4E9ZA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with quinuclidine bph-651 in the s1 site
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 118
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4e9zA00
1UBXA 1N24A 1V4EA 1VG7A 4UMJA 5HN8A 1V4HA 1WY0A 5EATA 1YYRA 5JUZF 5ILHA 4H5DF 3SDVA 5IMPA 1HX9A 3ASXA 3WCCA 4DEMF 4E1EA 5A0IA 5HN9A 1FPSA 3WCJA 5B0MA 4P0VA 3SDTA 3N45F 4XQRF 3KRFB 4EA0A 3KROA 3QKCA 3ADZA 1JFGA 3P5PA 4GAXA 1YYQA 5EROA 2Z7HA 1JFAA 2E8VA 3LJIA 3SDQA 2Z7IA 2QISA 2F7MF 3OYRA 4QXSF 4PVYF 4NFKF 1V4JA 1WL3A 4NFJF 2AELA 3WC9A 3AE0A 1RQIA 3WJNA 5C05A 3ID0A 4KQUA 5AELA 4F6XA 3ACXA 4RNQA 3PYAA 1YHKA 3KRAB 5DHKA 5HNAA 3S9VA 5AYPA 3N49F 5DJPF 3QQVA 1VG2A 3ICMA 3LEEA 2PS8A 3PKOA 3WCAA 5ILDA 2J5CA 3LOMA 3M02A 5I1UA 4JVJF 3VJ9A 5B00A 5DIQF 4OMHA 3RBMA 5JV0F 3ACWA 5IL8A 2J1OA 3LGKA 5H9DA 3OABB 4DZWA 5E8KA 2E95A 3KRFA 5IK9A 3WSAA 4KVWA 3AQCB 3N1VF 2E94A 1HXGA 3ZL6A 4N1ZF 3KRCB 3LVSA 4DWGA 1N1BA 2E8TA 3SAEA 4P0WA 3KRPB 3LSNA 4DI5A 3MAVA 2Z78A 4KKMA 4DWBA 3WE9A 1YYSA 5ILYA 2RAHA 3WCFA 2Q80A 1VG3A 2I19A 3ICKA 3ICZA 2OGDA 4LLTA 4LIXA 3UCAA 4LTVA 5ILJA 4F62A 3KRAA 2ZCOA 3WEGA 3V1XA 1N20A 2Z4WA 5E8LA 3TFNA 3AQ0A 5DGSF 4LLSA 2ZEVA 4NG6A 4HD1A 3ZMCA 4P0XA 5ER8A 5CG6A 1N22A 1WMWA 4LOBA 3WCEA 1RQJA 2DH4A 3TC1A 3WCBA 2F94F 1RTRA 2AZJA 4KK2A 3OABA 2J1PA 4LA6A 3LLWA 3N6KF 3N1WF 3WCMA 5IK0A 3ZCDA 3V66A 4DHDA 3KRCA 1YJ4A 5B02A 1HM7A 1HXAA 4H5EF 3KRPA 5DJVF 1VG6A 2OPMA 4KUXA 1V4IA 3WSBA 2E91A 5B0LA 4JYXA 1UBVA 3N3LF 2O1OA 3LGZB 3M9UA 1YQ7A 3N3DA 2Z50A 2H8OA 1ZW5A 4FP4A 4GP2A 1WL0A 2AEKA 5HN7A 3ACYA 3Q2ZA 5IVGA 4E9ZA 3N46F 5DJRF 1V4KA 3WEHA 3CC9A 5IMNA 3WEFA 1KIYA 3RYEA 4KVYA 3VJAA 2PS4A 2Z4XA 2E90A 3S4JA 1WL2A 4WK5A 4QPFA 5AHUB 3CKEA 2ZEUA 4JZXA 3PDEA 3M0GA 2EWGA 3PYBA 3LZ9A 5JV1F 4KWDA 4PVXF 5KSXF 3G4FA 4RXEA 1N21A 3ZMBA 3NPRA 2F8CF 2PS6A 1KIZA 4RYPA 2Q9YA 2PS5A 1DGPA 3M01A 3ICNA 5EASA 1UBYA 2E4OA 3BNXA 3RMGA 4LFGA 3G4DA 5ERNA 4GA3A 3CP6A 4K10A 3LDWA 3W7FA 2E8XA 3WEKA 4OKMA 2Q58A 2Z4ZA 5EAUA 5DGNF 2ONHA 3RYWA 3WCHA 3DYGA 3WJKA 3OACB 4LXWA 3LK5A 3AQBB 3PH7A 2P1CA 3IBAA 4LZ0A 4Q23A 3KB9A 2PS7A 4XQSF 3NRIA 4LZ3A 4MC0A 5IK6A 3Q1OA 4RXAA 5B03A 2ONGA 4LFVF 3TFVA 2F9KF 3WCGA 1HXCA 1YYUA 5IL3A 3WEIA 1YHMA 3NPKA 4LUUA 5IMIA 3LMDA 4MC8A 4KPJA 5ILZA 5DGMF 1YYTA 4FJQA 3TFPA 3KBKA 2Z4VA 3M00A 4F6VA 5ERMA 3VJDA 4NFIF 5DHIA 4GP1A 4NUAA 4E9UA 4ZQ8A 5ILIA 2Z4YA 2AETA 4JZBA 2E92A 4MC3A 5IN8A 4DXJA 4LPGF 3P8RA 3IPIA 4JXNA 2AZKA 4KFAA 2E8WA 4RXDA 2AZLA 3Q30A 2E8UA 3N5JF 1YV5A 4LA5A 5A0JA 1DI1A 1PS1A 4KVDA 3OACA 3WCLA 4OKZA 4EA2A 5B0KA 4OMGA 5JV2F 5B01A 3N0GA 1N1ZA 3P5RA 4KQSA 1UBWA 3V1VA 1EZFA 4LTZA 5DW7A 3NF2A 3BNYA 3DYFA 3APZA 5IKHA 1N23A 5E8HA 2F89F 2ZCQA 4XQTF 4KVIA 4JXYA 2Q9ZA 1YHLA 4LFEA 5DZ2A 5IM1A 5B0IA 4EA1A 3EGTA 3VJ8A 1WKZA 3VJBA 4LZCA 2F8ZF 4L2XF 3SDUA 3SDRA 2FORA 4N9UA 2ZCSA 3DYHA 3WCDA 2OA6A 3LG5A 1HM4A 3KROB 5IKAA 3B7LA 1WL1A 4H5CF 4LPHF 3P41A 5ILKA 2Z52A 3WCIA 3VJCA 3N5HF 4KQ5A 3Q2QA 5A0KA 2F92F 4NKFA 5AFXA 5CG5A 3P8LA 3ZOUA 3WJOA 3VJEA 4OGUA 2E93A 3MZVA 5B0JA 4RXCA 4KPDA 3EFQA 1VG4A 4NKEA 5JA0F 2ZCRA 2ZY1A 3EZ3A 3N0FA 3WEJA 2OPNA 2VF6A 3TS7A 2FTZA
chains in the Genus database with same CATH superfamily
1UBXA 1N24A 1V4EA 1VG7A 4UMJA 5HN8A 1V4HA 1WY0A 5EATA 1YYRA 5JUZF 5ILHA 4H5DF 3SDVA 5IMPA 1HX9A 3ASXA 3WCCA 4DEMF 4E1EA 5A0IA 5HN9A 1FPSA 3WCJA 5B0MA 4P0VA 3SDTA 3N45F 4XQRF 3KRFB 4EA0A 3KROA 3QKCA 3ADZA 1JFGA 3P5PA 4GAXA 1YYQA 5EROA 2Z7HA 1JFAA 2E8VA 3LJIA 3SDQA 2Z7IA 2QISA 2F7MF 3OYRA 4QXSF 4PVYF 4NFKF 1V4JA 1WL3A 4NFJF 2AELA 3WC9A 3AE0A 1RQIA 3WJNA 5C05A 3ID0A 4KQUA 5AELA 4F6XA 3ACXA 4RNQA 3PYAA 1YHKA 3KRAB 5DHKA 5HNAA 3S9VA 5AYPA 3N49F 5DJPF 3QQVA 1VG2A 3ICMA 3LEEA 2PS8A 3PKOA 3WCAA 5ILDA 2J5CA 3LOMA 3M02A 5I1UA 4JVJF 3VJ9A 5B00A 5DIQF 4OMHA 3RBMA 5JV0F 3ACWA 5IL8A 2J1OA 3LGKA 5H9DA 3OABB 4DZWA 5E8KA 2E95A 3KRFA 5IK9A 3WSAA 4KVWA 3AQCB 3N1VF 2E94A 1HXGA 3ZL6A 4N1ZF 3KRCB 3LVSA 4DWGA 1N1BA 2E8TA 3SAEA 4P0WA 3KRPB 3LSNA 4DI5A 3MAVA 2Z78A 4KKMA 4DWBA 3WE9A 1YYSA 5ILYA 2RAHA 3WCFA 2Q80A 1VG3A 2I19A 3ICKA 3ICZA 2OGDA 4LLTA 4LIXA 3UCAA 4LTVA 5ILJA 4F62A 3KRAA 2ZCOA 3WEGA 3V1XA 1N20A 2Z4WA 5E8LA 3TFNA 3AQ0A 5DGSF 4LLSA 2ZEVA 4NG6A 4HD1A 3ZMCA 4P0XA 5ER8A 5CG6A 1N22A 1WMWA 4LOBA 3WCEA 1RQJA 2DH4A 3TC1A 3WCBA 2F94F 1RTRA 2AZJA 4KK2A 3OABA 2J1PA 4LA6A 3LLWA 3N6KF 3N1WF 3WCMA 5IK0A 3ZCDA 3V66A 4DHDA 3KRCA 1YJ4A 5B02A 1HM7A 1HXAA 4H5EF 3KRPA 5DJVF 1VG6A 2OPMA 4KUXA 1V4IA 3WSBA 2E91A 5B0LA 4JYXA 1UBVA 3N3LF 2O1OA 3LGZB 3M9UA 1YQ7A 3N3DA 2Z50A 2H8OA 1ZW5A 4FP4A 4GP2A 1WL0A 2AEKA 5HN7A 3ACYA 3Q2ZA 5IVGA 4E9ZA 3N46F 5DJRF 1V4KA 3WEHA 3CC9A 5IMNA 3WEFA 1KIYA 3RYEA 4KVYA 3VJAA 2PS4A 2Z4XA 2E90A 3S4JA 1WL2A 4WK5A 4QPFA 5AHUB 3CKEA 2ZEUA 4JZXA 3PDEA 3M0GA 2EWGA 3PYBA 3LZ9A 5JV1F 4KWDA 4PVXF 5KSXF 3G4FA 4RXEA 1N21A 3ZMBA 3NPRA 2F8CF 2PS6A 1KIZA 4RYPA 2Q9YA 2PS5A 1DGPA 3M01A 3ICNA 5EASA 1UBYA 2E4OA 3BNXA 3RMGA 4LFGA 3G4DA 5ERNA 4GA3A 3CP6A 4K10A 3LDWA 3W7FA 2E8XA 3WEKA 4OKMA 2Q58A 2Z4ZA 5EAUA 5DGNF 2ONHA 3RYWA 3WCHA 3DYGA 3WJKA 3OACB 4LXWA 3LK5A 3AQBB 3PH7A 2P1CA 3IBAA 4LZ0A 4Q23A 3KB9A 2PS7A 4XQSF 3NRIA 4LZ3A 4MC0A 5IK6A 3Q1OA 4RXAA 5B03A 2ONGA 4LFVF 3TFVA 2F9KF 3WCGA 1HXCA 1YYUA 5IL3A 3WEIA 1YHMA 3NPKA 4LUUA 5IMIA 3LMDA 4MC8A 4KPJA 5ILZA 5DGMF 1YYTA 4FJQA 3TFPA 3KBKA 2Z4VA 3M00A 4F6VA 5ERMA 3VJDA 4NFIF 5DHIA 4GP1A 4NUAA 4E9UA 4ZQ8A 5ILIA 2Z4YA 2AETA 4JZBA 2E92A 4MC3A 5IN8A 4DXJA 4LPGF 3P8RA 3IPIA 4JXNA 2AZKA 4KFAA 2E8WA 4RXDA 2AZLA 3Q30A 2E8UA 3N5JF 1YV5A 4LA5A 5A0JA 1DI1A 1PS1A 4KVDA 3OACA 3WCLA 4OKZA 4EA2A 5B0KA 4OMGA 5JV2F 5B01A 3N0GA 1N1ZA 3P5RA 4KQSA 1UBWA 3V1VA 1EZFA 4LTZA 5DW7A 3NF2A 3BNYA 3DYFA 3APZA 5IKHA 1N23A 5E8HA 2F89F 2ZCQA 4XQTF 4KVIA 4JXYA 2Q9ZA 1YHLA 4LFEA 5DZ2A 5IM1A 5B0IA 4EA1A 3EGTA 3VJ8A 1WKZA 3VJBA 4LZCA 2F8ZF 4L2XF 3SDUA 3SDRA 2FORA 4N9UA 2ZCSA 3DYHA 3WCDA 2OA6A 3LG5A 1HM4A 3KROB 5IKAA 3B7LA 1WL1A 4H5CF 4LPHF 3P41A 5ILKA 2Z52A 3WCIA 3VJCA 3N5HF 4KQ5A 3Q2QA 5A0KA 2F92F 4NKFA 5AFXA 5CG5A 3P8LA 3ZOUA 3WJOA 3VJEA 4OGUA 2E93A 3MZVA 5B0JA 4RXCA 4KPDA 3EFQA 1VG4A 4NKEA 5JA0F 2ZCRA 2ZY1A 3EZ3A 3N0FA 3WEJA 2OPNA 2VF6A 3TS7A 2FTZA
chains in the Genus database with same CATH topology
1UBXA 1N24A 1V4EA 1VG7A 4UMJA 5HN8A 1V4HA 1WY0A 5EATA 1YYRA 5JUZF 5ILHA 4H5DF 3SDVA 5IMPA 1HX9A 3ASXA 3WCCA 4DEMF 4E1EA 5A0IA 5HN9A 1FPSA 3WCJA 5B0MA 4P0VA 3SDTA 3N45F 4XQRF 3KRFB 4EA0A 3KROA 3QKCA 3ADZA 1JFGA 3P5PA 4GAXA 1YYQA 5EROA 2Z7HA 1JFAA 2E8VA 3LJIA 3SDQA 2Z7IA 2QISA 2F7MF 3OYRA 4QXSF 4PVYF 4NFKF 1V4JA 1WL3A 4NFJF 2AELA 3WC9A 3AE0A 1RQIA 3WJNA 5C05A 3ID0A 4KQUA 5AELA 4F6XA 3ACXA 4RNQA 3PYAA 1YHKA 3KRAB 5DHKA 5HNAA 3S9VA 5AYPA 3N49F 5DJPF 3QQVA 1VG2A 3ICMA 3LEEA 2PS8A 3PKOA 3WCAA 5ILDA 2J5CA 3LOMA 3M02A 5I1UA 4JVJF 3VJ9A 5B00A 5DIQF 4OMHA 3RBMA 5JV0F 3ACWA 5IL8A 2J1OA 3LGKA 5H9DA 3OABB 4DZWA 5E8KA 2E95A 3KRFA 5IK9A 3WSAA 4KVWA 3AQCB 3N1VF 2E94A 1HXGA 3ZL6A 4N1ZF 3KRCB 3LVSA 4DWGA 1N1BA 2E8TA 3SAEA 4P0WA 3KRPB 3LSNA 4DI5A 3MAVA 2Z78A 4KKMA 4DWBA 3WE9A 1YYSA 5ILYA 2RAHA 3WCFA 2Q80A 1VG3A 2I19A 3ICKA 3ICZA 2OGDA 4LLTA 4LIXA 3UCAA 4LTVA 5ILJA 4F62A 3KRAA 2ZCOA 3WEGA 3V1XA 1N20A 2Z4WA 5E8LA 3TFNA 3AQ0A 5DGSF 4LLSA 2ZEVA 4NG6A 4HD1A 3ZMCA 4P0XA 5ER8A 5CG6A 1N22A 1WMWA 4LOBA 3WCEA 1RQJA 2DH4A 3TC1A 3WCBA 2F94F 1RTRA 2AZJA 4KK2A 3OABA 2J1PA 4LA6A 3LLWA 3N6KF 3N1WF 3WCMA 5IK0A 3ZCDA 3V66A 4DHDA 3KRCA 1YJ4A 5B02A 1HM7A 1HXAA 4H5EF 3KRPA 5DJVF 1VG6A 2OPMA 4KUXA 1V4IA 3WSBA 2E91A 5B0LA 4JYXA 1UBVA 3N3LF 2O1OA 3LGZB 3M9UA 1YQ7A 3N3DA 2Z50A 2H8OA 1ZW5A 4FP4A 4GP2A 1WL0A 2AEKA 5HN7A 3ACYA 3Q2ZA 5IVGA 4E9ZA 3N46F 5DJRF 1V4KA 3WEHA 3CC9A 5IMNA 3WEFA 1KIYA 3RYEA 4KVYA 3VJAA 2PS4A 2Z4XA 2E90A 3S4JA 1WL2A 4WK5A 4QPFA 5AHUB 3CKEA 2ZEUA 4JZXA 3PDEA 3M0GA 2EWGA 3PYBA 3LZ9A 5JV1F 4KWDA 4PVXF 5KSXF 3G4FA 4RXEA 1N21A 3ZMBA 3NPRA 2F8CF 2PS6A 1KIZA 4RYPA 2Q9YA 2PS5A 1DGPA 3M01A 3ICNA 5EASA 1UBYA 2E4OA 3BNXA 3RMGA 4LFGA 3G4DA 5ERNA 4GA3A 3CP6A 4K10A 3LDWA 3W7FA 2E8XA 3WEKA 4OKMA 2Q58A 2Z4ZA 5EAUA 5DGNF 2ONHA 3RYWA 3WCHA 3DYGA 3WJKA 3OACB 4LXWA 3LK5A 3AQBB 3PH7A 2P1CA 3IBAA 4LZ0A 4Q23A 3KB9A 2PS7A 4XQSF 3NRIA 4LZ3A 4MC0A 5IK6A 3Q1OA 4RXAA 5B03A 2ONGA 4LFVF 3TFVA 2F9KF 3WCGA 1HXCA 1YYUA 5IL3A 3WEIA 1YHMA 3NPKA 4LUUA 5IMIA 3LMDA 4MC8A 4KPJA 5ILZA 5DGMF 1YYTA 4FJQA 3TFPA 3KBKA 2Z4VA 3M00A 4F6VA 5ERMA 3VJDA 4NFIF 5DHIA 4GP1A 4NUAA 4E9UA 4ZQ8A 5ILIA 2Z4YA 2AETA 4JZBA 2E92A 4MC3A 5IN8A 4DXJA 4LPGF 3P8RA 3IPIA 4JXNA 2AZKA 4KFAA 2E8WA 4RXDA 2AZLA 3Q30A 2E8UA 3N5JF 1YV5A 4LA5A 5A0JA 1DI1A 1PS1A 4KVDA 3OACA 3WCLA 4OKZA 4EA2A 5B0KA 4OMGA 5JV2F 5B01A 3N0GA 1N1ZA 3P5RA 4KQSA 1UBWA 3V1VA 1EZFA 4LTZA 5DW7A 3NF2A 3BNYA 3DYFA 3APZA 5IKHA 1N23A 5E8HA 2F89F 2ZCQA 4XQTF 4KVIA 4JXYA 2Q9ZA 1YHLA 4LFEA 5DZ2A 5IM1A 5B0IA 4EA1A 3EGTA 3VJ8A 1WKZA 3VJBA 4LZCA 2F8ZF 4L2XF 3SDUA 3SDRA 2FORA 4N9UA 2ZCSA 3DYHA 3WCDA 2OA6A 3LG5A 1HM4A 3KROB 5IKAA 3B7LA 1WL1A 4H5CF 4LPHF 3P41A 5ILKA 2Z52A 3WCIA 3VJCA 3N5HF 4KQ5A 3Q2QA 5A0KA 2F92F 4NKFA 5AFXA 5CG5A 3P8LA 3ZOUA 3WJOA 3VJEA 4OGUA 2E93A 3MZVA 5B0JA 4RXCA 4KPDA 3EFQA 1VG4A 4NKEA 5JA0F 2ZCRA 2ZY1A 3EZ3A 3N0FA 3WEJA 2OPNA 2VF6A 3TS7A 2FTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UBX A;  1N24 A;  1V4E A;  1VG7 A;  4UMJ A;  5HN8 A;  1V4H A;  1WY0 A;  5EAT A;  1YYR A;  5JUZ F;  5ILH A;  4H5D F;  3SDV A;  5IMP A;  1HX9 A;  3ASX A;  3WCC A;  4DEM F;  4E1E A;  5A0I A;  5HN9 A;  1FPS A;  3WCJ A;  5B0M A;  4P0V A;  3SDT A;  3N45 F;  4XQR F;  3KRF B;  4EA0 A;  3KRO A;  3QKC A;  3ADZ A;  1JFG A;  3P5P A;  4GAX A;  1YYQ A;  5ERO A;  2Z7H A;  1JFA A;  2E8V A;  3LJI A;  3SDQ A;  2Z7I A;  2QIS A;  2F7M F;  3OYR A;  4QXS F;  4PVY F;  4NFK F;  1V4J A;  1WL3 A;  4NFJ F;  2AEL A;  3WC9 A;  3AE0 A;  1RQI A;  3WJN A;  5C05 A;  3ID0 A;  4KQU A;  5AEL A;  4F6X A;  3ACX A;  4RNQ A;  3PYA A;  1YHK A;  3KRA B;  5DHK A;  5HNA A;  3S9V A;  5AYP A;  3N49 F;  5DJP F;  3QQV A;  1VG2 A;  3ICM A;  3LEE A;  2PS8 A;  3PKO A;  3WCA A;  5ILD A;  2J5C A;  3LOM A;  3M02 A;  5I1U A;  4JVJ F;  3VJ9 A;  5B00 A;  5DIQ F;  4OMH A;  3RBM A;  5JV0 F;  3ACW A;  5IL8 A;  2J1O A;  3LGK A;  5H9D A;  3OAB B;  4DZW A;  5E8K A;  2E95 A;  3KRF A;  5IK9 A;  3WSA A;  4KVW A;  3AQC B;  3N1V F;  2E94 A;  1HXG A;  3ZL6 A;  4N1Z F;  3KRC B;  3LVS A;  4DWG A;  1N1B A;  2E8T A;  3SAE A;  4P0W A;  3KRP B;  3LSN A;  4DI5 A;  3MAV A;  2Z78 A;  4KKM A;  4DWB A;  3WE9 A;  1YYS A;  5ILY A;  2RAH A;  3WCF A;  2Q80 A;  1VG3 A;  2I19 A;  3ICK A;  3ICZ A;  2OGD A;  4LLT A;  4LIX A;  3UCA A;  4LTV A;  5ILJ A;  4F62 A;  3KRA A;  2ZCO A;  3WEG A;  3V1X A;  1N20 A;  2Z4W A;  5E8L A;  3TFN A;  3AQ0 A;  5DGS F;  4LLS A;  2ZEV A;  4NG6 A;  4HD1 A;  3ZMC A;  4P0X A;  5ER8 A;  5CG6 A;  1N22 A;  1WMW A;  4LOB A;  3WCE A;  1RQJ A;  2DH4 A;  3TC1 A;  3WCB A;  2F94 F;  1RTR A;  2AZJ A;  4KK2 A;  3OAB A;  2J1P A;  4LA6 A;  3LLW A;  3N6K F;  3N1W F;  3WCM A;  5IK0 A;  3ZCD A;  3V66 A;  4DHD A;  3KRC A;  1YJ4 A;  5B02 A;  1HM7 A;  1HXA A;  4H5E F;  3KRP A;  5DJV F;  1VG6 A;  2OPM A;  4KUX A;  1V4I A;  3WSB A;  2E91 A;  5B0L A;  4JYX A;  1UBV A;  3N3L F;  2O1O A;  3LGZ B;  3M9U A;  1YQ7 A;  3N3D A;  2Z50 A;  2H8O A;  1ZW5 A;  4FP4 A;  4GP2 A;  1WL0 A;  2AEK A;  5HN7 A;  3ACY A;  3Q2Z A;  5IVG A;  4E9Z A;  3N46 F;  5DJR F;  1V4K A;  3WEH A;  3CC9 A;  5IMN A;  3WEF A;  1KIY A;  3RYE A;  4KVY A;  3VJA A;  2PS4 A;  2Z4X A;  2E90 A;  3S4J A;  1WL2 A;  4WK5 A;  4QPF A;  5AHU B;  3CKE A;  2ZEU A;  4JZX A;  3PDE A;  3M0G A;  2EWG A;  3PYB A;  3LZ9 A;  5JV1 F;  4KWD A;  4PVX F;  5KSX F;  3G4F A;  4RXE A;  1N21 A;  3ZMB A;  3NPR A;  2F8C F;  2PS6 A;  1KIZ A;  4RYP A;  2Q9Y A;  2PS5 A;  1DGP A;  3M01 A;  3ICN A;  5EAS A;  1UBY A;  2E4O A;  3BNX A;  3RMG A;  4LFG A;  3G4D A;  5ERN A;  4GA3 A;  3CP6 A;  4K10 A;  3LDW A;  3W7F A;  2E8X A;  3WEK A;  4OKM A;  2Q58 A;  2Z4Z A;  5EAU A;  5DGN F;  2ONH A;  3RYW A;  3WCH A;  3DYG A;  3WJK A;  3OAC B;  4LXW A;  3LK5 A;  3AQB B;  3PH7 A;  2P1C A;  3IBA A;  4LZ0 A;  4Q23 A;  3KB9 A;  2PS7 A;  4XQS F;  3NRI A;  4LZ3 A;  4MC0 A;  5IK6 A;  3Q1O A;  4RXA A;  5B03 A;  2ONG A;  4LFV F;  3TFV A;  2F9K F;  3WCG A;  1HXC A;  1YYU A;  5IL3 A;  3WEI A;  1YHM A;  3NPK A;  4LUU A;  5IMI A;  3LMD A;  4MC8 A;  4KPJ A;  5ILZ A;  5DGM F;  1YYT A;  4FJQ A;  3TFP A;  3KBK A;  2Z4V A;  3M00 A;  4F6V A;  5ERM A;  3VJD A;  4NFI F;  5DHI A;  4GP1 A;  4NUA A;  4E9U A;  4ZQ8 A;  5ILI A;  2Z4Y A;  2AET A;  4JZB A;  2E92 A;  4MC3 A;  5IN8 A;  4DXJ A;  4LPG F;  3P8R A;  3IPI A;  4JXN A;  2AZK A;  4KFA A;  2E8W A;  4RXD A;  2AZL A;  3Q30 A;  2E8U A;  3N5J F;  1YV5 A;  4LA5 A;  5A0J A;  1DI1 A;  1PS1 A;  4KVD A;  3OAC A;  3WCL A;  4OKZ A;  4EA2 A;  5B0K A;  4OMG A;  5JV2 F;  5B01 A;  3N0G A;  1N1Z A;  3P5R A;  4KQS A;  1UBW A;  3V1V A;  1EZF A;  4LTZ A;  5DW7 A;  3NF2 A;  3BNY A;  3DYF A;  3APZ A;  5IKH A;  1N23 A;  5E8H A;  2F89 F;  2ZCQ A;  4XQT F;  4KVI A;  4JXY A;  2Q9Z A;  1YHL A;  4LFE A;  5DZ2 A;  5IM1 A;  5B0I A;  4EA1 A;  3EGT A;  3VJ8 A;  1WKZ A;  3VJB A;  4LZC A;  2F8Z F;  4L2X F;  3SDU A;  3SDR A;  2FOR A;  4N9U A;  2ZCS A;  3DYH A;  3WCD A;  2OA6 A;  3LG5 A;  1HM4 A;  3KRO B;  5IKA A;  3B7L A;  1WL1 A;  4H5C F;  4LPH F;  3P41 A;  5ILK A;  2Z52 A;  3WCI A;  3VJC A;  3N5H F;  4KQ5 A;  3Q2Q A;  5A0K A;  2F92 F;  4NKF A;  5AFX A;  5CG5 A;  3P8L A;  3ZOU A;  3WJO A;  3VJE A;  4OGU A;  2E93 A;  3MZV A;  5B0J A;  4RXC A;  4KPD A;  3EFQ A;  1VG4 A;  4NKE A;  5JA0 F;  2ZCR A;  2ZY1 A;  3EZ3 A;  3N0F A;  3WEJ A;  2OPN A;  2VF6 A;  3TS7 A;  2FTZ A; 
#chains in the Genus database with same CATH topology
 1UBX A;  1N24 A;  1V4E A;  1VG7 A;  4UMJ A;  5HN8 A;  1V4H A;  1WY0 A;  5EAT A;  1YYR A;  5JUZ F;  5ILH A;  4H5D F;  3SDV A;  5IMP A;  1HX9 A;  3ASX A;  3WCC A;  4DEM F;  4E1E A;  5A0I A;  5HN9 A;  1FPS A;  3WCJ A;  5B0M A;  4P0V A;  3SDT A;  3N45 F;  4XQR F;  3KRF B;  4EA0 A;  3KRO A;  3QKC A;  3ADZ A;  1JFG A;  3P5P A;  4GAX A;  1YYQ A;  5ERO A;  2Z7H A;  1JFA A;  2E8V A;  3LJI A;  3SDQ A;  2Z7I A;  2QIS A;  2F7M F;  3OYR A;  4QXS F;  4PVY F;  4NFK F;  1V4J A;  1WL3 A;  4NFJ F;  2AEL A;  3WC9 A;  3AE0 A;  1RQI A;  3WJN A;  5C05 A;  3ID0 A;  4KQU A;  5AEL A;  4F6X A;  3ACX A;  4RNQ A;  3PYA A;  1YHK A;  3KRA B;  5DHK A;  5HNA A;  3S9V A;  5AYP A;  3N49 F;  5DJP F;  3QQV A;  1VG2 A;  3ICM A;  3LEE A;  2PS8 A;  3PKO A;  3WCA A;  5ILD A;  2J5C A;  3LOM A;  3M02 A;  5I1U A;  4JVJ F;  3VJ9 A;  5B00 A;  5DIQ F;  4OMH A;  3RBM A;  5JV0 F;  3ACW A;  5IL8 A;  2J1O A;  3LGK A;  5H9D A;  3OAB B;  4DZW A;  5E8K A;  2E95 A;  3KRF A;  5IK9 A;  3WSA A;  4KVW A;  3AQC B;  3N1V F;  2E94 A;  1HXG A;  3ZL6 A;  4N1Z F;  3KRC B;  3LVS A;  4DWG A;  1N1B A;  2E8T A;  3SAE A;  4P0W A;  3KRP B;  3LSN A;  4DI5 A;  3MAV A;  2Z78 A;  4KKM A;  4DWB A;  3WE9 A;  1YYS A;  5ILY A;  2RAH A;  3WCF A;  2Q80 A;  1VG3 A;  2I19 A;  3ICK A;  3ICZ A;  2OGD A;  4LLT A;  4LIX A;  3UCA A;  4LTV A;  5ILJ A;  4F62 A;  3KRA A;  2ZCO A;  3WEG A;  3V1X A;  1N20 A;  2Z4W A;  5E8L A;  3TFN A;  3AQ0 A;  5DGS F;  4LLS A;  2ZEV A;  4NG6 A;  4HD1 A;  3ZMC A;  4P0X A;  5ER8 A;  5CG6 A;  1N22 A;  1WMW A;  4LOB A;  3WCE A;  1RQJ A;  2DH4 A;  3TC1 A;  3WCB A;  2F94 F;  1RTR A;  2AZJ A;  4KK2 A;  3OAB A;  2J1P A;  4LA6 A;  3LLW A;  3N6K F;  3N1W F;  3WCM A;  5IK0 A;  3ZCD A;  3V66 A;  4DHD A;  3KRC A;  1YJ4 A;  5B02 A;  1HM7 A;  1HXA A;  4H5E F;  3KRP A;  5DJV F;  1VG6 A;  2OPM A;  4KUX A;  1V4I A;  3WSB A;  2E91 A;  5B0L A;  4JYX A;  1UBV A;  3N3L F;  2O1O A;  3LGZ B;  3M9U A;  1YQ7 A;  3N3D A;  2Z50 A;  2H8O A;  1ZW5 A;  4FP4 A;  4GP2 A;  1WL0 A;  2AEK A;  5HN7 A;  3ACY A;  3Q2Z A;  5IVG A;  4E9Z A;  3N46 F;  5DJR F;  1V4K A;  3WEH A;  3CC9 A;  5IMN A;  3WEF A;  1KIY A;  3RYE A;  4KVY A;  3VJA A;  2PS4 A;  2Z4X A;  2E90 A;  3S4J A;  1WL2 A;  4WK5 A;  4QPF A;  5AHU B;  3CKE A;  2ZEU A;  4JZX A;  3PDE A;  3M0G A;  2EWG A;  3PYB A;  3LZ9 A;  5JV1 F;  4KWD A;  4PVX F;  5KSX F;  3G4F A;  4RXE A;  1N21 A;  3ZMB A;  3NPR A;  2F8C F;  2PS6 A;  1KIZ A;  4RYP A;  2Q9Y A;  2PS5 A;  1DGP A;  3M01 A;  3ICN A;  5EAS A;  1UBY A;  2E4O A;  3BNX A;  3RMG A;  4LFG A;  3G4D A;  5ERN A;  4GA3 A;  3CP6 A;  4K10 A;  3LDW A;  3W7F A;  2E8X A;  3WEK A;  4OKM A;  2Q58 A;  2Z4Z A;  5EAU A;  5DGN F;  2ONH A;  3RYW A;  3WCH A;  3DYG A;  3WJK A;  3OAC B;  4LXW A;  3LK5 A;  3AQB B;  3PH7 A;  2P1C A;  3IBA A;  4LZ0 A;  4Q23 A;  3KB9 A;  2PS7 A;  4XQS F;  3NRI A;  4LZ3 A;  4MC0 A;  5IK6 A;  3Q1O A;  4RXA A;  5B03 A;  2ONG A;  4LFV F;  3TFV A;  2F9K F;  3WCG A;  1HXC A;  1YYU A;  5IL3 A;  3WEI A;  1YHM A;  3NPK A;  4LUU A;  5IMI A;  3LMD A;  4MC8 A;  4KPJ A;  5ILZ A;  5DGM F;  1YYT A;  4FJQ A;  3TFP A;  3KBK A;  2Z4V A;  3M00 A;  4F6V A;  5ERM A;  3VJD A;  4NFI F;  5DHI A;  4GP1 A;  4NUA A;  4E9U A;  4ZQ8 A;  5ILI A;  2Z4Y A;  2AET A;  4JZB A;  2E92 A;  4MC3 A;  5IN8 A;  4DXJ A;  4LPG F;  3P8R A;  3IPI A;  4JXN A;  2AZK A;  4KFA A;  2E8W A;  4RXD A;  2AZL A;  3Q30 A;  2E8U A;  3N5J F;  1YV5 A;  4LA5 A;  5A0J A;  1DI1 A;  1PS1 A;  4KVD A;  3OAC A;  3WCL A;  4OKZ A;  4EA2 A;  5B0K A;  4OMG A;  5JV2 F;  5B01 A;  3N0G A;  1N1Z A;  3P5R A;  4KQS A;  1UBW A;  3V1V A;  1EZF A;  4LTZ A;  5DW7 A;  3NF2 A;  3BNY A;  3DYF A;  3APZ A;  5IKH A;  1N23 A;  5E8H A;  2F89 F;  2ZCQ A;  4XQT F;  4KVI A;  4JXY A;  2Q9Z A;  1YHL A;  4LFE A;  5DZ2 A;  5IM1 A;  5B0I A;  4EA1 A;  3EGT A;  3VJ8 A;  1WKZ A;  3VJB A;  4LZC A;  2F8Z F;  4L2X F;  3SDU A;  3SDR A;  2FOR A;  4N9U A;  2ZCS A;  3DYH A;  3WCD A;  2OA6 A;  3LG5 A;  1HM4 A;  3KRO B;  5IKA A;  3B7L A;  1WL1 A;  4H5C F;  4LPH F;  3P41 A;  5ILK A;  2Z52 A;  3WCI A;  3VJC A;  3N5H F;  4KQ5 A;  3Q2Q A;  5A0K A;  2F92 F;  4NKF A;  5AFX A;  5CG5 A;  3P8L A;  3ZOU A;  3WJO A;  3VJE A;  4OGU A;  2E93 A;  3MZV A;  5B0J A;  4RXC A;  4KPD A;  3EFQ A;  1VG4 A;  4NKE A;  5JA0 F;  2ZCR A;  2ZY1 A;  3EZ3 A;  3N0F A;  3WEJ A;  2OPN A;  2VF6 A;  3TS7 A;  2FTZ A; 
#chains in the Genus database with same CATH homology
 1UBX A;  1N24 A;  1V4E A;  1VG7 A;  4UMJ A;  5HN8 A;  1V4H A;  1WY0 A;  5EAT A;  1YYR A;  5JUZ F;  5ILH A;  4H5D F;  3SDV A;  5IMP A;  1HX9 A;  3ASX A;  3WCC A;  4DEM F;  4E1E A;  5A0I A;  5HN9 A;  1FPS A;  3WCJ A;  5B0M A;  4P0V A;  3SDT A;  3N45 F;  4XQR F;  3KRF B;  4EA0 A;  3KRO A;  3QKC A;  3ADZ A;  1JFG A;  3P5P A;  4GAX A;  1YYQ A;  5ERO A;  2Z7H A;  1JFA A;  2E8V A;  3LJI A;  3SDQ A;  2Z7I A;  2QIS A;  2F7M F;  3OYR A;  4QXS F;  4PVY F;  4NFK F;  1V4J A;  1WL3 A;  4NFJ F;  2AEL A;  3WC9 A;  3AE0 A;  1RQI A;  3WJN A;  5C05 A;  3ID0 A;  4KQU A;  5AEL A;  4F6X A;  3ACX A;  4RNQ A;  3PYA A;  1YHK A;  3KRA B;  5DHK A;  5HNA A;  3S9V A;  5AYP A;  3N49 F;  5DJP F;  3QQV A;  1VG2 A;  3ICM A;  3LEE A;  2PS8 A;  3PKO A;  3WCA A;  5ILD A;  2J5C A;  3LOM A;  3M02 A;  5I1U A;  4JVJ F;  3VJ9 A;  5B00 A;  5DIQ F;  4OMH A;  3RBM A;  5JV0 F;  3ACW A;  5IL8 A;  2J1O A;  3LGK A;  5H9D A;  3OAB B;  4DZW A;  5E8K A;  2E95 A;  3KRF A;  5IK9 A;  3WSA A;  4KVW A;  3AQC B;  3N1V F;  2E94 A;  1HXG A;  3ZL6 A;  4N1Z F;  3KRC B;  3LVS A;  4DWG A;  1N1B A;  2E8T A;  3SAE A;  4P0W A;  3KRP B;  3LSN A;  4DI5 A;  3MAV A;  2Z78 A;  4KKM A;  4DWB A;  3WE9 A;  1YYS A;  5ILY A;  2RAH A;  3WCF A;  2Q80 A;  1VG3 A;  2I19 A;  3ICK A;  3ICZ A;  2OGD A;  4LLT A;  4LIX A;  3UCA A;  4LTV A;  5ILJ A;  4F62 A;  3KRA A;  2ZCO A;  3WEG A;  3V1X A;  1N20 A;  2Z4W A;  5E8L A;  3TFN A;  3AQ0 A;  5DGS F;  4LLS A;  2ZEV A;  4NG6 A;  4HD1 A;  3ZMC A;  4P0X A;  5ER8 A;  5CG6 A;  1N22 A;  1WMW A;  4LOB A;  3WCE A;  1RQJ A;  2DH4 A;  3TC1 A;  3WCB A;  2F94 F;  1RTR A;  2AZJ A;  4KK2 A;  3OAB A;  2J1P A;  4LA6 A;  3LLW A;  3N6K F;  3N1W F;  3WCM A;  5IK0 A;  3ZCD A;  3V66 A;  4DHD A;  3KRC A;  1YJ4 A;  5B02 A;  1HM7 A;  1HXA A;  4H5E F;  3KRP A;  5DJV F;  1VG6 A;  2OPM A;  4KUX A;  1V4I A;  3WSB A;  2E91 A;  5B0L A;  4JYX A;  1UBV A;  3N3L F;  2O1O A;  3LGZ B;  3M9U A;  1YQ7 A;  3N3D A;  2Z50 A;  2H8O A;  1ZW5 A;  4FP4 A;  4GP2 A;  1WL0 A;  2AEK A;  5HN7 A;  3ACY A;  3Q2Z A;  5IVG A;  4E9Z A;  3N46 F;  5DJR F;  1V4K A;  3WEH A;  3CC9 A;  5IMN A;  3WEF A;  1KIY A;  3RYE A;  4KVY A;  3VJA A;  2PS4 A;  2Z4X A;  2E90 A;  3S4J A;  1WL2 A;  4WK5 A;  4QPF A;  5AHU B;  3CKE A;  2ZEU A;  4JZX A;  3PDE A;  3M0G A;  2EWG A;  3PYB A;  3LZ9 A;  5JV1 F;  4KWD A;  4PVX F;  5KSX F;  3G4F A;  4RXE A;  1N21 A;  3ZMB A;  3NPR A;  2F8C F;  2PS6 A;  1KIZ A;  4RYP A;  2Q9Y A;  2PS5 A;  1DGP A;  3M01 A;  3ICN A;  5EAS A;  1UBY A;  2E4O A;  3BNX A;  3RMG A;  4LFG A;  3G4D A;  5ERN A;  4GA3 A;  3CP6 A;  4K10 A;  3LDW A;  3W7F A;  2E8X A;  3WEK A;  4OKM A;  2Q58 A;  2Z4Z A;  5EAU A;  5DGN F;  2ONH A;  3RYW A;  3WCH A;  3DYG A;  3WJK A;  3OAC B;  4LXW A;  3LK5 A;  3AQB B;  3PH7 A;  2P1C A;  3IBA A;  4LZ0 A;  4Q23 A;  3KB9 A;  2PS7 A;  4XQS F;  3NRI A;  4LZ3 A;  4MC0 A;  5IK6 A;  3Q1O A;  4RXA A;  5B03 A;  2ONG A;  4LFV F;  3TFV A;  2F9K F;  3WCG A;  1HXC A;  1YYU A;  5IL3 A;  3WEI A;  1YHM A;  3NPK A;  4LUU A;  5IMI A;  3LMD A;  4MC8 A;  4KPJ A;  5ILZ A;  5DGM F;  1YYT A;  4FJQ A;  3TFP A;  3KBK A;  2Z4V A;  3M00 A;  4F6V A;  5ERM A;  3VJD A;  4NFI F;  5DHI A;  4GP1 A;  4NUA A;  4E9U A;  4ZQ8 A;  5ILI A;  2Z4Y A;  2AET A;  4JZB A;  2E92 A;  4MC3 A;  5IN8 A;  4DXJ A;  4LPG F;  3P8R A;  3IPI A;  4JXN A;  2AZK A;  4KFA A;  2E8W A;  4RXD A;  2AZL A;  3Q30 A;  2E8U A;  3N5J F;  1YV5 A;  4LA5 A;  5A0J A;  1DI1 A;  1PS1 A;  4KVD A;  3OAC A;  3WCL A;  4OKZ A;  4EA2 A;  5B0K A;  4OMG A;  5JV2 F;  5B01 A;  3N0G A;  1N1Z A;  3P5R A;  4KQS A;  1UBW A;  3V1V A;  1EZF A;  4LTZ A;  5DW7 A;  3NF2 A;  3BNY A;  3DYF A;  3APZ A;  5IKH A;  1N23 A;  5E8H A;  2F89 F;  2ZCQ A;  4XQT F;  4KVI A;  4JXY A;  2Q9Z A;  1YHL A;  4LFE A;  5DZ2 A;  5IM1 A;  5B0I A;  4EA1 A;  3EGT A;  3VJ8 A;  1WKZ A;  3VJB A;  4LZC A;  2F8Z F;  4L2X F;  3SDU A;  3SDR A;  2FOR A;  4N9U A;  2ZCS A;  3DYH A;  3WCD A;  2OA6 A;  3LG5 A;  1HM4 A;  3KRO B;  5IKA A;  3B7L A;  1WL1 A;  4H5C F;  4LPH F;  3P41 A;  5ILK A;  2Z52 A;  3WCI A;  3VJC A;  3N5H F;  4KQ5 A;  3Q2Q A;  5A0K A;  2F92 F;  4NKF A;  5AFX A;  5CG5 A;  3P8L A;  3ZOU A;  3WJO A;  3VJE A;  4OGU A;  2E93 A;  3MZV A;  5B0J A;  4RXC A;  4KPD A;  3EFQ A;  1VG4 A;  4NKE A;  5JA0 F;  2ZCR A;  2ZY1 A;  3EZ3 A;  3N0F A;  3WEJ A;  2OPN A;  2VF6 A;  3TS7 A;  2FTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...