5IMNA

Crystal structure of n299a/s303a aspergillus terreus aristolochene synthase complexed with (1s,8s,9ar)-1,9a-dimethyl-8-(prop-1-en-2-yl)decahydroquinolizin-5-ium
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
304
structure length
304
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGAELWAQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aristolochene synthase
publication title Probing the Role of Active Site Water in the Sesquiterpene Cyclization Reaction Catalyzed by Aristolochene Synthase.
pubmed doi rcsb
source organism Aspergillus terreus
molecule tags Lyase/lyase inhibitor
total genus 125
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5imnA00
3N3DA 4P0XA 2H8OA 3LSNA 2ZCQA 3CP6A 5IKHA 3OABA 3ZMCA 5JV1F 2Z4VA 3LDWA 3OABB 3KROA 5IVGA 3KROB 5ILKA 2AZJA 2QISA 2VF6A 2PS8A 3OYRA 1N24A 4N1ZF 4DWBA 4L2XF 3WEHA 3LOMA 5B03A 5AFXA 2OPMA 5KSXF 3EGTA 2RAHA 1V4JA 4LA6A 1VG2A 4OGUA 2AZLA 3S4JA 4GP2A 2ONHA 3KBKA 5IKAA 4GAXA 3WEGA 4KVYA 1YYSA 4LUUA 3AQBB 1YYRA 3P8RA 3P41A 4LZ3A 4RXCA 2PS7A 2Z7IA 2FORA 2PS4A 3TC1A 3N1VF 2ZCOA 3MZVA 5CG6A 1YHLA 5JUZF 5ER8A 3WJOA 4XQRF 2OA6A 5IMNA 5ILHA 4E1EA 5E8HA 3AQ0A 4XQSF 3APZA 3M00A 4EA2A 3LVSA 5B0KA 3TFNA 5ILJA 1V4IA 3ZOUA 3G4DA 4LLSA 3ACXA 3NPRA 2J1OA 3VJEA 4JVJF 4KPDA 3M9UA 5B0JA 1HM4A 2F9KF 3WCLA 4DEMF 4H5DF 4E9UA 3WCMA 1HXGA 1JFGA 5A0KA 3N3LF 3VJAA 1WL2A 5AELA 5JV2F 2Z50A 4GA3A 3WCBA 2E95A 3DYHA 5A0JA 1UBWA 4KVWA 4F62A 3AE0A 1YYUA 5ILZA 3SDVA 5B0MA 1UBYA 3SDUA 3WSBA 1JFAA 1RQIA 5DGNF 5A0IA 1YYQA 3TFPA 2E8UA 1N22A 3B7LA 4JXYA 1RQJA 4RYPA 3WE9A 4LZCA 1V4HA 4OMHA 1WMWA 1DGPA 4LXWA 3N45F 5ILIA 3CC9A 3SAEA 1N1ZA 3OACA 3IPIA 1ZW5A 4LPHF 3ZL6A 3OACB 4WK5A 2F92F 4RXAA 3KRCA 4XQTF 3QQVA 4H5CF 3RMGA 1V4KA 3ICZA 3KRCB 5C05A 3N1WF 5E8KA 5HN8A 2EWGA 4QPFA 4KPJA 2Z78A 3N6KF 3Q2ZA 5EASA 3S9VA 2ZY1A 3LJIA 3LGZB 3UCAA 4KUXA 4LOBA 1HXAA 5IMIA 3ICNA 3Q1OA 1KIZA 5ERMA 1YHKA 5B0LA 4LA5A 1YV5A 1HM7A 2F94F 3ICMA 4KKMA 4KVDA 2AEKA 2P1CA 3M02A 5B00A 3ICKA 3N0FA 3VJ9A 5E8LA 4K10A 1YQ7A 4H5EF 4NG6A 2Z7HA 5DGMF 2E93A 4DWGA 5DJRF 4RXDA 3WCEA 3DYFA 4DHDA 4KQ5A 4KQUA 2PS6A 3KRAA 3NRIA 3WCFA 2E92A 3VJBA 3KRAB 5JV0F 3SDRA 4UMJA 4KFAA 1WY0A 3PYBA 2OPNA 4RNQA 3NF2A 4ZQ8A 1WL0A 5DZ2A 1YYTA 3ACYA 5HN9A 1VG7A 2Q9YA 4LFGA 1FPSA 4NFJF 5IN8A 3KRFA 5IK9A 3BNXA 3EFQA 3WCCA 3KRFB 3VJDA 2E90A 3SDTA 2J5CA 2ZEUA 3ZMBA 4PVXF 4PVYF 3WCAA 5B0IA 3N5HF 3ASXA 3WEFA 5HN7A 3QKCA 4NKFA 3W7FA 1WL1A 3N0GA 3PH7A 2Z4ZA 3BNYA 3VJ8A 1N20A 3G4FA 3WSAA 2E91A 3NPKA 5CG5A 4LTVA 2ZEVA 4DZWA 3MAVA 1UBXA 3M01A 4NFIF 3N49F 4KVIA 2ZCRA 5AHUB 2E8VA 3WJKA 1N23A 3RYWA 3LEEA 2ONGA 5DW7A 4GP1A 4F6XA 5ILDA 4LFVF 3V1VA 4EA1A 4KWDA 1HX9A 2Z52A 3LG5A 3ZCDA 5H9DA 3WCDA 4P0VA 1N1BA 4LIXA 4KQSA 3ADZA 4FP4A 3WEIA 5IK6A 1EZFA 3WEJA 4E9ZA 4LFEA 4LZ0A 4JZBA 4OKZA 4OKMA 1VG3A 3WC9A 5IM1A 3PDEA 5EROA 3V1XA 3M0GA 3IBAA 3CKEA 5DJVF 3AQCB 4NFKF 3WEKA 3WCHA 3ACWA 4F6VA 3RBMA 3LK5A 3LGKA 5B01A 4MC0A 4LLTA 3P8LA 3KRPA 4KK2A 4LPGF 1KIYA 3KRPB 3Q2QA 4MC8A 4N9UA 4NUAA 4DXJA 3WCIA 3LMDA 4P0WA 4QXSF 3DYGA 5DHKA 2O1OA 5EATA 2Q80A 1VG4A 2E94A 2PS5A 3LLWA 3P5PA 5IL8A 4LTZA 2ZCSA 5JA0F 2E4OA 2Z4WA 2E8WA 1HXCA 4JZXA 1N21A 2FTZA 4EA0A 5DHIA 1WKZA 1V4EA 5AYPA 3TS7A 3EZ3A 3N5JF 1YJ4A 1WL3A 5HNAA 3PKOA 2Z4YA 4HD1A 5IL3A 1PS1A 2Q58A 2F8ZF 3V66A 3VJCA 4Q23A 3SDQA 1UBVA 4DI5A 2I19A 5I1UA 2F8CF 2F7MF 2J1PA 2AETA 3WCJA 1VG6A 2OGDA 4RXEA 3RYEA 4OMGA 1YHMA 3N46F 5EAUA 5ILYA 4NKEA 1RTRA 4FJQA 2DH4A 5DJPF 5DIQF 3PYAA 3ID0A 3Q30A 4MC3A 3WCGA 5ERNA 2AELA 2F89F 2AZKA 3TFVA 4JXNA 2Z4XA 3KB9A 1DI1A 5IMPA 5B02A 2Q9ZA 3WJNA 4JYXA 5IK0A 3LZ9A 5DGSF 2E8XA 3P5RA 2E8TA
chains in the Genus database with same CATH superfamily
3N3DA 4P0XA 2H8OA 3LSNA 2ZCQA 3CP6A 5IKHA 3OABA 3ZMCA 5JV1F 2Z4VA 3LDWA 3OABB 3KROA 5IVGA 3KROB 5ILKA 2AZJA 2QISA 2VF6A 2PS8A 3OYRA 1N24A 4N1ZF 4DWBA 4L2XF 3WEHA 3LOMA 5B03A 5AFXA 2OPMA 5KSXF 3EGTA 2RAHA 1V4JA 4LA6A 1VG2A 4OGUA 2AZLA 3S4JA 4GP2A 2ONHA 3KBKA 5IKAA 4GAXA 3WEGA 4KVYA 1YYSA 4LUUA 3AQBB 1YYRA 3P8RA 3P41A 4LZ3A 4RXCA 2PS7A 2Z7IA 2FORA 2PS4A 3TC1A 3N1VF 2ZCOA 3MZVA 5CG6A 1YHLA 5JUZF 5ER8A 3WJOA 4XQRF 2OA6A 5IMNA 5ILHA 4E1EA 5E8HA 3AQ0A 4XQSF 3APZA 3M00A 4EA2A 3LVSA 5B0KA 3TFNA 5ILJA 1V4IA 3ZOUA 3G4DA 4LLSA 3ACXA 3NPRA 2J1OA 3VJEA 4JVJF 4KPDA 3M9UA 5B0JA 1HM4A 2F9KF 3WCLA 4DEMF 4H5DF 4E9UA 3WCMA 1HXGA 1JFGA 5A0KA 3N3LF 3VJAA 1WL2A 5AELA 5JV2F 2Z50A 4GA3A 3WCBA 2E95A 3DYHA 5A0JA 1UBWA 4KVWA 4F62A 3AE0A 1YYUA 5ILZA 3SDVA 5B0MA 1UBYA 3SDUA 3WSBA 1JFAA 1RQIA 5DGNF 5A0IA 1YYQA 3TFPA 2E8UA 1N22A 3B7LA 4JXYA 1RQJA 4RYPA 3WE9A 4LZCA 1V4HA 4OMHA 1WMWA 1DGPA 4LXWA 3N45F 5ILIA 3CC9A 3SAEA 1N1ZA 3OACA 3IPIA 1ZW5A 4LPHF 3ZL6A 3OACB 4WK5A 2F92F 4RXAA 3KRCA 4XQTF 3QQVA 4H5CF 3RMGA 1V4KA 3ICZA 3KRCB 5C05A 3N1WF 5E8KA 5HN8A 2EWGA 4QPFA 4KPJA 2Z78A 3N6KF 3Q2ZA 5EASA 3S9VA 2ZY1A 3LJIA 3LGZB 3UCAA 4KUXA 4LOBA 1HXAA 5IMIA 3ICNA 3Q1OA 1KIZA 5ERMA 1YHKA 5B0LA 4LA5A 1YV5A 1HM7A 2F94F 3ICMA 4KKMA 4KVDA 2AEKA 2P1CA 3M02A 5B00A 3ICKA 3N0FA 3VJ9A 5E8LA 4K10A 1YQ7A 4H5EF 4NG6A 2Z7HA 5DGMF 2E93A 4DWGA 5DJRF 4RXDA 3WCEA 3DYFA 4DHDA 4KQ5A 4KQUA 2PS6A 3KRAA 3NRIA 3WCFA 2E92A 3VJBA 3KRAB 5JV0F 3SDRA 4UMJA 4KFAA 1WY0A 3PYBA 2OPNA 4RNQA 3NF2A 4ZQ8A 1WL0A 5DZ2A 1YYTA 3ACYA 5HN9A 1VG7A 2Q9YA 4LFGA 1FPSA 4NFJF 5IN8A 3KRFA 5IK9A 3BNXA 3EFQA 3WCCA 3KRFB 3VJDA 2E90A 3SDTA 2J5CA 2ZEUA 3ZMBA 4PVXF 4PVYF 3WCAA 5B0IA 3N5HF 3ASXA 3WEFA 5HN7A 3QKCA 4NKFA 3W7FA 1WL1A 3N0GA 3PH7A 2Z4ZA 3BNYA 3VJ8A 1N20A 3G4FA 3WSAA 2E91A 3NPKA 5CG5A 4LTVA 2ZEVA 4DZWA 3MAVA 1UBXA 3M01A 4NFIF 3N49F 4KVIA 2ZCRA 5AHUB 2E8VA 3WJKA 1N23A 3RYWA 3LEEA 2ONGA 5DW7A 4GP1A 4F6XA 5ILDA 4LFVF 3V1VA 4EA1A 4KWDA 1HX9A 2Z52A 3LG5A 3ZCDA 5H9DA 3WCDA 4P0VA 1N1BA 4LIXA 4KQSA 3ADZA 4FP4A 3WEIA 5IK6A 1EZFA 3WEJA 4E9ZA 4LFEA 4LZ0A 4JZBA 4OKZA 4OKMA 1VG3A 3WC9A 5IM1A 3PDEA 5EROA 3V1XA 3M0GA 3IBAA 3CKEA 5DJVF 3AQCB 4NFKF 3WEKA 3WCHA 3ACWA 4F6VA 3RBMA 3LK5A 3LGKA 5B01A 4MC0A 4LLTA 3P8LA 3KRPA 4KK2A 4LPGF 1KIYA 3KRPB 3Q2QA 4MC8A 4N9UA 4NUAA 4DXJA 3WCIA 3LMDA 4P0WA 4QXSF 3DYGA 5DHKA 2O1OA 5EATA 2Q80A 1VG4A 2E94A 2PS5A 3LLWA 3P5PA 5IL8A 4LTZA 2ZCSA 5JA0F 2E4OA 2Z4WA 2E8WA 1HXCA 4JZXA 1N21A 2FTZA 4EA0A 5DHIA 1WKZA 1V4EA 5AYPA 3TS7A 3EZ3A 3N5JF 1YJ4A 1WL3A 5HNAA 3PKOA 2Z4YA 4HD1A 5IL3A 1PS1A 2Q58A 2F8ZF 3V66A 3VJCA 4Q23A 3SDQA 1UBVA 4DI5A 2I19A 5I1UA 2F8CF 2F7MF 2J1PA 2AETA 3WCJA 1VG6A 2OGDA 4RXEA 3RYEA 4OMGA 1YHMA 3N46F 5EAUA 5ILYA 4NKEA 1RTRA 4FJQA 2DH4A 5DJPF 5DIQF 3PYAA 3ID0A 3Q30A 4MC3A 3WCGA 5ERNA 2AELA 2F89F 2AZKA 3TFVA 4JXNA 2Z4XA 3KB9A 1DI1A 5IMPA 5B02A 2Q9ZA 3WJNA 4JYXA 5IK0A 3LZ9A 5DGSF 2E8XA 3P5RA 2E8TA
chains in the Genus database with same CATH topology
3N3DA 4P0XA 2H8OA 3LSNA 2ZCQA 3CP6A 5IKHA 3OABA 3ZMCA 5JV1F 2Z4VA 3LDWA 3OABB 3KROA 5IVGA 3KROB 5ILKA 2AZJA 2QISA 2VF6A 2PS8A 3OYRA 1N24A 4N1ZF 4DWBA 4L2XF 3WEHA 3LOMA 5B03A 5AFXA 2OPMA 5KSXF 3EGTA 2RAHA 1V4JA 4LA6A 1VG2A 4OGUA 2AZLA 3S4JA 4GP2A 2ONHA 3KBKA 5IKAA 4GAXA 3WEGA 4KVYA 1YYSA 4LUUA 3AQBB 1YYRA 3P8RA 3P41A 4LZ3A 4RXCA 2PS7A 2Z7IA 2FORA 2PS4A 3TC1A 3N1VF 2ZCOA 3MZVA 5CG6A 1YHLA 5JUZF 5ER8A 3WJOA 4XQRF 2OA6A 5IMNA 5ILHA 4E1EA 5E8HA 3AQ0A 4XQSF 3APZA 3M00A 4EA2A 3LVSA 5B0KA 3TFNA 5ILJA 1V4IA 3ZOUA 3G4DA 4LLSA 3ACXA 3NPRA 2J1OA 3VJEA 4JVJF 4KPDA 3M9UA 5B0JA 1HM4A 2F9KF 3WCLA 4DEMF 4H5DF 4E9UA 3WCMA 1HXGA 1JFGA 5A0KA 3N3LF 3VJAA 1WL2A 5AELA 5JV2F 2Z50A 4GA3A 3WCBA 2E95A 3DYHA 5A0JA 1UBWA 4KVWA 4F62A 3AE0A 1YYUA 5ILZA 3SDVA 5B0MA 1UBYA 3SDUA 3WSBA 1JFAA 1RQIA 5DGNF 5A0IA 1YYQA 3TFPA 2E8UA 1N22A 3B7LA 4JXYA 1RQJA 4RYPA 3WE9A 4LZCA 1V4HA 4OMHA 1WMWA 1DGPA 4LXWA 3N45F 5ILIA 3CC9A 3SAEA 1N1ZA 3OACA 3IPIA 1ZW5A 4LPHF 3ZL6A 3OACB 4WK5A 2F92F 4RXAA 3KRCA 4XQTF 3QQVA 4H5CF 3RMGA 1V4KA 3ICZA 3KRCB 5C05A 3N1WF 5E8KA 5HN8A 2EWGA 4QPFA 4KPJA 2Z78A 3N6KF 3Q2ZA 5EASA 3S9VA 2ZY1A 3LJIA 3LGZB 3UCAA 4KUXA 4LOBA 1HXAA 5IMIA 3ICNA 3Q1OA 1KIZA 5ERMA 1YHKA 5B0LA 4LA5A 1YV5A 1HM7A 2F94F 3ICMA 4KKMA 4KVDA 2AEKA 2P1CA 3M02A 5B00A 3ICKA 3N0FA 3VJ9A 5E8LA 4K10A 1YQ7A 4H5EF 4NG6A 2Z7HA 5DGMF 2E93A 4DWGA 5DJRF 4RXDA 3WCEA 3DYFA 4DHDA 4KQ5A 4KQUA 2PS6A 3KRAA 3NRIA 3WCFA 2E92A 3VJBA 3KRAB 5JV0F 3SDRA 4UMJA 4KFAA 1WY0A 3PYBA 2OPNA 4RNQA 3NF2A 4ZQ8A 1WL0A 5DZ2A 1YYTA 3ACYA 5HN9A 1VG7A 2Q9YA 4LFGA 1FPSA 4NFJF 5IN8A 3KRFA 5IK9A 3BNXA 3EFQA 3WCCA 3KRFB 3VJDA 2E90A 3SDTA 2J5CA 2ZEUA 3ZMBA 4PVXF 4PVYF 3WCAA 5B0IA 3N5HF 3ASXA 3WEFA 5HN7A 3QKCA 4NKFA 3W7FA 1WL1A 3N0GA 3PH7A 2Z4ZA 3BNYA 3VJ8A 1N20A 3G4FA 3WSAA 2E91A 3NPKA 5CG5A 4LTVA 2ZEVA 4DZWA 3MAVA 1UBXA 3M01A 4NFIF 3N49F 4KVIA 2ZCRA 5AHUB 2E8VA 3WJKA 1N23A 3RYWA 3LEEA 2ONGA 5DW7A 4GP1A 4F6XA 5ILDA 4LFVF 3V1VA 4EA1A 4KWDA 1HX9A 2Z52A 3LG5A 3ZCDA 5H9DA 3WCDA 4P0VA 1N1BA 4LIXA 4KQSA 3ADZA 4FP4A 3WEIA 5IK6A 1EZFA 3WEJA 4E9ZA 4LFEA 4LZ0A 4JZBA 4OKZA 4OKMA 1VG3A 3WC9A 5IM1A 3PDEA 5EROA 3V1XA 3M0GA 3IBAA 3CKEA 5DJVF 3AQCB 4NFKF 3WEKA 3WCHA 3ACWA 4F6VA 3RBMA 3LK5A 3LGKA 5B01A 4MC0A 4LLTA 3P8LA 3KRPA 4KK2A 4LPGF 1KIYA 3KRPB 3Q2QA 4MC8A 4N9UA 4NUAA 4DXJA 3WCIA 3LMDA 4P0WA 4QXSF 3DYGA 5DHKA 2O1OA 5EATA 2Q80A 1VG4A 2E94A 2PS5A 3LLWA 3P5PA 5IL8A 4LTZA 2ZCSA 5JA0F 2E4OA 2Z4WA 2E8WA 1HXCA 4JZXA 1N21A 2FTZA 4EA0A 5DHIA 1WKZA 1V4EA 5AYPA 3TS7A 3EZ3A 3N5JF 1YJ4A 1WL3A 5HNAA 3PKOA 2Z4YA 4HD1A 5IL3A 1PS1A 2Q58A 2F8ZF 3V66A 3VJCA 4Q23A 3SDQA 1UBVA 4DI5A 2I19A 5I1UA 2F8CF 2F7MF 2J1PA 2AETA 3WCJA 1VG6A 2OGDA 4RXEA 3RYEA 4OMGA 1YHMA 3N46F 5EAUA 5ILYA 4NKEA 1RTRA 4FJQA 2DH4A 5DJPF 5DIQF 3PYAA 3ID0A 3Q30A 4MC3A 3WCGA 5ERNA 2AELA 2F89F 2AZKA 3TFVA 4JXNA 2Z4XA 3KB9A 1DI1A 5IMPA 5B02A 2Q9ZA 3WJNA 4JYXA 5IK0A 3LZ9A 5DGSF 2E8XA 3P5RA 2E8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3D A;  4P0X A;  2H8O A;  3LSN A;  2ZCQ A;  3CP6 A;  5IKH A;  3OAB A;  3ZMC A;  5JV1 F;  2Z4V A;  3LDW A;  3OAB B;  3KRO A;  5IVG A;  3KRO B;  5ILK A;  2AZJ A;  2QIS A;  2VF6 A;  2PS8 A;  3OYR A;  1N24 A;  4N1Z F;  4DWB A;  4L2X F;  3WEH A;  3LOM A;  5B03 A;  5AFX A;  2OPM A;  5KSX F;  3EGT A;  2RAH A;  1V4J A;  4LA6 A;  1VG2 A;  4OGU A;  2AZL A;  3S4J A;  4GP2 A;  2ONH A;  3KBK A;  5IKA A;  4GAX A;  3WEG A;  4KVY A;  1YYS A;  4LUU A;  3AQB B;  1YYR A;  3P8R A;  3P41 A;  4LZ3 A;  4RXC A;  2PS7 A;  2Z7I A;  2FOR A;  2PS4 A;  3TC1 A;  3N1V F;  2ZCO A;  3MZV A;  5CG6 A;  1YHL A;  5JUZ F;  5ER8 A;  3WJO A;  4XQR F;  2OA6 A;  5IMN A;  5ILH A;  4E1E A;  5E8H A;  3AQ0 A;  4XQS F;  3APZ A;  3M00 A;  4EA2 A;  3LVS A;  5B0K A;  3TFN A;  5ILJ A;  1V4I A;  3ZOU A;  3G4D A;  4LLS A;  3ACX A;  3NPR A;  2J1O A;  3VJE A;  4JVJ F;  4KPD A;  3M9U A;  5B0J A;  1HM4 A;  2F9K F;  3WCL A;  4DEM F;  4H5D F;  4E9U A;  3WCM A;  1HXG A;  1JFG A;  5A0K A;  3N3L F;  3VJA A;  1WL2 A;  5AEL A;  5JV2 F;  2Z50 A;  4GA3 A;  3WCB A;  2E95 A;  3DYH A;  5A0J A;  1UBW A;  4KVW A;  4F62 A;  3AE0 A;  1YYU A;  5ILZ A;  3SDV A;  5B0M A;  1UBY A;  3SDU A;  3WSB A;  1JFA A;  1RQI A;  5DGN F;  5A0I A;  1YYQ A;  3TFP A;  2E8U A;  1N22 A;  3B7L A;  4JXY A;  1RQJ A;  4RYP A;  3WE9 A;  4LZC A;  1V4H A;  4OMH A;  1WMW A;  1DGP A;  4LXW A;  3N45 F;  5ILI A;  3CC9 A;  3SAE A;  1N1Z A;  3OAC A;  3IPI A;  1ZW5 A;  4LPH F;  3ZL6 A;  3OAC B;  4WK5 A;  2F92 F;  4RXA A;  3KRC A;  4XQT F;  3QQV A;  4H5C F;  3RMG A;  1V4K A;  3ICZ A;  3KRC B;  5C05 A;  3N1W F;  5E8K A;  5HN8 A;  2EWG A;  4QPF A;  4KPJ A;  2Z78 A;  3N6K F;  3Q2Z A;  5EAS A;  3S9V A;  2ZY1 A;  3LJI A;  3LGZ B;  3UCA A;  4KUX A;  4LOB A;  1HXA A;  5IMI A;  3ICN A;  3Q1O A;  1KIZ A;  5ERM A;  1YHK A;  5B0L A;  4LA5 A;  1YV5 A;  1HM7 A;  2F94 F;  3ICM A;  4KKM A;  4KVD A;  2AEK A;  2P1C A;  3M02 A;  5B00 A;  3ICK A;  3N0F A;  3VJ9 A;  5E8L A;  4K10 A;  1YQ7 A;  4H5E F;  4NG6 A;  2Z7H A;  5DGM F;  2E93 A;  4DWG A;  5DJR F;  4RXD A;  3WCE A;  3DYF A;  4DHD A;  4KQ5 A;  4KQU A;  2PS6 A;  3KRA A;  3NRI A;  3WCF A;  2E92 A;  3VJB A;  3KRA B;  5JV0 F;  3SDR A;  4UMJ A;  4KFA A;  1WY0 A;  3PYB A;  2OPN A;  4RNQ A;  3NF2 A;  4ZQ8 A;  1WL0 A;  5DZ2 A;  1YYT A;  3ACY A;  5HN9 A;  1VG7 A;  2Q9Y A;  4LFG A;  1FPS A;  4NFJ F;  5IN8 A;  3KRF A;  5IK9 A;  3BNX A;  3EFQ A;  3WCC A;  3KRF B;  3VJD A;  2E90 A;  3SDT A;  2J5C A;  2ZEU A;  3ZMB A;  4PVX F;  4PVY F;  3WCA A;  5B0I A;  3N5H F;  3ASX A;  3WEF A;  5HN7 A;  3QKC A;  4NKF A;  3W7F A;  1WL1 A;  3N0G A;  3PH7 A;  2Z4Z A;  3BNY A;  3VJ8 A;  1N20 A;  3G4F A;  3WSA A;  2E91 A;  3NPK A;  5CG5 A;  4LTV A;  2ZEV A;  4DZW A;  3MAV A;  1UBX A;  3M01 A;  4NFI F;  3N49 F;  4KVI A;  2ZCR A;  5AHU B;  2E8V A;  3WJK A;  1N23 A;  3RYW A;  3LEE A;  2ONG A;  5DW7 A;  4GP1 A;  4F6X A;  5ILD A;  4LFV F;  3V1V A;  4EA1 A;  4KWD A;  1HX9 A;  2Z52 A;  3LG5 A;  3ZCD A;  5H9D A;  3WCD A;  4P0V A;  1N1B A;  4LIX A;  4KQS A;  3ADZ A;  4FP4 A;  3WEI A;  5IK6 A;  1EZF A;  3WEJ A;  4E9Z A;  4LFE A;  4LZ0 A;  4JZB A;  4OKZ A;  4OKM A;  1VG3 A;  3WC9 A;  5IM1 A;  3PDE A;  5ERO A;  3V1X A;  3M0G A;  3IBA A;  3CKE A;  5DJV F;  3AQC B;  4NFK F;  3WEK A;  3WCH A;  3ACW A;  4F6V A;  3RBM A;  3LK5 A;  3LGK A;  5B01 A;  4MC0 A;  4LLT A;  3P8L A;  3KRP A;  4KK2 A;  4LPG F;  1KIY A;  3KRP B;  3Q2Q A;  4MC8 A;  4N9U A;  4NUA A;  4DXJ A;  3WCI A;  3LMD A;  4P0W A;  4QXS F;  3DYG A;  5DHK A;  2O1O A;  5EAT A;  2Q80 A;  1VG4 A;  2E94 A;  2PS5 A;  3LLW A;  3P5P A;  5IL8 A;  4LTZ A;  2ZCS A;  5JA0 F;  2E4O A;  2Z4W A;  2E8W A;  1HXC A;  4JZX A;  1N21 A;  2FTZ A;  4EA0 A;  5DHI A;  1WKZ A;  1V4E A;  5AYP A;  3TS7 A;  3EZ3 A;  3N5J F;  1YJ4 A;  1WL3 A;  5HNA A;  3PKO A;  2Z4Y A;  4HD1 A;  5IL3 A;  1PS1 A;  2Q58 A;  2F8Z F;  3V66 A;  3VJC A;  4Q23 A;  3SDQ A;  1UBV A;  4DI5 A;  2I19 A;  5I1U A;  2F8C F;  2F7M F;  2J1P A;  2AET A;  3WCJ A;  1VG6 A;  2OGD A;  4RXE A;  3RYE A;  4OMG A;  1YHM A;  3N46 F;  5EAU A;  5ILY A;  4NKE A;  1RTR A;  4FJQ A;  2DH4 A;  5DJP F;  5DIQ F;  3PYA A;  3ID0 A;  3Q30 A;  4MC3 A;  3WCG A;  5ERN A;  2AEL A;  2F89 F;  2AZK A;  3TFV A;  4JXN A;  2Z4X A;  3KB9 A;  1DI1 A;  5IMP A;  5B02 A;  2Q9Z A;  3WJN A;  4JYX A;  5IK0 A;  3LZ9 A;  5DGS F;  2E8X A;  3P5R A;  2E8T A; 
#chains in the Genus database with same CATH topology
 3N3D A;  4P0X A;  2H8O A;  3LSN A;  2ZCQ A;  3CP6 A;  5IKH A;  3OAB A;  3ZMC A;  5JV1 F;  2Z4V A;  3LDW A;  3OAB B;  3KRO A;  5IVG A;  3KRO B;  5ILK A;  2AZJ A;  2QIS A;  2VF6 A;  2PS8 A;  3OYR A;  1N24 A;  4N1Z F;  4DWB A;  4L2X F;  3WEH A;  3LOM A;  5B03 A;  5AFX A;  2OPM A;  5KSX F;  3EGT A;  2RAH A;  1V4J A;  4LA6 A;  1VG2 A;  4OGU A;  2AZL A;  3S4J A;  4GP2 A;  2ONH A;  3KBK A;  5IKA A;  4GAX A;  3WEG A;  4KVY A;  1YYS A;  4LUU A;  3AQB B;  1YYR A;  3P8R A;  3P41 A;  4LZ3 A;  4RXC A;  2PS7 A;  2Z7I A;  2FOR A;  2PS4 A;  3TC1 A;  3N1V F;  2ZCO A;  3MZV A;  5CG6 A;  1YHL A;  5JUZ F;  5ER8 A;  3WJO A;  4XQR F;  2OA6 A;  5IMN A;  5ILH A;  4E1E A;  5E8H A;  3AQ0 A;  4XQS F;  3APZ A;  3M00 A;  4EA2 A;  3LVS A;  5B0K A;  3TFN A;  5ILJ A;  1V4I A;  3ZOU A;  3G4D A;  4LLS A;  3ACX A;  3NPR A;  2J1O A;  3VJE A;  4JVJ F;  4KPD A;  3M9U A;  5B0J A;  1HM4 A;  2F9K F;  3WCL A;  4DEM F;  4H5D F;  4E9U A;  3WCM A;  1HXG A;  1JFG A;  5A0K A;  3N3L F;  3VJA A;  1WL2 A;  5AEL A;  5JV2 F;  2Z50 A;  4GA3 A;  3WCB A;  2E95 A;  3DYH A;  5A0J A;  1UBW A;  4KVW A;  4F62 A;  3AE0 A;  1YYU A;  5ILZ A;  3SDV A;  5B0M A;  1UBY A;  3SDU A;  3WSB A;  1JFA A;  1RQI A;  5DGN F;  5A0I A;  1YYQ A;  3TFP A;  2E8U A;  1N22 A;  3B7L A;  4JXY A;  1RQJ A;  4RYP A;  3WE9 A;  4LZC A;  1V4H A;  4OMH A;  1WMW A;  1DGP A;  4LXW A;  3N45 F;  5ILI A;  3CC9 A;  3SAE A;  1N1Z A;  3OAC A;  3IPI A;  1ZW5 A;  4LPH F;  3ZL6 A;  3OAC B;  4WK5 A;  2F92 F;  4RXA A;  3KRC A;  4XQT F;  3QQV A;  4H5C F;  3RMG A;  1V4K A;  3ICZ A;  3KRC B;  5C05 A;  3N1W F;  5E8K A;  5HN8 A;  2EWG A;  4QPF A;  4KPJ A;  2Z78 A;  3N6K F;  3Q2Z A;  5EAS A;  3S9V A;  2ZY1 A;  3LJI A;  3LGZ B;  3UCA A;  4KUX A;  4LOB A;  1HXA A;  5IMI A;  3ICN A;  3Q1O A;  1KIZ A;  5ERM A;  1YHK A;  5B0L A;  4LA5 A;  1YV5 A;  1HM7 A;  2F94 F;  3ICM A;  4KKM A;  4KVD A;  2AEK A;  2P1C A;  3M02 A;  5B00 A;  3ICK A;  3N0F A;  3VJ9 A;  5E8L A;  4K10 A;  1YQ7 A;  4H5E F;  4NG6 A;  2Z7H A;  5DGM F;  2E93 A;  4DWG A;  5DJR F;  4RXD A;  3WCE A;  3DYF A;  4DHD A;  4KQ5 A;  4KQU A;  2PS6 A;  3KRA A;  3NRI A;  3WCF A;  2E92 A;  3VJB A;  3KRA B;  5JV0 F;  3SDR A;  4UMJ A;  4KFA A;  1WY0 A;  3PYB A;  2OPN A;  4RNQ A;  3NF2 A;  4ZQ8 A;  1WL0 A;  5DZ2 A;  1YYT A;  3ACY A;  5HN9 A;  1VG7 A;  2Q9Y A;  4LFG A;  1FPS A;  4NFJ F;  5IN8 A;  3KRF A;  5IK9 A;  3BNX A;  3EFQ A;  3WCC A;  3KRF B;  3VJD A;  2E90 A;  3SDT A;  2J5C A;  2ZEU A;  3ZMB A;  4PVX F;  4PVY F;  3WCA A;  5B0I A;  3N5H F;  3ASX A;  3WEF A;  5HN7 A;  3QKC A;  4NKF A;  3W7F A;  1WL1 A;  3N0G A;  3PH7 A;  2Z4Z A;  3BNY A;  3VJ8 A;  1N20 A;  3G4F A;  3WSA A;  2E91 A;  3NPK A;  5CG5 A;  4LTV A;  2ZEV A;  4DZW A;  3MAV A;  1UBX A;  3M01 A;  4NFI F;  3N49 F;  4KVI A;  2ZCR A;  5AHU B;  2E8V A;  3WJK A;  1N23 A;  3RYW A;  3LEE A;  2ONG A;  5DW7 A;  4GP1 A;  4F6X A;  5ILD A;  4LFV F;  3V1V A;  4EA1 A;  4KWD A;  1HX9 A;  2Z52 A;  3LG5 A;  3ZCD A;  5H9D A;  3WCD A;  4P0V A;  1N1B A;  4LIX A;  4KQS A;  3ADZ A;  4FP4 A;  3WEI A;  5IK6 A;  1EZF A;  3WEJ A;  4E9Z A;  4LFE A;  4LZ0 A;  4JZB A;  4OKZ A;  4OKM A;  1VG3 A;  3WC9 A;  5IM1 A;  3PDE A;  5ERO A;  3V1X A;  3M0G A;  3IBA A;  3CKE A;  5DJV F;  3AQC B;  4NFK F;  3WEK A;  3WCH A;  3ACW A;  4F6V A;  3RBM A;  3LK5 A;  3LGK A;  5B01 A;  4MC0 A;  4LLT A;  3P8L A;  3KRP A;  4KK2 A;  4LPG F;  1KIY A;  3KRP B;  3Q2Q A;  4MC8 A;  4N9U A;  4NUA A;  4DXJ A;  3WCI A;  3LMD A;  4P0W A;  4QXS F;  3DYG A;  5DHK A;  2O1O A;  5EAT A;  2Q80 A;  1VG4 A;  2E94 A;  2PS5 A;  3LLW A;  3P5P A;  5IL8 A;  4LTZ A;  2ZCS A;  5JA0 F;  2E4O A;  2Z4W A;  2E8W A;  1HXC A;  4JZX A;  1N21 A;  2FTZ A;  4EA0 A;  5DHI A;  1WKZ A;  1V4E A;  5AYP A;  3TS7 A;  3EZ3 A;  3N5J F;  1YJ4 A;  1WL3 A;  5HNA A;  3PKO A;  2Z4Y A;  4HD1 A;  5IL3 A;  1PS1 A;  2Q58 A;  2F8Z F;  3V66 A;  3VJC A;  4Q23 A;  3SDQ A;  1UBV A;  4DI5 A;  2I19 A;  5I1U A;  2F8C F;  2F7M F;  2J1P A;  2AET A;  3WCJ A;  1VG6 A;  2OGD A;  4RXE A;  3RYE A;  4OMG A;  1YHM A;  3N46 F;  5EAU A;  5ILY A;  4NKE A;  1RTR A;  4FJQ A;  2DH4 A;  5DJP F;  5DIQ F;  3PYA A;  3ID0 A;  3Q30 A;  4MC3 A;  3WCG A;  5ERN A;  2AEL A;  2F89 F;  2AZK A;  3TFV A;  4JXN A;  2Z4X A;  3KB9 A;  1DI1 A;  5IMP A;  5B02 A;  2Q9Z A;  3WJN A;  4JYX A;  5IK0 A;  3LZ9 A;  5DGS F;  2E8X A;  3P5R A;  2E8T A; 
#chains in the Genus database with same CATH homology
 3N3D A;  4P0X A;  2H8O A;  3LSN A;  2ZCQ A;  3CP6 A;  5IKH A;  3OAB A;  3ZMC A;  5JV1 F;  2Z4V A;  3LDW A;  3OAB B;  3KRO A;  5IVG A;  3KRO B;  5ILK A;  2AZJ A;  2QIS A;  2VF6 A;  2PS8 A;  3OYR A;  1N24 A;  4N1Z F;  4DWB A;  4L2X F;  3WEH A;  3LOM A;  5B03 A;  5AFX A;  2OPM A;  5KSX F;  3EGT A;  2RAH A;  1V4J A;  4LA6 A;  1VG2 A;  4OGU A;  2AZL A;  3S4J A;  4GP2 A;  2ONH A;  3KBK A;  5IKA A;  4GAX A;  3WEG A;  4KVY A;  1YYS A;  4LUU A;  3AQB B;  1YYR A;  3P8R A;  3P41 A;  4LZ3 A;  4RXC A;  2PS7 A;  2Z7I A;  2FOR A;  2PS4 A;  3TC1 A;  3N1V F;  2ZCO A;  3MZV A;  5CG6 A;  1YHL A;  5JUZ F;  5ER8 A;  3WJO A;  4XQR F;  2OA6 A;  5IMN A;  5ILH A;  4E1E A;  5E8H A;  3AQ0 A;  4XQS F;  3APZ A;  3M00 A;  4EA2 A;  3LVS A;  5B0K A;  3TFN A;  5ILJ A;  1V4I A;  3ZOU A;  3G4D A;  4LLS A;  3ACX A;  3NPR A;  2J1O A;  3VJE A;  4JVJ F;  4KPD A;  3M9U A;  5B0J A;  1HM4 A;  2F9K F;  3WCL A;  4DEM F;  4H5D F;  4E9U A;  3WCM A;  1HXG A;  1JFG A;  5A0K A;  3N3L F;  3VJA A;  1WL2 A;  5AEL A;  5JV2 F;  2Z50 A;  4GA3 A;  3WCB A;  2E95 A;  3DYH A;  5A0J A;  1UBW A;  4KVW A;  4F62 A;  3AE0 A;  1YYU A;  5ILZ A;  3SDV A;  5B0M A;  1UBY A;  3SDU A;  3WSB A;  1JFA A;  1RQI A;  5DGN F;  5A0I A;  1YYQ A;  3TFP A;  2E8U A;  1N22 A;  3B7L A;  4JXY A;  1RQJ A;  4RYP A;  3WE9 A;  4LZC A;  1V4H A;  4OMH A;  1WMW A;  1DGP A;  4LXW A;  3N45 F;  5ILI A;  3CC9 A;  3SAE A;  1N1Z A;  3OAC A;  3IPI A;  1ZW5 A;  4LPH F;  3ZL6 A;  3OAC B;  4WK5 A;  2F92 F;  4RXA A;  3KRC A;  4XQT F;  3QQV A;  4H5C F;  3RMG A;  1V4K A;  3ICZ A;  3KRC B;  5C05 A;  3N1W F;  5E8K A;  5HN8 A;  2EWG A;  4QPF A;  4KPJ A;  2Z78 A;  3N6K F;  3Q2Z A;  5EAS A;  3S9V A;  2ZY1 A;  3LJI A;  3LGZ B;  3UCA A;  4KUX A;  4LOB A;  1HXA A;  5IMI A;  3ICN A;  3Q1O A;  1KIZ A;  5ERM A;  1YHK A;  5B0L A;  4LA5 A;  1YV5 A;  1HM7 A;  2F94 F;  3ICM A;  4KKM A;  4KVD A;  2AEK A;  2P1C A;  3M02 A;  5B00 A;  3ICK A;  3N0F A;  3VJ9 A;  5E8L A;  4K10 A;  1YQ7 A;  4H5E F;  4NG6 A;  2Z7H A;  5DGM F;  2E93 A;  4DWG A;  5DJR F;  4RXD A;  3WCE A;  3DYF A;  4DHD A;  4KQ5 A;  4KQU A;  2PS6 A;  3KRA A;  3NRI A;  3WCF A;  2E92 A;  3VJB A;  3KRA B;  5JV0 F;  3SDR A;  4UMJ A;  4KFA A;  1WY0 A;  3PYB A;  2OPN A;  4RNQ A;  3NF2 A;  4ZQ8 A;  1WL0 A;  5DZ2 A;  1YYT A;  3ACY A;  5HN9 A;  1VG7 A;  2Q9Y A;  4LFG A;  1FPS A;  4NFJ F;  5IN8 A;  3KRF A;  5IK9 A;  3BNX A;  3EFQ A;  3WCC A;  3KRF B;  3VJD A;  2E90 A;  3SDT A;  2J5C A;  2ZEU A;  3ZMB A;  4PVX F;  4PVY F;  3WCA A;  5B0I A;  3N5H F;  3ASX A;  3WEF A;  5HN7 A;  3QKC A;  4NKF A;  3W7F A;  1WL1 A;  3N0G A;  3PH7 A;  2Z4Z A;  3BNY A;  3VJ8 A;  1N20 A;  3G4F A;  3WSA A;  2E91 A;  3NPK A;  5CG5 A;  4LTV A;  2ZEV A;  4DZW A;  3MAV A;  1UBX A;  3M01 A;  4NFI F;  3N49 F;  4KVI A;  2ZCR A;  5AHU B;  2E8V A;  3WJK A;  1N23 A;  3RYW A;  3LEE A;  2ONG A;  5DW7 A;  4GP1 A;  4F6X A;  5ILD A;  4LFV F;  3V1V A;  4EA1 A;  4KWD A;  1HX9 A;  2Z52 A;  3LG5 A;  3ZCD A;  5H9D A;  3WCD A;  4P0V A;  1N1B A;  4LIX A;  4KQS A;  3ADZ A;  4FP4 A;  3WEI A;  5IK6 A;  1EZF A;  3WEJ A;  4E9Z A;  4LFE A;  4LZ0 A;  4JZB A;  4OKZ A;  4OKM A;  1VG3 A;  3WC9 A;  5IM1 A;  3PDE A;  5ERO A;  3V1X A;  3M0G A;  3IBA A;  3CKE A;  5DJV F;  3AQC B;  4NFK F;  3WEK A;  3WCH A;  3ACW A;  4F6V A;  3RBM A;  3LK5 A;  3LGK A;  5B01 A;  4MC0 A;  4LLT A;  3P8L A;  3KRP A;  4KK2 A;  4LPG F;  1KIY A;  3KRP B;  3Q2Q A;  4MC8 A;  4N9U A;  4NUA A;  4DXJ A;  3WCI A;  3LMD A;  4P0W A;  4QXS F;  3DYG A;  5DHK A;  2O1O A;  5EAT A;  2Q80 A;  1VG4 A;  2E94 A;  2PS5 A;  3LLW A;  3P5P A;  5IL8 A;  4LTZ A;  2ZCS A;  5JA0 F;  2E4O A;  2Z4W A;  2E8W A;  1HXC A;  4JZX A;  1N21 A;  2FTZ A;  4EA0 A;  5DHI A;  1WKZ A;  1V4E A;  5AYP A;  3TS7 A;  3EZ3 A;  3N5J F;  1YJ4 A;  1WL3 A;  5HNA A;  3PKO A;  2Z4Y A;  4HD1 A;  5IL3 A;  1PS1 A;  2Q58 A;  2F8Z F;  3V66 A;  3VJC A;  4Q23 A;  3SDQ A;  1UBV A;  4DI5 A;  2I19 A;  5I1U A;  2F8C F;  2F7M F;  2J1P A;  2AET A;  3WCJ A;  1VG6 A;  2OGD A;  4RXE A;  3RYE A;  4OMG A;  1YHM A;  3N46 F;  5EAU A;  5ILY A;  4NKE A;  1RTR A;  4FJQ A;  2DH4 A;  5DJP F;  5DIQ F;  3PYA A;  3ID0 A;  3Q30 A;  4MC3 A;  3WCG A;  5ERN A;  2AEL A;  2F89 F;  2AZK A;  3TFV A;  4JXN A;  2Z4X A;  3KB9 A;  1DI1 A;  5IMP A;  5B02 A;  2Q9Z A;  3WJN A;  4JYX A;  5IK0 A;  3LZ9 A;  5DGS F;  2E8X A;  3P5R A;  2E8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...