M F;  3WCC A;  3WCM A;  5I1U A;  4MC8 A;  2Z78 A;  2ZEV A;  4H5E F;  4NKE A;  4DWB A;  1HM7 A;  5DJV F;  1WL2 A;  5AEL A;  2Z4Y A;  3Q2Q A;  4NFJ F;  3S9V A;  3WC9 A;  3P5P A;  4GP2 A;  2I19 A;  4KVI A;  3KRC B;  3NF2 A;  5B0M A;  2ZCR A;  3M02 A;  2F9K F;  4DHD A;  2ZCO A;  3KBK A;  3VJE A;  1V4K A;  1RTR A;  2RAH A;  1N1Z A;  4LUU A;  4NKF A;  4LFE A;  1JFA A;  1FPS A;  3TFV A;  4FP4 A;  2E94 A;  5ERO A;  4KWD A;  3EZ3 A;  4RXA A;  1PS1 A;  3CP6 A;  3ZOU A;  3M01 A;  3N1W F;  4H5D F;  3WCB A;  1V4E A;  1N22 A;  4KVD A;  4LLT A;  2ZCQ A;  4E9U A;  2OA6 A;  3WCF A;  3EGT A;  4OMH A;  5DW7 A;  4LZ0 A;  3UCA A;  3WEG A;  3IPI A;  5IMP A;  3WEI A;  2ZEU A;  4MC3 A;  3WEJ A;  3WJO A;  3N3D A;  3IBA A;  3N3L F;  3N49 F;  5ILH A;  3DYH A;  5IL3 A;  2O1O A;  3ASX A;  3V1X A;  4N9U A;  4XQS F;  3WSB A;  2PS7 A;  1WL0 A;  5AFX A;  4LIX A;  4RNQ A;  3EFQ A;  3ICM A;  4KPJ A;  4N1Z F;  3WJK A;  2F8Z F;  1YYU A;  5ILK A;  5E8H A;  3RBM A;  4DEM F;  2ZY1 A;  4KFA A;  4OKM A;  4KVW A;  2Z4X A;  4LTV A;  4RXD A;  2E91 A;  3N0G A;  5HNA A;  5HN9 A;  4NUA A;  5A0I A;  5JA0 F;  5C05 A;  3B7L A;  3ICN A;  2Z52 A;  1UBV A;  3SDT A;  5IMN A;  1UBY A;  4XQT F;  3ZMC A;  4DI5 A;  1HM4 A;  5DIQ F;  2E8U A;  3WCL A;  4ZQ8 A;  3VJ8 A;  1HXG A;  1HXA A;  3KRP B;  5AYP A;  2AZK A;  3ZCD A;  3WCG A;  2FOR A;  1YV5 A;  1V4H A;  3W7F A;  3WCE A;  5HN7 A;  3OAB A;  3LGK A;  3P8L A;  4WK5 A;  3LK5 A;  5B00 A;  5DGM F;  3WCH A;  3WEK A;  4JXN A;  2PS5 A;  3APZ A;  5CG5 A;  1WKZ A;  2E4O A;  3ICZ A;  3N45 F;  3CC9 A;  1V4J A;  2E90 A;  3LG5 A;  1RQI A;  2P1C A;  4LPG F;  4DZW A;  1YYS A;  3OAC A;  3V66 A;  2F94 F;  2ONH A;  3KRO B;  1HXC A;  4H5C F;  3KB9 A;  4L2X F;  1VG4 A;  3WJN A;  3BNX A;  4GP1 A;  4FJQ A;  1RQJ A;  2H8O A;  4LFV F;  3SDR A;  5IN8 A;  4RXC A;  4P0W A;  5IK6 A;  2E8W A;  1DI1 A;  2AZL A;  2Z7H A;  3LOM A;  2E92 A;  4RYP A;  4P0X A;  4Q23 A;  5DGS F;  3ID0 A;  3RMG A;  5ILJ A;  3QKC A;  3LDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...