5IMNA

Crystal structure of n299a/s303a aspergillus terreus aristolochene synthase complexed with (1s,8s,9ar)-1,9a-dimethyl-8-(prop-1-en-2-yl)decahydroquinolizin-5-ium
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
304
structure length
304
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGAELWAQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Aristolochene synthase
publication title Probing the Role of Active Site Water in the Sesquiterpene Cyclization Reaction Catalyzed by Aristolochene Synthase.
pubmed doi rcsb
source organism Aspergillus terreus
total genus 125
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5imnA00
3N5JF 4F6VA 4ZQ8A 4NUAA 3OYRA 3WEGA 5A0JA 3V66A 1HX9A 5B0IA 3LK5A 3WCDA 5DHIA 1JFAA 5AELA 4GP1A 1N23A 2Z4YA 3M0GA 3ACWA 2E8XA 4DI5A 2RAHA 4JXNA 4EA0A 3WSBA 3TFVA 4GP2A 3P5RA 3KB9A 2F7MF 1JFGA 4RXEA 3WCHA 3LMDA 5H9DA 4KVWA 5HN7A 5IM1A 5E8LA 2PS7A 3V1XA 5HN9A 5DGNF 1VG4A 1WL2A 4Q23A 4KQSA 4DHDA 4LFEA 5DW7A 3IPIA 5IMIA 4KVIA 1YYRA 3VJEA 4LFVF 1YHKA 5IMPA 2F8ZF 2ZY1A 5C05A 3LGKA 1UBWA 3M00A 2E8WA 5IL8A 4N1ZF 2QISA 2AELA 3N49F 2Z7IA 5CG5A 4KVYA 4XQSF 3ZOUA 1YHMA 4P0WA 1UBVA 3LGZB 3ID0A 2F9KF 3WCLA 1RTRA 4NFIF 2E93A 2AZLA 3G4FA 3NF2A 3VJ9A 4KVDA 1UBYA 5ILKA 5E8HA 3LVSA 3LZ9A 5JV2F 4E9UA 4RNQA 2AETA 4MC8A 4NG6A 2DH4A 2E91A 4DWGA 3AQ0A 4H5EF 2FTZA 1HM4A 3VJDA 2Z4WA 5B01A 3ZMBA 1N20A 3RYWA 4QPFA 4LPHF 1N1BA 4KKMA 3WJKA 2P1CA 3ZMCA 5ILJA 3EGTA 3DYGA 4NKFA 3P8RA 4P0VA 2Z52A 4LA6A 5E8KA 5B0KA 5IKAA 4EA1A 4KPDA 2Z78A 4PVYF 1YV5A 1WY0A 2E94A 5IN8A 3S9VA 1V4KA 4H5CF 5B02A 4KPJA 4K10A 2O1OA 3MZVA 3TFNA 4QXSF 3WCFA 3N46F 4FP4A 3KRFA 5EASA 2E90A 5DJVF 4OMHA 4KUXA 3W7FA 3EZ3A 3P8LA 2AEKA 4NFKF 1HXAA 4H5DF 5I1UA 3CP6A 4KFAA 1YYUA 5HNAA 3CKEA 3WCGA 1WMWA 3WEKA 5IK6A 5DZ2A 4LTVA 5A0KA 1PS1A 1N22A 4LLSA 3N45F 3N3DA 3Q2ZA 2ZEVA 2OA6A 5ILIA 3LLWA 3P5PA 4EA2A 3RMGA 5CG6A 5EAUA 3KRFB 3N0FA 4JYXA 2ZEUA 3DYFA 3DYHA 4E9ZA 4NFJF 3WCBA 5JV1F 2OPNA 4LXWA 4LIXA 4P0XA 3NPKA 5IL3A 2F89F 4DZWA 3S4JA 3TS7A 3WC9A 1WL1A 3N1VF 5B00A 4KK2A 2AZJA 5ILZA 2E92A 3M01A 3B7LA 3V1VA 4LZCA 2Z4ZA 4XQRF 3N5HF 4NKEA 3BNXA 3LJIA 3N0GA 5ERMA 4DWBA 2ZCOA 2ZCRA 3WJNA 5HN8A 1YHLA 1FPSA 3WEIA 2Z4XA 4E1EA 2J1PA 1N24A 2J5CA 3LG5A 3ICKA 3G4DA 3OABA 5DGSF 3PYAA 1VG6A 3PH7A 2H8OA 3WCEA 5ILYA 2OPMA 3VJCA 3ICMA 2E4OA 3UCAA 1V4HA 4LZ0A 4LUUA 5DGMF 3VJAA 3EFQA 3KRAA 4JVJF 4L2XF 4LFGA 4HD1A 2Z50A 4JZXA 2E8TA 1VG3A 5IK0A 3ACYA 3SAEA 1N21A 1V4JA 5ERNA 1DI1A 4XQTF 1HXCA 4RXDA 3OABB 3LSNA 3KRCA 3AQBB 3SDTA 1YYQA 2ZCQA 4DEMF 4OMGA 1RQJA 3KRAB 2ZCSA 3ADZA 1YYSA 1KIZA 2I19A 2ONGA 2E8VA 2F94F 4LA5A 5A0IA 5DJPF 1HXGA 3OACA 2Z7HA 3RYEA 3WEHA 1WKZA 2E95A 2PS4A 5EROA 3QKCA 3ICZA 3KRCB 3IBAA 4F6XA 5AFXA 3M9UA 5AHUB 3WCAA 5IK9A 3ASXA 2AZKA 3WEJA 1UBXA 5JUZF 3WCMA 1V4EA 1DGPA 3CC9A 2Q58A 3SDUA 4KQ5A 3N1WF 3AQCB 2J1OA 5AYPA 2ONHA 1VG7A 3OACB 3P41A 3APZA 3SDRA 2Z4VA 3LOMA 4F62A 3KRPA 4JXYA 3LEEA 1VG2A 3WJOA 4LLTA 1ZW5A 5KSXF 3Q1OA 4DXJA 4GA3A 2VF6A 3WCIA 4UMJA 3PKOA 4PVXF 5ILDA 3ZL6A 1WL3A 4OKZA 3N3LF 3WCCA 3NRIA 2PS5A 4RXAA 5IKHA 2F92F 1KIYA 1YJ4A 5ILHA 3RBMA 3AE0A 3VJBA 4N9UA 3KRPB 4MC0A 3WSAA 3KROA 4LPGF 5B03A 3TC1A 4WK5A 2PS8A 3KBKA 5JV0F 5JA0F 5B0MA 3BNYA 4RXCA 3N6KF 3Q30A 4GAXA 5B0JA 1WL0A 4OKMA 3ZCDA 4LZ3A 1YQ7A 4MC3A 2Q9YA 1N1ZA 3ACXA 3QQVA 1V4IA 3WE9A 4RYPA 3NPRA 4LOBA 3KROB 3SDQA 2FORA 4OGUA 4LTZA 5DJRF 3M02A 3VJ8A 3LDWA 1EZFA 5B0LA 3ICNA 2PS6A 3WEFA 5EATA 4JZBA 4FJQA 2E8UA 2F8CF 3WCJA 4KQUA 5DHKA 4KWDA 2Q9ZA 5IVGA 5DIQF 1HM7A 1YYTA 3MAVA 1RQIA 2EWGA 3PYBA 2OGDA 2Q80A 3SDVA 5ER8A 5IMNA 3TFPA 3PDEA 3Q2QA
chains in the Genus database with same CATH superfamily
3N5JF 4F6VA 4ZQ8A 4NUAA 3OYRA 3WEGA 5A0JA 3V66A 1HX9A 5B0IA 3LK5A 3WCDA 5DHIA 1JFAA 5AELA 4GP1A 1N23A 2Z4YA 3M0GA 3ACWA 2E8XA 4DI5A 2RAHA 4JXNA 4EA0A 3WSBA 3TFVA 4GP2A 3P5RA 3KB9A 2F7MF 1JFGA 4RXEA 3WCHA 3LMDA 5H9DA 4KVWA 5HN7A 5IM1A 5E8LA 2PS7A 3V1XA 5HN9A 5DGNF 1VG4A 1WL2A 4Q23A 4KQSA 4DHDA 4LFEA 5DW7A 3IPIA 5IMIA 4KVIA 1YYRA 3VJEA 4LFVF 1YHKA 5IMPA 2F8ZF 2ZY1A 5C05A 3LGKA 1UBWA 3M00A 2E8WA 5IL8A 4N1ZF 2QISA 2AELA 3N49F 2Z7IA 5CG5A 4KVYA 4XQSF 3ZOUA 1YHMA 4P0WA 1UBVA 3LGZB 3ID0A 2F9KF 3WCLA 1RTRA 4NFIF 2E93A 2AZLA 3G4FA 3NF2A 3VJ9A 4KVDA 1UBYA 5ILKA 5E8HA 3LVSA 3LZ9A 5JV2F 4E9UA 4RNQA 2AETA 4MC8A 4NG6A 2DH4A 2E91A 4DWGA 3AQ0A 4H5EF 2FTZA 1HM4A 3VJDA 2Z4WA 5B01A 3ZMBA 1N20A 3RYWA 4QPFA 4LPHF 1N1BA 4KKMA 3WJKA 2P1CA 3ZMCA 5ILJA 3EGTA 3DYGA 4NKFA 3P8RA 4P0VA 2Z52A 4LA6A 5E8KA 5B0KA 5IKAA 4EA1A 4KPDA 2Z78A 4PVYF 1YV5A 1WY0A 2E94A 5IN8A 3S9VA 1V4KA 4H5CF 5B02A 4KPJA 4K10A 2O1OA 3MZVA 3TFNA 4QXSF 3WCFA 3N46F 4FP4A 3KRFA 5EASA 2E90A 5DJVF 4OMHA 4KUXA 3W7FA 3EZ3A 3P8LA 2AEKA 4NFKF 1HXAA 4H5DF 5I1UA 3CP6A 4KFAA 1YYUA 5HNAA 3CKEA 3WCGA 1WMWA 3WEKA 5IK6A 5DZ2A 4LTVA 5A0KA 1PS1A 1N22A 4LLSA 3N45F 3N3DA 3Q2ZA 2ZEVA 2OA6A 5ILIA 3LLWA 3P5PA 4EA2A 3RMGA 5CG6A 5EAUA 3KRFB 3N0FA 4JYXA 2ZEUA 3DYFA 3DYHA 4E9ZA 4NFJF 3WCBA 5JV1F 2OPNA 4LXWA 4LIXA 4P0XA 3NPKA 5IL3A 2F89F 4DZWA 3S4JA 3TS7A 3WC9A 1WL1A 3N1VF 5B00A 4KK2A 2AZJA 5ILZA 2E92A 3M01A 3B7LA 3V1VA 4LZCA 2Z4ZA 4XQRF 3N5HF 4NKEA 3BNXA 3LJIA 3N0GA 5ERMA 4DWBA 2ZCOA 2ZCRA 3WJNA 5HN8A 1YHLA 1FPSA 3WEIA 2Z4XA 4E1EA 2J1PA 1N24A 2J5CA 3LG5A 3ICKA 3G4DA 3OABA 5DGSF 3PYAA 1VG6A 3PH7A 2H8OA 3WCEA 5ILYA 2OPMA 3VJCA 3ICMA 2E4OA 3UCAA 1V4HA 4LZ0A 4LUUA 5DGMF 3VJAA 3EFQA 3KRAA 4JVJF 4L2XF 4LFGA 4HD1A 2Z50A 4JZXA 2E8TA 1VG3A 5IK0A 3ACYA 3SAEA 1N21A 1V4JA 5ERNA 1DI1A 4XQTF 1HXCA 4RXDA 3OABB 3LSNA 3KRCA 3AQBB 3SDTA 1YYQA 2ZCQA 4DEMF 4OMGA 1RQJA 3KRAB 2ZCSA 3ADZA 1YYSA 1KIZA 2I19A 2ONGA 2E8VA 2F94F 4LA5A 5A0IA 5DJPF 1HXGA 3OACA 2Z7HA 3RYEA 3WEHA 1WKZA 2E95A 2PS4A 5EROA 3QKCA 3ICZA 3KRCB 3IBAA 4F6XA 5AFXA 3M9UA 5AHUB 3WCAA 5IK9A 3ASXA 2AZKA 3WEJA 1UBXA 5JUZF 3WCMA 1V4EA 1DGPA 3CC9A 2Q58A 3SDUA 4KQ5A 3N1WF 3AQCB 2J1OA 5AYPA 2ONHA 1VG7A 3OACB 3P41A 3APZA 3SDRA 2Z4VA 3LOMA 4F62A 3KRPA 4JXYA 3LEEA 1VG2A 3WJOA 4LLTA 1ZW5A 5KSXF 3Q1OA 4DXJA 4GA3A 2VF6A 3WCIA 4UMJA 3PKOA 4PVXF 5ILDA 3ZL6A 1WL3A 4OKZA 3N3LF 3WCCA 3NRIA 2PS5A 4RXAA 5IKHA 2F92F 1KIYA 1YJ4A 5ILHA 3RBMA 3AE0A 3VJBA 4N9UA 3KRPB 4MC0A 3WSAA 3KROA 4LPGF 5B03A 3TC1A 4WK5A 2PS8A 3KBKA 5JV0F 5JA0F 5B0MA 3BNYA 4RXCA 3N6KF 3Q30A 4GAXA 5B0JA 1WL0A 4OKMA 3ZCDA 4LZ3A 1YQ7A 4MC3A 2Q9YA 1N1ZA 3ACXA 3QQVA 1V4IA 3WE9A 4RYPA 3NPRA 4LOBA 3KROB 3SDQA 2FORA 4OGUA 4LTZA 5DJRF 3M02A 3VJ8A 3LDWA 1EZFA 5B0LA 3ICNA 2PS6A 3WEFA 5EATA 4JZBA 4FJQA 2E8UA 2F8CF 3WCJA 4KQUA 5DHKA 4KWDA 2Q9ZA 5IVGA 5DIQF 1HM7A 1YYTA 3MAVA 1RQIA 2EWGA 3PYBA 2OGDA 2Q80A 3SDVA 5ER8A 5IMNA 3TFPA 3PDEA 3Q2QA
chains in the Genus database with same CATH topology
3N5JF 4F6VA 4ZQ8A 4NUAA 3OYRA 3WEGA 5A0JA 3V66A 1HX9A 5B0IA 3LK5A 3WCDA 5DHIA 1JFAA 5AELA 4GP1A 1N23A 2Z4YA 3M0GA 3ACWA 2E8XA 4DI5A 2RAHA 4JXNA 4EA0A 3WSBA 3TFVA 4GP2A 3P5RA 3KB9A 2F7MF 1JFGA 4RXEA 3WCHA 3LMDA 5H9DA 4KVWA 5HN7A 5IM1A 5E8LA 2PS7A 3V1XA 5HN9A 5DGNF 1VG4A 1WL2A 4Q23A 4KQSA 4DHDA 4LFEA 5DW7A 3IPIA 5IMIA 4KVIA 1YYRA 3VJEA 4LFVF 1YHKA 5IMPA 2F8ZF 2ZY1A 5C05A 3LGKA 1UBWA 3M00A 2E8WA 5IL8A 4N1ZF 2QISA 2AELA 3N49F 2Z7IA 5CG5A 4KVYA 4XQSF 3ZOUA 1YHMA 4P0WA 1UBVA 3LGZB 3ID0A 2F9KF 3WCLA 1RTRA 4NFIF 2E93A 2AZLA 3G4FA 3NF2A 3VJ9A 4KVDA 1UBYA 5ILKA 5E8HA 3LVSA 3LZ9A 5JV2F 4E9UA 4RNQA 2AETA 4MC8A 4NG6A 2DH4A 2E91A 4DWGA 3AQ0A 4H5EF 2FTZA 1HM4A 3VJDA 2Z4WA 5B01A 3ZMBA 1N20A 3RYWA 4QPFA 4LPHF 1N1BA 4KKMA 3WJKA 2P1CA 3ZMCA 5ILJA 3EGTA 3DYGA 4NKFA 3P8RA 4P0VA 2Z52A 4LA6A 5E8KA 5B0KA 5IKAA 4EA1A 4KPDA 2Z78A 4PVYF 1YV5A 1WY0A 2E94A 5IN8A 3S9VA 1V4KA 4H5CF 5B02A 4KPJA 4K10A 2O1OA 3MZVA 3TFNA 4QXSF 3WCFA 3N46F 4FP4A 3KRFA 5EASA 2E90A 5DJVF 4OMHA 4KUXA 3W7FA 3EZ3A 3P8LA 2AEKA 4NFKF 1HXAA 4H5DF 5I1UA 3CP6A 4KFAA 1YYUA 5HNAA 3CKEA 3WCGA 1WMWA 3WEKA 5IK6A 5DZ2A 4LTVA 5A0KA 1PS1A 1N22A 4LLSA 3N45F 3N3DA 3Q2ZA 2ZEVA 2OA6A 5ILIA 3LLWA 3P5PA 4EA2A 3RMGA 5CG6A 5EAUA 3KRFB 3N0FA 4JYXA 2ZEUA 3DYFA 3DYHA 4E9ZA 4NFJF 3WCBA 5JV1F 2OPNA 4LXWA 4LIXA 4P0XA 3NPKA 5IL3A 2F89F 4DZWA 3S4JA 3TS7A 3WC9A 1WL1A 3N1VF 5B00A 4KK2A 2AZJA 5ILZA 2E92A 3M01A 3B7LA 3V1VA 4LZCA 2Z4ZA 4XQRF 3N5HF 4NKEA 3BNXA 3LJIA 3N0GA 5ERMA 4DWBA 2ZCOA 2ZCRA 3WJNA 5HN8A 1YHLA 1FPSA 3WEIA 2Z4XA 4E1EA 2J1PA 1N24A 2J5CA 3LG5A 3ICKA 3G4DA 3OABA 5DGSF 3PYAA 1VG6A 3PH7A 2H8OA 3WCEA 5ILYA 2OPMA 3VJCA 3ICMA 2E4OA 3UCAA 1V4HA 4LZ0A 4LUUA 5DGMF 3VJAA 3EFQA 3KRAA 4JVJF 4L2XF 4LFGA 4HD1A 2Z50A 4JZXA 2E8TA 1VG3A 5IK0A 3ACYA 3SAEA 1N21A 1V4JA 5ERNA 1DI1A 4XQTF 1HXCA 4RXDA 3OABB 3LSNA 3KRCA 3AQBB 3SDTA 1YYQA 2ZCQA 4DEMF 4OMGA 1RQJA 3KRAB 2ZCSA 3ADZA 1YYSA 1KIZA 2I19A 2ONGA 2E8VA 2F94F 4LA5A 5A0IA 5DJPF 1HXGA 3OACA 2Z7HA 3RYEA 3WEHA 1WKZA 2E95A 2PS4A 5EROA 3QKCA 3ICZA 3KRCB 3IBAA 4F6XA 5AFXA 3M9UA 5AHUB 3WCAA 5IK9A 3ASXA 2AZKA 3WEJA 1UBXA 5JUZF 3WCMA 1V4EA 1DGPA 3CC9A 2Q58A 3SDUA 4KQ5A 3N1WF 3AQCB 2J1OA 5AYPA 2ONHA 1VG7A 3OACB 3P41A 3APZA 3SDRA 2Z4VA 3LOMA 4F62A 3KRPA 4JXYA 3LEEA 1VG2A 3WJOA 4LLTA 1ZW5A 5KSXF 3Q1OA 4DXJA 4GA3A 2VF6A 3WCIA 4UMJA 3PKOA 4PVXF 5ILDA 3ZL6A 1WL3A 4OKZA 3N3LF 3WCCA 3NRIA 2PS5A 4RXAA 5IKHA 2F92F 1KIYA 1YJ4A 5ILHA 3RBMA 3AE0A 3VJBA 4N9UA 3KRPB 4MC0A 3WSAA 3KROA 4LPGF 5B03A 3TC1A 4WK5A 2PS8A 3KBKA 5JV0F 5JA0F 5B0MA 3BNYA 4RXCA 3N6KF 3Q30A 4GAXA 5B0JA 1WL0A 4OKMA 3ZCDA 4LZ3A 1YQ7A 4MC3A 2Q9YA 1N1ZA 3ACXA 3QQVA 1V4IA 3WE9A 4RYPA 3NPRA 4LOBA 3KROB 3SDQA 2FORA 4OGUA 4LTZA 5DJRF 3M02A 3VJ8A 3LDWA 1EZFA 5B0LA 3ICNA 2PS6A 3WEFA 5EATA 4JZBA 4FJQA 2E8UA 2F8CF 3WCJA 4KQUA 5DHKA 4KWDA 2Q9ZA 5IVGA 5DIQF 1HM7A 1YYTA 3MAVA 1RQIA 2EWGA 3PYBA 2OGDA 2Q80A 3SDVA 5ER8A 5IMNA 3TFPA 3PDEA 3Q2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5J F;  4F6V A;  4ZQ8 A;  4NUA A;  3OYR A;  3WEG A;  5A0J A;  3V66 A;  1HX9 A;  5B0I A;  3LK5 A;  3WCD A;  5DHI A;  1JFA A;  5AEL A;  4GP1 A;  1N23 A;  2Z4Y A;  3M0G A;  3ACW A;  2E8X A;  4DI5 A;  2RAH A;  4JXN A;  4EA0 A;  3WSB A;  3TFV A;  4GP2 A;  3P5R A;  3KB9 A;  2F7M F;  1JFG A;  4RXE A;  3WCH A;  3LMD A;  5H9D A;  4KVW A;  5HN7 A;  5IM1 A;  5E8L A;  2PS7 A;  3V1X A;  5HN9 A;  5DGN F;  1VG4 A;  1WL2 A;  4Q23 A;  4KQS A;  4DHD A;  4LFE A;  5DW7 A;  3IPI A;  5IMI A;  4KVI A;  1YYR A;  3VJE A;  4LFV F;  1YHK A;  5IMP A;  2F8Z F;  2ZY1 A;  5C05 A;  3LGK A;  1UBW A;  3M00 A;  2E8W A;  5IL8 A;  4N1Z F;  2QIS A;  2AEL A;  3N49 F;  2Z7I A;  5CG5 A;  4KVY A;  4XQS F;  3ZOU A;  1YHM A;  4P0W A;  1UBV A;  3LGZ B;  3ID0 A;  2F9K F;  3WCL A;  1RTR A;  4NFI F;  2E93 A;  2AZL A;  3G4F A;  3NF2 A;  3VJ9 A;  4KVD A;  1UBY A;  5ILK A;  5E8H A;  3LVS A;  3LZ9 A;  5JV2 F;  4E9U A;  4RNQ A;  2AET A;  4MC8 A;  4NG6 A;  2DH4 A;  2E91 A;  4DWG A;  3AQ0 A;  4H5E F;  2FTZ A;  1HM4 A;  3VJD A;  2Z4W A;  5B01 A;  3ZMB A;  1N20 A;  3RYW A;  4QPF A;  4LPH F;  1N1B A;  4KKM A;  3WJK A;  2P1C A;  3ZMC A;  5ILJ A;  3EGT A;  3DYG A;  4NKF A;  3P8R A;  4P0V A;  2Z52 A;  4LA6 A;  5E8K A;  5B0K A;  5IKA A;  4EA1 A;  4KPD A;  2Z78 A;  4PVY F;  1YV5 A;  1WY0 A;  2E94 A;  5IN8 A;  3S9V A;  1V4K A;  4H5C F;  5B02 A;  4KPJ A;  4K10 A;  2O1O A;  3MZV A;  3TFN A;  4QXS F;  3WCF A;  3N46 F;  4FP4 A;  3KRF A;  5EAS A;  2E90 A;  5DJV F;  4OMH A;  4KUX A;  3W7F A;  3EZ3 A;  3P8L A;  2AEK A;  4NFK F;  1HXA A;  4H5D F;  5I1U A;  3CP6 A;  4KFA A;  1YYU A;  5HNA A;  3CKE A;  3WCG A;  1WMW A;  3WEK A;  5IK6 A;  5DZ2 A;  4LTV A;  5A0K A;  1PS1 A;  1N22 A;  4LLS A;  3N45 F;  3N3D A;  3Q2Z A;  2ZEV A;  2OA6 A;  5ILI A;  3LLW A;  3P5P A;  4EA2 A;  3RMG A;  5CG6 A;  5EAU A;  3KRF B;  3N0F A;  4JYX A;  2ZEU A;  3DYF A;  3DYH A;  4E9Z A;  4NFJ F;  3WCB A;  5JV1 F;  2OPN A;  4LXW A;  4LIX A;  4P0X A;  3NPK A;  5IL3 A;  2F89 F;  4DZW A;  3S4J A;  3TS7 A;  3WC9 A;  1WL1 A;  3N1V F;  5B00 A;  4KK2 A;  2AZJ A;  5ILZ A;  2E92 A;  3M01 A;  3B7L A;  3V1V A;  4LZC A;  2Z4Z A;  4XQR F;  3N5H F;  4NKE A;  3BNX A;  3LJI A;  3N0G A;  5ERM A;  4DWB A;  2ZCO A;  2ZCR A;  3WJN A;  5HN8 A;  1YHL A;  1FPS A;  3WEI A;  2Z4X A;  4E1E A;  2J1P A;  1N24 A;  2J5C A;  3LG5 A;  3ICK A;  3G4D A;  3OAB A;  5DGS F;  3PYA A;  1VG6 A;  3PH7 A;  2H8O A;  3WCE A;  5ILY A;  2OPM A;  3VJC A;  3ICM A;  2E4O A;  3UCA A;  1V4H A;  4LZ0 A;  4LUU A;  5DGM F;  3VJA A;  3EFQ A;  3KRA A;  4JVJ F;  4L2X F;  4LFG A;  4HD1 A;  2Z50 A;  4JZX A;  2E8T A;  1VG3 A;  5IK0 A;  3ACY A;  3SAE A;  1N21 A;  1V4J A;  5ERN A;  1DI1 A;  4XQT F;  1HXC A;  4RXD A;  3OAB B;  3LSN A;  3KRC A;  3AQB B;  3SDT A;  1YYQ A;  2ZCQ A;  4DEM F;  4OMG A;  1RQJ A;  3KRA B;  2ZCS A;  3ADZ A;  1YYS A;  1KIZ A;  2I19 A;  2ONG A;  2E8V A;  2F94 F;  4LA5 A;  5A0I A;  5DJP F;  1HXG A;  3OAC A;  2Z7H A;  3RYE A;  3WEH A;  1WKZ A;  2E95 A;  2PS4 A;  5ERO A;  3QKC A;  3ICZ A;  3KRC B;  3IBA A;  4F6X A;  5AFX A;  3M9U A;  5AHU B;  3WCA A;  5IK9 A;  3ASX A;  2AZK A;  3WEJ A;  1UBX A;  5JUZ F;  3WCM A;  1V4E A;  1DGP A;  3CC9 A;  2Q58 A;  3SDU A;  4KQ5 A;  3N1W F;  3AQC B;  2J1O A;  5AYP A;  2ONH A;  1VG7 A;  3OAC B;  3P41 A;  3APZ A;  3SDR A;  2Z4V A;  3LOM A;  4F62 A;  3KRP A;  4JXY A;  3LEE A;  1VG2 A;  3WJO A;  4LLT A;  1ZW5 A;  5KSX F;  3Q1O A;  4DXJ A;  4GA3 A;  2VF6 A;  3WCI A;  4UMJ A;  3PKO A;  4PVX F;  5ILD A;  3ZL6 A;  1WL3 A;  4OKZ A;  3N3L F;  3WCC A;  3NRI A;  2PS5 A;  4RXA A;  5IKH A;  2F92 F;  1KIY A;  1YJ4 A;  5ILH A;  3RBM A;  3AE0 A;  3VJB A;  4N9U A;  3KRP B;  4MC0 A;  3WSA A;  3KRO A;  4LPG F;  5B03 A;  3TC1 A;  4WK5 A;  2PS8 A;  3KBK A;  5JV0 F;  5JA0 F;  5B0M A;  3BNY A;  4RXC A;  3N6K F;  3Q30 A;  4GAX A;  5B0J A;  1WL0 A;  4OKM A;  3ZCD A;  4LZ3 A;  1YQ7 A;  4MC3 A;  2Q9Y A;  1N1Z A;  3ACX A;  3QQV A;  1V4I A;  3WE9 A;  4RYP A;  3NPR A;  4LOB A;  3KRO B;  3SDQ A;  2FOR A;  4OGU A;  4LTZ A;  5DJR F;  3M02 A;  3VJ8 A;  3LDW A;  1EZF A;  5B0L A;  3ICN A;  2PS6 A;  3WEF A;  5EAT A;  4JZB A;  4FJQ A;  2E8U A;  2F8C F;  3WCJ A;  4KQU A;  5DHK A;  4KWD A;  2Q9Z A;  5IVG A;  5DIQ F;  1HM7 A;  1YYT A;  3MAV A;  1RQI A;  2EWG A;  3PYB A;  2OGD A;  2Q80 A;  3SDV A;  5ER8 A;  5IMN A;  3TFP A;  3PDE A;  3Q2Q A; 
#chains in the Genus database with same CATH topology
 3N5J F;  4F6V A;  4ZQ8 A;  4NUA A;  3OYR A;  3WEG A;  5A0J A;  3V66 A;  1HX9 A;  5B0I A;  3LK5 A;  3WCD A;  5DHI A;  1JFA A;  5AEL A;  4GP1 A;  1N23 A;  2Z4Y A;  3M0G A;  3ACW A;  2E8X A;  4DI5 A;  2RAH A;  4JXN A;  4EA0 A;  3WSB A;  3TFV A;  4GP2 A;  3P5R A;  3KB9 A;  2F7M F;  1JFG A;  4RXE A;  3WCH A;  3LMD A;  5H9D A;  4KVW A;  5HN7 A;  5IM1 A;  5E8L A;  2PS7 A;  3V1X A;  5HN9 A;  5DGN F;  1VG4 A;  1WL2 A;  4Q23 A;  4KQS A;  4DHD A;  4LFE A;  5DW7 A;  3IPI A;  5IMI A;  4KVI A;  1YYR A;  3VJE A;  4LFV F;  1YHK A;  5IMP A;  2F8Z F;  2ZY1 A;  5C05 A;  3LGK A;  1UBW A;  3M00 A;  2E8W A;  5IL8 A;  4N1Z F;  2QIS A;  2AEL A;  3N49 F;  2Z7I A;  5CG5 A;  4KVY A;  4XQS F;  3ZOU A;  1YHM A;  4P0W A;  1UBV A;  3LGZ B;  3ID0 A;  2F9K F;  3WCL A;  1RTR A;  4NFI F;  2E93 A;  2AZL A;  3G4F A;  3NF2 A;  3VJ9 A;  4KVD A;  1UBY A;  5ILK A;  5E8H A;  3LVS A;  3LZ9 A;  5JV2 F;  4E9U A;  4RNQ A;  2AET A;  4MC8 A;  4NG6 A;  2DH4 A;  2E91 A;  4DWG A;  3AQ0 A;  4H5E F;  2FTZ A;  1HM4 A;  3VJD A;  2Z4W A;  5B01 A;  3ZMB A;  1N20 A;  3RYW A;  4QPF A;  4LPH F;  1N1B A;  4KKM A;  3WJK A;  2P1C A;  3ZMC A;  5ILJ A;  3EGT A;  3DYG A;  4NKF A;  3P8R A;  4P0V A;  2Z52 A;  4LA6 A;  5E8K A;  5B0K A;  5IKA A;  4EA1 A;  4KPD A;  2Z78 A;  4PVY F;  1YV5 A;  1WY0 A;  2E94 A;  5IN8 A;  3S9V A;  1V4K A;  4H5C F;  5B02 A;  4KPJ A;  4K10 A;  2O1O A;  3MZV A;  3TFN A;  4QXS F;  3WCF A;  3N46 F;  4FP4 A;  3KRF A;  5EAS A;  2E90 A;  5DJV F;  4OMH A;  4KUX A;  3W7F A;  3EZ3 A;  3P8L A;  2AEK A;  4NFK F;  1HXA A;  4H5D F;  5I1U A;  3CP6 A;  4KFA A;  1YYU A;  5HNA A;  3CKE A;  3WCG A;  1WMW A;  3WEK A;  5IK6 A;  5DZ2 A;  4LTV A;  5A0K A;  1PS1 A;  1N22 A;  4LLS A;  3N45 F;  3N3D A;  3Q2Z A;  2ZEV A;  2OA6 A;  5ILI A;  3LLW A;  3P5P A;  4EA2 A;  3RMG A;  5CG6 A;  5EAU A;  3KRF B;  3N0F A;  4JYX A;  2ZEU A;  3DYF A;  3DYH A;  4E9Z A;  4NFJ F;  3WCB A;  5JV1 F;  2OPN A;  4LXW A;  4LIX A;  4P0X A;  3NPK A;  5IL3 A;  2F89 F;  4DZW A;  3S4J A;  3TS7 A;  3WC9 A;  1WL1 A;  3N1V F;  5B00 A;  4KK2 A;  2AZJ A;  5ILZ A;  2E92 A;  3M01 A;  3B7L A;  3V1V A;  4LZC A;  2Z4Z A;  4XQR F;  3N5H F;  4NKE A;  3BNX A;  3LJI A;  3N0G A;  5ERM A;  4DWB A;  2ZCO A;  2ZCR A;  3WJN A;  5HN8 A;  1YHL A;  1FPS A;  3WEI A;  2Z4X A;  4E1E A;  2J1P A;  1N24 A;  2J5C A;  3LG5 A;  3ICK A;  3G4D A;  3OAB A;  5DGS F;  3PYA A;  1VG6 A;  3PH7 A;  2H8O A;  3WCE A;  5ILY A;  2OPM A;  3VJC A;  3ICM A;  2E4O A;  3UCA A;  1V4H A;  4LZ0 A;  4LUU A;  5DGM F;  3VJA A;  3EFQ A;  3KRA A;  4JVJ F;  4L2X F;  4LFG A;  4HD1 A;  2Z50 A;  4JZX A;  2E8T A;  1VG3 A;  5IK0 A;  3ACY A;  3SAE A;  1N21 A;  1V4J A;  5ERN A;  1DI1 A;  4XQT F;  1HXC A;  4RXD A;  3OAB B;  3LSN A;  3KRC A;  3AQB B;  3SDT A;  1YYQ A;  2ZCQ A;  4DEM F;  4OMG A;  1RQJ A;  3KRA B;  2ZCS A;  3ADZ A;  1YYS A;  1KIZ A;  2I19 A;  2ONG A;  2E8V A;  2F94 F;  4LA5 A;  5A0I A;  5DJP F;  1HXG A;  3OAC A;  2Z7H A;  3RYE A;  3WEH A;  1WKZ A;  2E95 A;  2PS4 A;  5ERO A;  3QKC A;  3ICZ A;  3KRC B;  3IBA A;  4F6X A;  5AFX A;  3M9U A;  5AHU B;  3WCA A;  5IK9 A;  3ASX A;  2AZK A;  3WEJ A;  1UBX A;  5JUZ F;  3WCM A;  1V4E A;  1DGP A;  3CC9 A;  2Q58 A;  3SDU A;  4KQ5 A;  3N1W F;  3AQC B;  2J1O A;  5AYP A;  2ONH A;  1VG7 A;  3OAC B;  3P41 A;  3APZ A;  3SDR A;  2Z4V A;  3LOM A;  4F62 A;  3KRP A;  4JXY A;  3LEE A;  1VG2 A;  3WJO A;  4LLT A;  1ZW5 A;  5KSX F;  3Q1O A;  4DXJ A;  4GA3 A;  2VF6 A;  3WCI A;  4UMJ A;  3PKO A;  4PVX F;  5ILD A;  3ZL6 A;  1WL3 A;  4OKZ A;  3N3L F;  3WCC A;  3NRI A;  2PS5 A;  4RXA A;  5IKH A;  2F92 F;  1KIY A;  1YJ4 A;  5ILH A;  3RBM A;  3AE0 A;  3VJB A;  4N9U A;  3KRP B;  4MC0 A;  3WSA A;  3KRO A;  4LPG F;  5B03 A;  3TC1 A;  4WK5 A;  2PS8 A;  3KBK A;  5JV0 F;  5JA0 F;  5B0M A;  3BNY A;  4RXC A;  3N6K F;  3Q30 A;  4GAX A;  5B0J A;  1WL0 A;  4OKM A;  3ZCD A;  4LZ3 A;  1YQ7 A;  4MC3 A;  2Q9Y A;  1N1Z A;  3ACX A;  3QQV A;  1V4I A;  3WE9 A;  4RYP A;  3NPR A;  4LOB A;  3KRO B;  3SDQ A;  2FOR A;  4OGU A;  4LTZ A;  5DJR F;  3M02 A;  3VJ8 A;  3LDW A;  1EZF A;  5B0L A;  3ICN A;  2PS6 A;  3WEF A;  5EAT A;  4JZB A;  4FJQ A;  2E8U A;  2F8C F;  3WCJ A;  4KQU A;  5DHK A;  4KWD A;  2Q9Z A;  5IVG A;  5DIQ F;  1HM7 A;  1YYT A;  3MAV A;  1RQI A;  2EWG A;  3PYB A;  2OGD A;  2Q80 A;  3SDV A;  5ER8 A;  5IMN A;  3TFP A;  3PDE A;  3Q2Q A; 
#chains in the Genus database with same CATH homology
 3N5J F;  4F6V A;  4ZQ8 A;  4NUA A;  3OYR A;  3WEG A;  5A0J A;  3V66 A;  1HX9 A;  5B0I A;  3LK5 A;  3WCD A;  5DHI A;  1JFA A;  5AEL A;  4GP1 A;  1N23 A;  2Z4Y A;  3M0G A;  3ACW A;  2E8X A;  4DI5 A;  2RAH A;  4JXN A;  4EA0 A;  3WSB A;  3TFV A;  4GP2 A;  3P5R A;  3KB9 A;  2F7M F;  1JFG A;  4RXE A;  3WCH A;  3LMD A;  5H9D A;  4KVW A;  5HN7 A;  5IM1 A;  5E8L A;  2PS7 A;  3V1X A;  5HN9 A;  5DGN F;  1VG4 A;  1WL2 A;  4Q23 A;  4KQS A;  4DHD A;  4LFE A;  5DW7 A;  3IPI A;  5IMI A;  4KVI A;  1YYR A;  3VJE A;  4LFV F;  1YHK A;  5IMP A;  2F8Z F;  2ZY1 A;  5C05 A;  3LGK A;  1UBW A;  3M00 A;  2E8W A;  5IL8 A;  4N1Z F;  2QIS A;  2AEL A;  3N49 F;  2Z7I A;  5CG5 A;  4KVY A;  4XQS F;  3ZOU A;  1YHM A;  4P0W A;  1UBV A;  3LGZ B;  3ID0 A;  2F9K F;  3WCL A;  1RTR A;  4NFI F;  2E93 A;  2AZL A;  3G4F A;  3NF2 A;  3VJ9 A;  4KVD A;  1UBY A;  5ILK A;  5E8H A;  3LVS A;  3LZ9 A;  5JV2 F;  4E9U A;  4RNQ A;  2AET A;  4MC8 A;  4NG6 A;  2DH4 A;  2E91 A;  4DWG A;  3AQ0 A;  4H5E F;  2FTZ A;  1HM4 A;  3VJD A;  2Z4W A;  5B01 A;  3ZMB A;  1N20 A;  3RYW A;  4QPF A;  4LPH F;  1N1B A;  4KKM A;  3WJK A;  2P1C A;  3ZMC A;  5ILJ A;  3EGT A;  3DYG A;  4NKF A;  3P8R A;  4P0V A;  2Z52 A;  4LA6 A;  5E8K A;  5B0K A;  5IKA A;  4EA1 A;  4KPD A;  2Z78 A;  4PVY F;  1YV5 A;  1WY0 A;  2E94 A;  5IN8 A;  3S9V A;  1V4K A;  4H5C F;  5B02 A;  4KPJ A;  4K10 A;  2O1O A;  3MZV A;  3TFN A;  4QXS F;  3WCF A;  3N46 F;  4FP4 A;  3KRF A;  5EAS A;  2E90 A;  5DJV F;  4OMH A;  4KUX A;  3W7F A;  3EZ3 A;  3P8L A;  2AEK A;  4NFK F;  1HXA A;  4H5D F;  5I1U A;  3CP6 A;  4KFA A;  1YYU A;  5HNA A;  3CKE A;  3WCG A;  1WMW A;  3WEK A;  5IK6 A;  5DZ2 A;  4LTV A;  5A0K A;  1PS1 A;  1N22 A;  4LLS A;  3N45 F;  3N3D A;  3Q2Z A;  2ZEV A;  2OA6 A;  5ILI A;  3LLW A;  3P5P A;  4EA2 A;  3RMG A;  5CG6 A;  5EAU A;  3KRF B;  3N0F A;  4JYX A;  2ZEU A;  3DYF A;  3DYH A;  4E9Z A;  4NFJ F;  3WCB A;  5JV1 F;  2OPN A;  4LXW A;  4LIX A;  4P0X A;  3NPK A;  5IL3 A;  2F89 F;  4DZW A;  3S4J A;  3TS7 A;  3WC9 A;  1WL1 A;  3N1V F;  5B00 A;  4KK2 A;  2AZJ A;  5ILZ A;  2E92 A;  3M01 A;  3B7L A;  3V1V A;  4LZC A;  2Z4Z A;  4XQR F;  3N5H F;  4NKE A;  3BNX A;  3LJI A;  3N0G A;  5ERM A;  4DWB A;  2ZCO A;  2ZCR A;  3WJN A;  5HN8 A;  1YHL A;  1FPS A;  3WEI A;  2Z4X A;  4E1E A;  2J1P A;  1N24 A;  2J5C A;  3LG5 A;  3ICK A;  3G4D A;  3OAB A;  5DGS F;  3PYA A;  1VG6 A;  3PH7 A;  2H8O A;  3WCE A;  5ILY A;  2OPM A;  3VJC A;  3ICM A;  2E4O A;  3UCA A;  1V4H A;  4LZ0 A;  4LUU A;  5DGM F;  3VJA A;  3EFQ A;  3KRA A;  4JVJ F;  4L2X F;  4LFG A;  4HD1 A;  2Z50 A;  4JZX A;  2E8T A;  1VG3 A;  5IK0 A;  3ACY A;  3SAE A;  1N21 A;  1V4J A;  5ERN A;  1DI1 A;  4XQT F;  1HXC A;  4RXD A;  3OAB B;  3LSN A;  3KRC A;  3AQB B;  3SDT A;  1YYQ A;  2ZCQ A;  4DEM F;  4OMG A;  1RQJ A;  3KRA B;  2ZCS A;  3ADZ A;  1YYS A;  1KIZ A;  2I19 A;  2ONG A;  2E8V A;  2F94 F;  4LA5 A;  5A0I A;  5DJP F;  1HXG A;  3OAC A;  2Z7H A;  3RYE A;  3WEH A;  1WKZ A;  2E95 A;  2PS4 A;  5ERO A;  3QKC A;  3ICZ A;  3KRC B;  3IBA A;  4F6X A;  5AFX A;  3M9U A;  5AHU B;  3WCA A;  5IK9 A;  3ASX A;  2AZK A;  3WEJ A;  1UBX A;  5JUZ F;  3WCM A;  1V4E A;  1DGP A;  3CC9 A;  2Q58 A;  3SDU A;  4KQ5 A;  3N1W F;  3AQC B;  2J1O A;  5AYP A;  2ONH A;  1VG7 A;  3OAC B;  3P41 A;  3APZ A;  3SDR A;  2Z4V A;  3LOM A;  4F62 A;  3KRP A;  4JXY A;  3LEE A;  1VG2 A;  3WJO A;  4LLT A;  1ZW5 A;  5KSX F;  3Q1O A;  4DXJ A;  4GA3 A;  2VF6 A;  3WCI A;  4UMJ A;  3PKO A;  4PVX F;  5ILD A;  3ZL6 A;  1WL3 A;  4OKZ A;  3N3L F;  3WCC A;  3NRI A;  2PS5 A;  4RXA A;  5IKH A;  2F92 F;  1KIY A;  1YJ4 A;  5ILH A;  3RBM A;  3AE0 A;  3VJB A;  4N9U A;  3KRP B;  4MC0 A;  3WSA A;  3KRO A;  4LPG F;  5B03 A;  3TC1 A;  4WK5 A;  2PS8 A;  3KBK A;  5JV0 F;  5JA0 F;  5B0M A;  3BNY A;  4RXC A;  3N6K F;  3Q30 A;  4GAX A;  5B0J A;  1WL0 A;  4OKM A;  3ZCD A;  4LZ3 A;  1YQ7 A;  4MC3 A;  2Q9Y A;  1N1Z A;  3ACX A;  3QQV A;  1V4I A;  3WE9 A;  4RYP A;  3NPR A;  4LOB A;  3KRO B;  3SDQ A;  2FOR A;  4OGU A;  4LTZ A;  5DJR F;  3M02 A;  3VJ8 A;  3LDW A;  1EZF A;  5B0L A;  3ICN A;  2PS6 A;  3WEF A;  5EAT A;  4JZB A;  4FJQ A;  2E8U A;  2F8C F;  3WCJ A;  4KQU A;  5DHK A;  4KWD A;  2Q9Z A;  5IVG A;  5DIQ F;  1HM7 A;  1YYT A;  3MAV A;  1RQI A;  2EWG A;  3PYB A;  2OGD A;  2Q80 A;  3SDV A;  5ER8 A;  5IMN A;  3TFP A;  3PDE A;  3Q2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...