4E9ZA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with quinuclidine bph-651 in the s1 site
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
total genus 118
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4e9zA00
1VG4A 5JV2F 2E94A 1WKZA 2AELA 4DHDA 5DGMF 4E1EA 5A0KA 3NF2A 1JFGA 5DZ2A 3VJEA 3ASXA 2J5CA 5B0LA 3G4FA 4H5DF 3LGKA 3EFQA 4DI5A 4KUXA 1WL2A 3N46F 2AEKA 3APZA 3DYGA 3ID0A 5HN7A 3WE9A 5ILJA 3TC1A 4H5CF 3Q1OA 4H5EF 4KVWA 3N5JF 3WEFA 1JFAA 3WC9A 2P1CA 2O1OA 5B02A 5CG6A 1HXGA 2OPNA 3KRAB 3OABB 5IKHA 2FORA 1YYQA 5EROA 2Z78A 5ERNA 1N21A 4P0VA 2ZY1A 2Z4VA 5IMIA 5B0JA 4HD1A 4NFKF 1YYRA 3ICNA 2Z4WA 3P5PA 3ICZA 1ZW5A 5JV1F 2Q9ZA 3AQBB 3WEHA 1N24A 3M9UA 4XQRF 4OMHA 3LEEA 5DHKA 3WCEA 3KRPB 2F9KF 3ICKA 4MC8A 4JXYA 3TFVA 4P0WA 1UBXA 2E8WA 2Z4ZA 1RTRA 3WEGA 3WCCA 2H8OA 4EA2A 4F62A 2ZEVA 3P8RA 1YYUA 2E95A 3M02A 2Z50A 3LK5A 3VJDA 3AQ0A 3QQVA 4PVYF 5DGNF 3WCBA 4QPFA 3OACA 2Z4XA 5JA0F 5JV0F 5B00A 5DHIA 1YHKA 4RNQA 3MZVA 3N1VF 3SAEA 1YHLA 4RXDA 2E90A 2E8TA 3EGTA 4MC3A 3RYWA 4GP2A 5IL3A 3PH7A 3IBAA 3Q2QA 5EAUA 4LTZA 1YV5A 2Q9YA 2ZCSA 5A0JA 2OGDA 3LZ9A 4JZXA 1HXAA 2Q58A 3LJIA 2E8XA 2AZLA 3CKEA 4GP1A 4OMGA 3KRCA 5IK9A 5ILIA 3W7FA 1V4HA 3KBKA 1N1ZA 5CG5A 5ILZA 1V4IA 1UBWA 4FP4A 3WSBA 1DI1A 3LVSA 3ZCDA 1V4JA 3SDUA 2F89F 5ER8A 4OKZA 3M00A 4LZ0A 5IM1A 4KQSA 2Q80A 3BNYA 4L2XF 3AE0A 3V1XA 3WCFA 2OA6A 4EA1A 3SDTA 5A0IA 1HXCA 3Q2ZA 1N1BA 3PDEA 3SDRA 4ZQ8A 5DJPF 2ZCOA 3VJBA 5B0KA 4WK5A 4LUUA 5ILDA 2ONHA 2PS5A 4LLTA 5I1UA 2PS4A 4XQTF 1VG2A 2AETA 5ERMA 1HX9A 3WJKA 3N1WF 1KIZA 3IPIA 4KWDA 5C05A 3KROA 3ZMBA 4F6XA 3SDQA 1EZFA 3KRCB 3WJOA 1YYTA 1UBVA 5EATA 4DWGA 2ONGA 3ADZA 3WJNA 2F92F 3N0GA 3M01A 3ACYA 3WCIA 4KPJA 1WL1A 4KVYA 4DZWA 3BNXA 3RYEA 2F8CF 4N9UA 1N23A 4OGUA 2OPMA 3VJ8A 1WY0A 3LSNA 1YHMA 4QXSF 5IN8A 1FPSA 4KQUA 4LFGA 3TS7A 4GA3A 3TFNA 4KVIA 3ACXA 3WCGA 1WL3A 3LMDA 3WSAA 1YYSA 3NRIA 4JZBA 1PS1A 1VG3A 2QISA 3KRFA 5DW7A 3PKOA 3P41A 2ZEUA 4NFIF 2Z4YA 2FTZA 4UMJA 2E4OA 3N0FA 1HM4A 3WCAA 3LGZB 3M0GA 2ZCRA 4F6VA 1UBYA 3KROB 5DGSF 5B0IA 3ACWA 5AELA 3UCAA 3PYBA 1YJ4A 3LDWA 3RMGA 3EZ3A 3S9VA 3WCMA 4KQ5A 2F94F 1N22A 3WCHA 4LA5A 4NG6A 4NUAA 4LFEA 3N3DA 4LZ3A 4P0XA 1WMWA 3LOMA 5DIQF 3KRPA 4XQSF 3DYHA 4KVDA 3LLWA 5IVGA 5IK6A 1YQ7A 3KB9A 3N49F 3VJCA 2J1OA 4GAXA 2F7MF 3WCJA 3OACB 3OYRA 4RXCA 4LLSA 3VJ9A 4LFVF 3ZL6A 4NKEA 3N3LF 5DJVF 4RXAA 2ZCQA 2PS7A 3CC9A 3G4DA 2EWGA 3S4JA 3LG5A 3Q30A 4LIXA 5B03A 3KRFB 2VF6A 4N1ZF 2PS8A 2J1PA 1KIYA 5JUZF 1V4EA 4DEMF 4JYXA 4LOBA 4RYPA 4Q23A 3ZOUA 4LPHF 3VJAA 2F8ZF 2DH4A 3PYAA 3ZMCA 5B01A 5HNAA 5EASA 1N20A 5KSXF 3N5HF 3AQCB 3P8LA 3TFPA 3V66A 3WEKA 3MAVA 3DYFA 1WL0A 4K10A 4PVXF 4KFAA 5ILKA 4LTVA 5IKAA 4FJQA 5HN9A 3SDVA 5AFXA 4NKFA 5E8HA 5IK0A 4E9UA 2E8UA 2PS6A 1V4KA 3P5RA 5E8KA 3V1VA 4OKMA 5AYPA 1RQJA 5ILYA 4KPDA 4RXEA 2I19A 4LZCA 4KK2A 2E91A 3B7LA 2AZKA 5HN8A 2AZJA 4E9ZA 5B0MA 2Z7HA 4LPGF 5H9DA 3KRAA 3OABA 4DXJA 2E8VA 1VG7A 1DGPA 3N45F 3WCLA 4JVJF 2E92A 1VG6A 4MC0A 4KKMA 5DJRF 3RBMA 5AHUB 3WCDA 1HM7A 3N6KF 3QKCA 4EA0A 3WEIA 1RQIA 5ILHA 4DWBA 5E8LA 4JXNA 4LA6A 3ICMA 2Z52A 5IMPA 2Z7IA 2E93A 4LXWA 3WEJA 2RAHA 3CP6A 5IMNA 3NPRA 3NPKA 5IL8A 4NFJF
chains in the Genus database with same CATH superfamily
1VG4A 5JV2F 2E94A 1WKZA 2AELA 4DHDA 5DGMF 4E1EA 5A0KA 3NF2A 1JFGA 5DZ2A 3VJEA 3ASXA 2J5CA 5B0LA 3G4FA 4H5DF 3LGKA 3EFQA 4DI5A 4KUXA 1WL2A 3N46F 2AEKA 3APZA 3DYGA 3ID0A 5HN7A 3WE9A 5ILJA 3TC1A 4H5CF 3Q1OA 4H5EF 4KVWA 3N5JF 3WEFA 1JFAA 3WC9A 2P1CA 2O1OA 5B02A 5CG6A 1HXGA 2OPNA 3KRAB 3OABB 5IKHA 2FORA 1YYQA 5EROA 2Z78A 5ERNA 1N21A 4P0VA 2ZY1A 2Z4VA 5IMIA 5B0JA 4HD1A 4NFKF 1YYRA 3ICNA 2Z4WA 3P5PA 3ICZA 1ZW5A 5JV1F 2Q9ZA 3AQBB 3WEHA 1N24A 3M9UA 4XQRF 4OMHA 3LEEA 5DHKA 3WCEA 3KRPB 2F9KF 3ICKA 4MC8A 4JXYA 3TFVA 4P0WA 1UBXA 2E8WA 2Z4ZA 1RTRA 3WEGA 3WCCA 2H8OA 4EA2A 4F62A 2ZEVA 3P8RA 1YYUA 2E95A 3M02A 2Z50A 3LK5A 3VJDA 3AQ0A 3QQVA 4PVYF 5DGNF 3WCBA 4QPFA 3OACA 2Z4XA 5JA0F 5JV0F 5B00A 5DHIA 1YHKA 4RNQA 3MZVA 3N1VF 3SAEA 1YHLA 4RXDA 2E90A 2E8TA 3EGTA 4MC3A 3RYWA 4GP2A 5IL3A 3PH7A 3IBAA 3Q2QA 5EAUA 4LTZA 1YV5A 2Q9YA 2ZCSA 5A0JA 2OGDA 3LZ9A 4JZXA 1HXAA 2Q58A 3LJIA 2E8XA 2AZLA 3CKEA 4GP1A 4OMGA 3KRCA 5IK9A 5ILIA 3W7FA 1V4HA 3KBKA 1N1ZA 5CG5A 5ILZA 1V4IA 1UBWA 4FP4A 3WSBA 1DI1A 3LVSA 3ZCDA 1V4JA 3SDUA 2F89F 5ER8A 4OKZA 3M00A 4LZ0A 5IM1A 4KQSA 2Q80A 3BNYA 4L2XF 3AE0A 3V1XA 3WCFA 2OA6A 4EA1A 3SDTA 5A0IA 1HXCA 3Q2ZA 1N1BA 3PDEA 3SDRA 4ZQ8A 5DJPF 2ZCOA 3VJBA 5B0KA 4WK5A 4LUUA 5ILDA 2ONHA 2PS5A 4LLTA 5I1UA 2PS4A 4XQTF 1VG2A 2AETA 5ERMA 1HX9A 3WJKA 3N1WF 1KIZA 3IPIA 4KWDA 5C05A 3KROA 3ZMBA 4F6XA 3SDQA 1EZFA 3KRCB 3WJOA 1YYTA 1UBVA 5EATA 4DWGA 2ONGA 3ADZA 3WJNA 2F92F 3N0GA 3M01A 3ACYA 3WCIA 4KPJA 1WL1A 4KVYA 4DZWA 3BNXA 3RYEA 2F8CF 4N9UA 1N23A 4OGUA 2OPMA 3VJ8A 1WY0A 3LSNA 1YHMA 4QXSF 5IN8A 1FPSA 4KQUA 4LFGA 3TS7A 4GA3A 3TFNA 4KVIA 3ACXA 3WCGA 1WL3A 3LMDA 3WSAA 1YYSA 3NRIA 4JZBA 1PS1A 1VG3A 2QISA 3KRFA 5DW7A 3PKOA 3P41A 2ZEUA 4NFIF 2Z4YA 2FTZA 4UMJA 2E4OA 3N0FA 1HM4A 3WCAA 3LGZB 3M0GA 2ZCRA 4F6VA 1UBYA 3KROB 5DGSF 5B0IA 3ACWA 5AELA 3UCAA 3PYBA 1YJ4A 3LDWA 3RMGA 3EZ3A 3S9VA 3WCMA 4KQ5A 2F94F 1N22A 3WCHA 4LA5A 4NG6A 4NUAA 4LFEA 3N3DA 4LZ3A 4P0XA 1WMWA 3LOMA 5DIQF 3KRPA 4XQSF 3DYHA 4KVDA 3LLWA 5IVGA 5IK6A 1YQ7A 3KB9A 3N49F 3VJCA 2J1OA 4GAXA 2F7MF 3WCJA 3OACB 3OYRA 4RXCA 4LLSA 3VJ9A 4LFVF 3ZL6A 4NKEA 3N3LF 5DJVF 4RXAA 2ZCQA 2PS7A 3CC9A 3G4DA 2EWGA 3S4JA 3LG5A 3Q30A 4LIXA 5B03A 3KRFB 2VF6A 4N1ZF 2PS8A 2J1PA 1KIYA 5JUZF 1V4EA 4DEMF 4JYXA 4LOBA 4RYPA 4Q23A 3ZOUA 4LPHF 3VJAA 2F8ZF 2DH4A 3PYAA 3ZMCA 5B01A 5HNAA 5EASA 1N20A 5KSXF 3N5HF 3AQCB 3P8LA 3TFPA 3V66A 3WEKA 3MAVA 3DYFA 1WL0A 4K10A 4PVXF 4KFAA 5ILKA 4LTVA 5IKAA 4FJQA 5HN9A 3SDVA 5AFXA 4NKFA 5E8HA 5IK0A 4E9UA 2E8UA 2PS6A 1V4KA 3P5RA 5E8KA 3V1VA 4OKMA 5AYPA 1RQJA 5ILYA 4KPDA 4RXEA 2I19A 4LZCA 4KK2A 2E91A 3B7LA 2AZKA 5HN8A 2AZJA 4E9ZA 5B0MA 2Z7HA 4LPGF 5H9DA 3KRAA 3OABA 4DXJA 2E8VA 1VG7A 1DGPA 3N45F 3WCLA 4JVJF 2E92A 1VG6A 4MC0A 4KKMA 5DJRF 3RBMA 5AHUB 3WCDA 1HM7A 3N6KF 3QKCA 4EA0A 3WEIA 1RQIA 5ILHA 4DWBA 5E8LA 4JXNA 4LA6A 3ICMA 2Z52A 5IMPA 2Z7IA 2E93A 4LXWA 3WEJA 2RAHA 3CP6A 5IMNA 3NPRA 3NPKA 5IL8A 4NFJF
chains in the Genus database with same CATH topology
1VG4A 5JV2F 2E94A 1WKZA 2AELA 4DHDA 5DGMF 4E1EA 5A0KA 3NF2A 1JFGA 5DZ2A 3VJEA 3ASXA 2J5CA 5B0LA 3G4FA 4H5DF 3LGKA 3EFQA 4DI5A 4KUXA 1WL2A 3N46F 2AEKA 3APZA 3DYGA 3ID0A 5HN7A 3WE9A 5ILJA 3TC1A 4H5CF 3Q1OA 4H5EF 4KVWA 3N5JF 3WEFA 1JFAA 3WC9A 2P1CA 2O1OA 5B02A 5CG6A 1HXGA 2OPNA 3KRAB 3OABB 5IKHA 2FORA 1YYQA 5EROA 2Z78A 5ERNA 1N21A 4P0VA 2ZY1A 2Z4VA 5IMIA 5B0JA 4HD1A 4NFKF 1YYRA 3ICNA 2Z4WA 3P5PA 3ICZA 1ZW5A 5JV1F 2Q9ZA 3AQBB 3WEHA 1N24A 3M9UA 4XQRF 4OMHA 3LEEA 5DHKA 3WCEA 3KRPB 2F9KF 3ICKA 4MC8A 4JXYA 3TFVA 4P0WA 1UBXA 2E8WA 2Z4ZA 1RTRA 3WEGA 3WCCA 2H8OA 4EA2A 4F62A 2ZEVA 3P8RA 1YYUA 2E95A 3M02A 2Z50A 3LK5A 3VJDA 3AQ0A 3QQVA 4PVYF 5DGNF 3WCBA 4QPFA 3OACA 2Z4XA 5JA0F 5JV0F 5B00A 5DHIA 1YHKA 4RNQA 3MZVA 3N1VF 3SAEA 1YHLA 4RXDA 2E90A 2E8TA 3EGTA 4MC3A 3RYWA 4GP2A 5IL3A 3PH7A 3IBAA 3Q2QA 5EAUA 4LTZA 1YV5A 2Q9YA 2ZCSA 5A0JA 2OGDA 3LZ9A 4JZXA 1HXAA 2Q58A 3LJIA 2E8XA 2AZLA 3CKEA 4GP1A 4OMGA 3KRCA 5IK9A 5ILIA 3W7FA 1V4HA 3KBKA 1N1ZA 5CG5A 5ILZA 1V4IA 1UBWA 4FP4A 3WSBA 1DI1A 3LVSA 3ZCDA 1V4JA 3SDUA 2F89F 5ER8A 4OKZA 3M00A 4LZ0A 5IM1A 4KQSA 2Q80A 3BNYA 4L2XF 3AE0A 3V1XA 3WCFA 2OA6A 4EA1A 3SDTA 5A0IA 1HXCA 3Q2ZA 1N1BA 3PDEA 3SDRA 4ZQ8A 5DJPF 2ZCOA 3VJBA 5B0KA 4WK5A 4LUUA 5ILDA 2ONHA 2PS5A 4LLTA 5I1UA 2PS4A 4XQTF 1VG2A 2AETA 5ERMA 1HX9A 3WJKA 3N1WF 1KIZA 3IPIA 4KWDA 5C05A 3KROA 3ZMBA 4F6XA 3SDQA 1EZFA 3KRCB 3WJOA 1YYTA 1UBVA 5EATA 4DWGA 2ONGA 3ADZA 3WJNA 2F92F 3N0GA 3M01A 3ACYA 3WCIA 4KPJA 1WL1A 4KVYA 4DZWA 3BNXA 3RYEA 2F8CF 4N9UA 1N23A 4OGUA 2OPMA 3VJ8A 1WY0A 3LSNA 1YHMA 4QXSF 5IN8A 1FPSA 4KQUA 4LFGA 3TS7A 4GA3A 3TFNA 4KVIA 3ACXA 3WCGA 1WL3A 3LMDA 3WSAA 1YYSA 3NRIA 4JZBA 1PS1A 1VG3A 2QISA 3KRFA 5DW7A 3PKOA 3P41A 2ZEUA 4NFIF 2Z4YA 2FTZA 4UMJA 2E4OA 3N0FA 1HM4A 3WCAA 3LGZB 3M0GA 2ZCRA 4F6VA 1UBYA 3KROB 5DGSF 5B0IA 3ACWA 5AELA 3UCAA 3PYBA 1YJ4A 3LDWA 3RMGA 3EZ3A 3S9VA 3WCMA 4KQ5A 2F94F 1N22A 3WCHA 4LA5A 4NG6A 4NUAA 4LFEA 3N3DA 4LZ3A 4P0XA 1WMWA 3LOMA 5DIQF 3KRPA 4XQSF 3DYHA 4KVDA 3LLWA 5IVGA 5IK6A 1YQ7A 3KB9A 3N49F 3VJCA 2J1OA 4GAXA 2F7MF 3WCJA 3OACB 3OYRA 4RXCA 4LLSA 3VJ9A 4LFVF 3ZL6A 4NKEA 3N3LF 5DJVF 4RXAA 2ZCQA 2PS7A 3CC9A 3G4DA 2EWGA 3S4JA 3LG5A 3Q30A 4LIXA 5B03A 3KRFB 2VF6A 4N1ZF 2PS8A 2J1PA 1KIYA 5JUZF 1V4EA 4DEMF 4JYXA 4LOBA 4RYPA 4Q23A 3ZOUA 4LPHF 3VJAA 2F8ZF 2DH4A 3PYAA 3ZMCA 5B01A 5HNAA 5EASA 1N20A 5KSXF 3N5HF 3AQCB 3P8LA 3TFPA 3V66A 3WEKA 3MAVA 3DYFA 1WL0A 4K10A 4PVXF 4KFAA 5ILKA 4LTVA 5IKAA 4FJQA 5HN9A 3SDVA 5AFXA 4NKFA 5E8HA 5IK0A 4E9UA 2E8UA 2PS6A 1V4KA 3P5RA 5E8KA 3V1VA 4OKMA 5AYPA 1RQJA 5ILYA 4KPDA 4RXEA 2I19A 4LZCA 4KK2A 2E91A 3B7LA 2AZKA 5HN8A 2AZJA 4E9ZA 5B0MA 2Z7HA 4LPGF 5H9DA 3KRAA 3OABA 4DXJA 2E8VA 1VG7A 1DGPA 3N45F 3WCLA 4JVJF 2E92A 1VG6A 4MC0A 4KKMA 5DJRF 3RBMA 5AHUB 3WCDA 1HM7A 3N6KF 3QKCA 4EA0A 3WEIA 1RQIA 5ILHA 4DWBA 5E8LA 4JXNA 4LA6A 3ICMA 2Z52A 5IMPA 2Z7IA 2E93A 4LXWA 3WEJA 2RAHA 3CP6A 5IMNA 3NPRA 3NPKA 5IL8A 4NFJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VG4 A;  5JV2 F;  2E94 A;  1WKZ A;  2AEL A;  4DHD A;  5DGM F;  4E1E A;  5A0K A;  3NF2 A;  1JFG A;  5DZ2 A;  3VJE A;  3ASX A;  2J5C A;  5B0L A;  3G4F A;  4H5D F;  3LGK A;  3EFQ A;  4DI5 A;  4KUX A;  1WL2 A;  3N46 F;  2AEK A;  3APZ A;  3DYG A;  3ID0 A;  5HN7 A;  3WE9 A;  5ILJ A;  3TC1 A;  4H5C F;  3Q1O A;  4H5E F;  4KVW A;  3N5J F;  3WEF A;  1JFA A;  3WC9 A;  2P1C A;  2O1O A;  5B02 A;  5CG6 A;  1HXG A;  2OPN A;  3KRA B;  3OAB B;  5IKH A;  2FOR A;  1YYQ A;  5ERO A;  2Z78 A;  5ERN A;  1N21 A;  4P0V A;  2ZY1 A;  2Z4V A;  5IMI A;  5B0J A;  4HD1 A;  4NFK F;  1YYR A;  3ICN A;  2Z4W A;  3P5P A;  3ICZ A;  1ZW5 A;  5JV1 F;  2Q9Z A;  3AQB B;  3WEH A;  1N24 A;  3M9U A;  4XQR F;  4OMH A;  3LEE A;  5DHK A;  3WCE A;  3KRP B;  2F9K F;  3ICK A;  4MC8 A;  4JXY A;  3TFV A;  4P0W A;  1UBX A;  2E8W A;  2Z4Z A;  1RTR A;  3WEG A;  3WCC A;  2H8O A;  4EA2 A;  4F62 A;  2ZEV A;  3P8R A;  1YYU A;  2E95 A;  3M02 A;  2Z50 A;  3LK5 A;  3VJD A;  3AQ0 A;  3QQV A;  4PVY F;  5DGN F;  3WCB A;  4QPF A;  3OAC A;  2Z4X A;  5JA0 F;  5JV0 F;  5B00 A;  5DHI A;  1YHK A;  4RNQ A;  3MZV A;  3N1V F;  3SAE A;  1YHL A;  4RXD A;  2E90 A;  2E8T A;  3EGT A;  4MC3 A;  3RYW A;  4GP2 A;  5IL3 A;  3PH7 A;  3IBA A;  3Q2Q A;  5EAU A;  4LTZ A;  1YV5 A;  2Q9Y A;  2ZCS A;  5A0J A;  2OGD A;  3LZ9 A;  4JZX A;  1HXA A;  2Q58 A;  3LJI A;  2E8X A;  2AZL A;  3CKE A;  4GP1 A;  4OMG A;  3KRC A;  5IK9 A;  5ILI A;  3W7F A;  1V4H A;  3KBK A;  1N1Z A;  5CG5 A;  5ILZ A;  1V4I A;  1UBW A;  4FP4 A;  3WSB A;  1DI1 A;  3LVS A;  3ZCD A;  1V4J A;  3SDU A;  2F89 F;  5ER8 A;  4OKZ A;  3M00 A;  4LZ0 A;  5IM1 A;  4KQS A;  2Q80 A;  3BNY A;  4L2X F;  3AE0 A;  3V1X A;  3WCF A;  2OA6 A;  4EA1 A;  3SDT A;  5A0I A;  1HXC A;  3Q2Z A;  1N1B A;  3PDE A;  3SDR A;  4ZQ8 A;  5DJP F;  2ZCO A;  3VJB A;  5B0K A;  4WK5 A;  4LUU A;  5ILD A;  2ONH A;  2PS5 A;  4LLT A;  5I1U A;  2PS4 A;  4XQT F;  1VG2 A;  2AET A;  5ERM A;  1HX9 A;  3WJK A;  3N1W F;  1KIZ A;  3IPI A;  4KWD A;  5C05 A;  3KRO A;  3ZMB A;  4F6X A;  3SDQ A;  1EZF A;  3KRC B;  3WJO A;  1YYT A;  1UBV A;  5EAT A;  4DWG A;  2ONG A;  3ADZ A;  3WJN A;  2F92 F;  3N0G A;  3M01 A;  3ACY A;  3WCI A;  4KPJ A;  1WL1 A;  4KVY A;  4DZW A;  3BNX A;  3RYE A;  2F8C F;  4N9U A;  1N23 A;  4OGU A;  2OPM A;  3VJ8 A;  1WY0 A;  3LSN A;  1YHM A;  4QXS F;  5IN8 A;  1FPS A;  4KQU A;  4LFG A;  3TS7 A;  4GA3 A;  3TFN A;  4KVI A;  3ACX A;  3WCG A;  1WL3 A;  3LMD A;  3WSA A;  1YYS A;  3NRI A;  4JZB A;  1PS1 A;  1VG3 A;  2QIS A;  3KRF A;  5DW7 A;  3PKO A;  3P41 A;  2ZEU A;  4NFI F;  2Z4Y A;  2FTZ A;  4UMJ A;  2E4O A;  3N0F A;  1HM4 A;  3WCA A;  3LGZ B;  3M0G A;  2ZCR A;  4F6V A;  1UBY A;  3KRO B;  5DGS F;  5B0I A;  3ACW A;  5AEL A;  3UCA A;  3PYB A;  1YJ4 A;  3LDW A;  3RMG A;  3EZ3 A;  3S9V A;  3WCM A;  4KQ5 A;  2F94 F;  1N22 A;  3WCH A;  4LA5 A;  4NG6 A;  4NUA A;  4LFE A;  3N3D A;  4LZ3 A;  4P0X A;  1WMW A;  3LOM A;  5DIQ F;  3KRP A;  4XQS F;  3DYH A;  4KVD A;  3LLW A;  5IVG A;  5IK6 A;  1YQ7 A;  3KB9 A;  3N49 F;  3VJC A;  2J1O A;  4GAX A;  2F7M F;  3WCJ A;  3OAC B;  3OYR A;  4RXC A;  4LLS A;  3VJ9 A;  4LFV F;  3ZL6 A;  4NKE A;  3N3L F;  5DJV F;  4RXA A;  2ZCQ A;  2PS7 A;  3CC9 A;  3G4D A;  2EWG A;  3S4J A;  3LG5 A;  3Q30 A;  4LIX A;  5B03 A;  3KRF B;  2VF6 A;  4N1Z F;  2PS8 A;  2J1P A;  1KIY A;  5JUZ F;  1V4E A;  4DEM F;  4JYX A;  4LOB A;  4RYP A;  4Q23 A;  3ZOU A;  4LPH F;  3VJA A;  2F8Z F;  2DH4 A;  3PYA A;  3ZMC A;  5B01 A;  5HNA A;  5EAS A;  1N20 A;  5KSX F;  3N5H F;  3AQC B;  3P8L A;  3TFP A;  3V66 A;  3WEK A;  3MAV A;  3DYF A;  1WL0 A;  4K10 A;  4PVX F;  4KFA A;  5ILK A;  4LTV A;  5IKA A;  4FJQ A;  5HN9 A;  3SDV A;  5AFX A;  4NKF A;  5E8H A;  5IK0 A;  4E9U A;  2E8U A;  2PS6 A;  1V4K A;  3P5R A;  5E8K A;  3V1V A;  4OKM A;  5AYP A;  1RQJ A;  5ILY A;  4KPD A;  4RXE A;  2I19 A;  4LZC A;  4KK2 A;  2E91 A;  3B7L A;  2AZK A;  5HN8 A;  2AZJ A;  4E9Z A;  5B0M A;  2Z7H A;  4LPG F;  5H9D A;  3KRA A;  3OAB A;  4DXJ A;  2E8V A;  1VG7 A;  1DGP A;  3N45 F;  3WCL A;  4JVJ F;  2E92 A;  1VG6 A;  4MC0 A;  4KKM A;  5DJR F;  3RBM A;  5AHU B;  3WCD A;  1HM7 A;  3N6K F;  3QKC A;  4EA0 A;  3WEI A;  1RQI A;  5ILH A;  4DWB A;  5E8L A;  4JXN A;  4LA6 A;  3ICM A;  2Z52 A;  5IMP A;  2Z7I A;  2E93 A;  4LXW A;  3WEJ A;  2RAH A;  3CP6 A;  5IMN A;  3NPR A;  3NPK A;  5IL8 A;  4NFJ F; 
#chains in the Genus database with same CATH topology
 1VG4 A;  5JV2 F;  2E94 A;  1WKZ A;  2AEL A;  4DHD A;  5DGM F;  4E1E A;  5A0K A;  3NF2 A;  1JFG A;  5DZ2 A;  3VJE A;  3ASX A;  2J5C A;  5B0L A;  3G4F A;  4H5D F;  3LGK A;  3EFQ A;  4DI5 A;  4KUX A;  1WL2 A;  3N46 F;  2AEK A;  3APZ A;  3DYG A;  3ID0 A;  5HN7 A;  3WE9 A;  5ILJ A;  3TC1 A;  4H5C F;  3Q1O A;  4H5E F;  4KVW A;  3N5J F;  3WEF A;  1JFA A;  3WC9 A;  2P1C A;  2O1O A;  5B02 A;  5CG6 A;  1HXG A;  2OPN A;  3KRA B;  3OAB B;  5IKH A;  2FOR A;  1YYQ A;  5ERO A;  2Z78 A;  5ERN A;  1N21 A;  4P0V A;  2ZY1 A;  2Z4V A;  5IMI A;  5B0J A;  4HD1 A;  4NFK F;  1YYR A;  3ICN A;  2Z4W A;  3P5P A;  3ICZ A;  1ZW5 A;  5JV1 F;  2Q9Z A;  3AQB B;  3WEH A;  1N24 A;  3M9U A;  4XQR F;  4OMH A;  3LEE A;  5DHK A;  3WCE A;  3KRP B;  2F9K F;  3ICK A;  4MC8 A;  4JXY A;  3TFV A;  4P0W A;  1UBX A;  2E8W A;  2Z4Z A;  1RTR A;  3WEG A;  3WCC A;  2H8O A;  4EA2 A;  4F62 A;  2ZEV A;  3P8R A;  1YYU A;  2E95 A;  3M02 A;  2Z50 A;  3LK5 A;  3VJD A;  3AQ0 A;  3QQV A;  4PVY F;  5DGN F;  3WCB A;  4QPF A;  3OAC A;  2Z4X A;  5JA0 F;  5JV0 F;  5B00 A;  5DHI A;  1YHK A;  4RNQ A;  3MZV A;  3N1V F;  3SAE A;  1YHL A;  4RXD A;  2E90 A;  2E8T A;  3EGT A;  4MC3 A;  3RYW A;  4GP2 A;  5IL3 A;  3PH7 A;  3IBA A;  3Q2Q A;  5EAU A;  4LTZ A;  1YV5 A;  2Q9Y A;  2ZCS A;  5A0J A;  2OGD A;  3LZ9 A;  4JZX A;  1HXA A;  2Q58 A;  3LJI A;  2E8X A;  2AZL A;  3CKE A;  4GP1 A;  4OMG A;  3KRC A;  5IK9 A;  5ILI A;  3W7F A;  1V4H A;  3KBK A;  1N1Z A;  5CG5 A;  5ILZ A;  1V4I A;  1UBW A;  4FP4 A;  3WSB A;  1DI1 A;  3LVS A;  3ZCD A;  1V4J A;  3SDU A;  2F89 F;  5ER8 A;  4OKZ A;  3M00 A;  4LZ0 A;  5IM1 A;  4KQS A;  2Q80 A;  3BNY A;  4L2X F;  3AE0 A;  3V1X A;  3WCF A;  2OA6 A;  4EA1 A;  3SDT A;  5A0I A;  1HXC A;  3Q2Z A;  1N1B A;  3PDE A;  3SDR A;  4ZQ8 A;  5DJP F;  2ZCO A;  3VJB A;  5B0K A;  4WK5 A;  4LUU A;  5ILD A;  2ONH A;  2PS5 A;  4LLT A;  5I1U A;  2PS4 A;  4XQT F;  1VG2 A;  2AET A;  5ERM A;  1HX9 A;  3WJK A;  3N1W F;  1KIZ A;  3IPI A;  4KWD A;  5C05 A;  3KRO A;  3ZMB A;  4F6X A;  3SDQ A;  1EZF A;  3KRC B;  3WJO A;  1YYT A;  1UBV A;  5EAT A;  4DWG A;  2ONG A;  3ADZ A;  3WJN A;  2F92 F;  3N0G A;  3M01 A;  3ACY A;  3WCI A;  4KPJ A;  1WL1 A;  4KVY A;  4DZW A;  3BNX A;  3RYE A;  2F8C F;  4N9U A;  1N23 A;  4OGU A;  2OPM A;  3VJ8 A;  1WY0 A;  3LSN A;  1YHM A;  4QXS F;  5IN8 A;  1FPS A;  4KQU A;  4LFG A;  3TS7 A;  4GA3 A;  3TFN A;  4KVI A;  3ACX A;  3WCG A;  1WL3 A;  3LMD A;  3WSA A;  1YYS A;  3NRI A;  4JZB A;  1PS1 A;  1VG3 A;  2QIS A;  3KRF A;  5DW7 A;  3PKO A;  3P41 A;  2ZEU A;  4NFI F;  2Z4Y A;  2FTZ A;  4UMJ A;  2E4O A;  3N0F A;  1HM4 A;  3WCA A;  3LGZ B;  3M0G A;  2ZCR A;  4F6V A;  1UBY A;  3KRO B;  5DGS F;  5B0I A;  3ACW A;  5AEL A;  3UCA A;  3PYB A;  1YJ4 A;  3LDW A;  3RMG A;  3EZ3 A;  3S9V A;  3WCM A;  4KQ5 A;  2F94 F;  1N22 A;  3WCH A;  4LA5 A;  4NG6 A;  4NUA A;  4LFE A;  3N3D A;  4LZ3 A;  4P0X A;  1WMW A;  3LOM A;  5DIQ F;  3KRP A;  4XQS F;  3DYH A;  4KVD A;  3LLW A;  5IVG A;  5IK6 A;  1YQ7 A;  3KB9 A;  3N49 F;  3VJC A;  2J1O A;  4GAX A;  2F7M F;  3WCJ A;  3OAC B;  3OYR A;  4RXC A;  4LLS A;  3VJ9 A;  4LFV F;  3ZL6 A;  4NKE A;  3N3L F;  5DJV F;  4RXA A;  2ZCQ A;  2PS7 A;  3CC9 A;  3G4D A;  2EWG A;  3S4J A;  3LG5 A;  3Q30 A;  4LIX A;  5B03 A;  3KRF B;  2VF6 A;  4N1Z F;  2PS8 A;  2J1P A;  1KIY A;  5JUZ F;  1V4E A;  4DEM F;  4JYX A;  4LOB A;  4RYP A;  4Q23 A;  3ZOU A;  4LPH F;  3VJA A;  2F8Z F;  2DH4 A;  3PYA A;  3ZMC A;  5B01 A;  5HNA A;  5EAS A;  1N20 A;  5KSX F;  3N5H F;  3AQC B;  3P8L A;  3TFP A;  3V66 A;  3WEK A;  3MAV A;  3DYF A;  1WL0 A;  4K10 A;  4PVX F;  4KFA A;  5ILK A;  4LTV A;  5IKA A;  4FJQ A;  5HN9 A;  3SDV A;  5AFX A;  4NKF A;  5E8H A;  5IK0 A;  4E9U A;  2E8U A;  2PS6 A;  1V4K A;  3P5R A;  5E8K A;  3V1V A;  4OKM A;  5AYP A;  1RQJ A;  5ILY A;  4KPD A;  4RXE A;  2I19 A;  4LZC A;  4KK2 A;  2E91 A;  3B7L A;  2AZK A;  5HN8 A;  2AZJ A;  4E9Z A;  5B0M A;  2Z7H A;  4LPG F;  5H9D A;  3KRA A;  3OAB A;  4DXJ A;  2E8V A;  1VG7 A;  1DGP A;  3N45 F;  3WCL A;  4JVJ F;  2E92 A;  1VG6 A;  4MC0 A;  4KKM A;  5DJR F;  3RBM A;  5AHU B;  3WCD A;  1HM7 A;  3N6K F;  3QKC A;  4EA0 A;  3WEI A;  1RQI A;  5ILH A;  4DWB A;  5E8L A;  4JXN A;  4LA6 A;  3ICM A;  2Z52 A;  5IMP A;  2Z7I A;  2E93 A;  4LXW A;  3WEJ A;  2RAH A;  3CP6 A;  5IMN A;  3NPR A;  3NPK A;  5IL8 A;  4NFJ F; 
#chains in the Genus database with same CATH homology
 1VG4 A;  5JV2 F;  2E94 A;  1WKZ A;  2AEL A;  4DHD A;  5DGM F;  4E1E A;  5A0K A;  3NF2 A;  1JFG A;  5DZ2 A;  3VJE A;  3ASX A;  2J5C A;  5B0L A;  3G4F A;  4H5D F;  3LGK A;  3EFQ A;  4DI5 A;  4KUX A;  1WL2 A;  3N46 F;  2AEK A;  3APZ A;  3DYG A;  3ID0 A;  5HN7 A;  3WE9 A;  5ILJ A;  3TC1 A;  4H5C F;  3Q1O A;  4H5E F;  4KVW A;  3N5J F;  3WEF A;  1JFA A;  3WC9 A;  2P1C A;  2O1O A;  5B02 A;  5CG6 A;  1HXG A;  2OPN A;  3KRA B;  3OAB B;  5IKH A;  2FOR A;  1YYQ A;  5ERO A;  2Z78 A;  5ERN A;  1N21 A;  4P0V A;  2ZY1 A;  2Z4V A;  5IMI A;  5B0J A;  4HD1 A;  4NFK F;  1YYR A;  3ICN A;  2Z4W A;  3P5P A;  3ICZ A;  1ZW5 A;  5JV1 F;  2Q9Z A;  3AQB B;  3WEH A;  1N24 A;  3M9U A;  4XQR F;  4OMH A;  3LEE A;  5DHK A;  3WCE A;  3KRP B;  2F9K F;  3ICK A;  4MC8 A;  4JXY A;  3TFV A;  4P0W A;  1UBX A;  2E8W A;  2Z4Z A;  1RTR A;  3WEG A;  3WCC A;  2H8O A;  4EA2 A;  4F62 A;  2ZEV A;  3P8R A;  1YYU A;  2E95 A;  3M02 A;  2Z50 A;  3LK5 A;  3VJD A;  3AQ0 A;  3QQV A;  4PVY F;  5DGN F;  3WCB A;  4QPF A;  3OAC A;  2Z4X A;  5JA0 F;  5JV0 F;  5B00 A;  5DHI A;  1YHK A;  4RNQ A;  3MZV A;  3N1V F;  3SAE A;  1YHL A;  4RXD A;  2E90 A;  2E8T A;  3EGT A;  4MC3 A;  3RYW A;  4GP2 A;  5IL3 A;  3PH7 A;  3IBA A;  3Q2Q A;  5EAU A;  4LTZ A;  1YV5 A;  2Q9Y A;  2ZCS A;  5A0J A;  2OGD A;  3LZ9 A;  4JZX A;  1HXA A;  2Q58 A;  3LJI A;  2E8X A;  2AZL A;  3CKE A;  4GP1 A;  4OMG A;  3KRC A;  5IK9 A;  5ILI A;  3W7F A;  1V4H A;  3KBK A;  1N1Z A;  5CG5 A;  5ILZ A;  1V4I A;  1UBW A;  4FP4 A;  3WSB A;  1DI1 A;  3LVS A;  3ZCD A;  1V4J A;  3SDU A;  2F89 F;  5ER8 A;  4OKZ A;  3M00 A;  4LZ0 A;  5IM1 A;  4KQS A;  2Q80 A;  3BNY A;  4L2X F;  3AE0 A;  3V1X A;  3WCF A;  2OA6 A;  4EA1 A;  3SDT A;  5A0I A;  1HXC A;  3Q2Z A;  1N1B A;  3PDE A;  3SDR A;  4ZQ8 A;  5DJP F;  2ZCO A;  3VJB A;  5B0K A;  4WK5 A;  4LUU A;  5ILD A;  2ONH A;  2PS5 A;  4LLT A;  5I1U A;  2PS4 A;  4XQT F;  1VG2 A;  2AET A;  5ERM A;  1HX9 A;  3WJK A;  3N1W F;  1KIZ A;  3IPI A;  4KWD A;  5C05 A;  3KRO A;  3ZMB A;  4F6X A;  3SDQ A;  1EZF A;  3KRC B;  3WJO A;  1YYT A;  1UBV A;  5EAT A;  4DWG A;  2ONG A;  3ADZ A;  3WJN A;  2F92 F;  3N0G A;  3M01 A;  3ACY A;  3WCI A;  4KPJ A;  1WL1 A;  4KVY A;  4DZW A;  3BNX A;  3RYE A;  2F8C F;  4N9U A;  1N23 A;  4OGU A;  2OPM A;  3VJ8 A;  1WY0 A;  3LSN A;  1YHM A;  4QXS F;  5IN8 A;  1FPS A;  4KQU A;  4LFG A;  3TS7 A;  4GA3 A;  3TFN A;  4KVI A;  3ACX A;  3WCG A;  1WL3 A;  3LMD A;  3WSA A;  1YYS A;  3NRI A;  4JZB A;  1PS1 A;  1VG3 A;  2QIS A;  3KRF A;  5DW7 A;  3PKO A;  3P41 A;  2ZEU A;  4NFI F;  2Z4Y A;  2FTZ A;  4UMJ A;  2E4O A;  3N0F A;  1HM4 A;  3WCA A;  3LGZ B;  3M0G A;  2ZCR A;  4F6V A;  1UBY A;  3KRO B;  5DGS F;  5B0I A;  3ACW A;  5AEL A;  3UCA A;  3PYB A;  1YJ4 A;  3LDW A;  3RMG A;  3EZ3 A;  3S9V A;  3WCM A;  4KQ5 A;  2F94 F;  1N22 A;  3WCH A;  4LA5 A;  4NG6 A;  4NUA A;  4LFE A;  3N3D A;  4LZ3 A;  4P0X A;  1WMW A;  3LOM A;  5DIQ F;  3KRP A;  4XQS F;  3DYH A;  4KVD A;  3LLW A;  5IVG A;  5IK6 A;  1YQ7 A;  3KB9 A;  3N49 F;  3VJC A;  2J1O A;  4GAX A;  2F7M F;  3WCJ A;  3OAC B;  3OYR A;  4RXC A;  4LLS A;  3VJ9 A;  4LFV F;  3ZL6 A;  4NKE A;  3N3L F;  5DJV F;  4RXA A;  2ZCQ A;  2PS7 A;  3CC9 A;  3G4D A;  2EWG A;  3S4J A;  3LG5 A;  3Q30 A;  4LIX A;  5B03 A;  3KRF B;  2VF6 A;  4N1Z F;  2PS8 A;  2J1P A;  1KIY A;  5JUZ F;  1V4E A;  4DEM F;  4JYX A;  4LOB A;  4RYP A;  4Q23 A;  3ZOU A;  4LPH F;  3VJA A;  2F8Z F;  2DH4 A;  3PYA A;  3ZMC A;  5B01 A;  5HNA A;  5EAS A;  1N20 A;  5KSX F;  3N5H F;  3AQC B;  3P8L A;  3TFP A;  3V66 A;  3WEK A;  3MAV A;  3DYF A;  1WL0 A;  4K10 A;  4PVX F;  4KFA A;  5ILK A;  4LTV A;  5IKA A;  4FJQ A;  5HN9 A;  3SDV A;  5AFX A;  4NKF A;  5E8H A;  5IK0 A;  4E9U A;  2E8U A;  2PS6 A;  1V4K A;  3P5R A;  5E8K A;  3V1V A;  4OKM A;  5AYP A;  1RQJ A;  5ILY A;  4KPD A;  4RXE A;  2I19 A;  4LZC A;  4KK2 A;  2E91 A;  3B7L A;  2AZK A;  5HN8 A;  2AZJ A;  4E9Z A;  5B0M A;  2Z7H A;  4LPG F;  5H9D A;  3KRA A;  3OAB A;  4DXJ A;  2E8V A;  1VG7 A;  1DGP A;  3N45 F;  3WCL A;  4JVJ F;  2E92 A;  1VG6 A;  4MC0 A;  4KKM A;  5DJR F;  3RBM A;  5AHU B;  3WCD A;  1HM7 A;  3N6K F;  3QKC A;  4EA0 A;  3WEI A;  1RQI A;  5ILH A;  4DWB A;  5E8L A;  4JXN A;  4LA6 A;  3ICM A;  2Z52 A;  5IMP A;  2Z7I A;  2E93 A;  4LXW A;  3WEJ A;  2RAH A;  3CP6 A;  5IMN A;  3NPR A;  3NPK A;  5IL8 A;  4NFJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...