3ACYA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bph-702
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title Mechanism of action and inhibition of dehydrosqualene synthase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
total genus 118
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3acyA00
2EWGA 4WK5A 2Z4WA 2H8OA 4DHDA 1WL2A 4E9ZA 5JV1F 3WEGA 3ICNA 2Q9ZA 4LIXA 3LG5A 4OMHA 5ILJA 5B0KA 3RBMA 3TFPA 1YYUA 4RXCA 5EAUA 2Z7IA 1WL1A 5A0IA 4KQSA 5DHIA 3NF2A 3WSAA 4KQUA 2E8UA 1VG4A 2F94F 2RAHA 3SDTA 4JVJF 5ILKA 3UCAA 4FP4A 1V4JA 3WCBA 3ZL6A 4E9UA 2OA6A 2O1OA 5DIQF 5B0IA 3PDEA 1YYTA 3KBKA 4KVYA 3WEKA 5A0KA 1UBYA 3NRIA 5IMPA 2FORA 2PS4A 1VG3A 3CP6A 3ADZA 3S4JA 5IK0A 2ZCRA 1EZFA 4JZBA 4OMGA 3SDQA 1V4KA 3WE9A 5DGSF 2F7MF 1WY0A 3SAEA 4NFJF 3SDVA 4XQRF 2PS7A 3APZA 5DW7A 3ICZA 4LFGA 5AFXA 5JV0F 3LGKA 4P0XA 3M00A 3IPIA 3LEEA 5EATA 4LFEA 4GA3A 2F8CF 4MC3A 3N0GA 2AZLA 4GP2A 4H5CF 2ZEUA 3OACA 3N0FA 5AYPA 1N20A 2ZCSA 4LA5A 3V1XA 5HN9A 5A0JA 5DJPF 5ERMA 3KRFA 1YYRA 3ACWA 3NPKA 3SDUA 1VG7A 4FJQA 5E8KA 4F62A 4OKZA 2ZCOA 3VJEA 3V1VA 3WCJA 4DXJA 1VG2A 4EA0A 1HM4A 4NG6A 3N49F 4PVYF 1N1ZA 5DGMF 1V4IA 4JZXA 2E95A 3M0GA 5B00A 4LXWA 4H5DF 5JUZF 1VG6A 3RYWA 5B02A 2ZEVA 2AZJA 5ILYA 3LDWA 2Q80A 4LZCA 4Q23A 2Z4YA 3MZVA 2Z4XA 3OACB 3LLWA 3ACYA 5ILZA 4RXDA 3NPRA 3KRFB 5DGNF 5EROA 5ILDA 3ID0A 3WJNA 2ONGA 2Z78A 1KIYA 5B0LA 4L2XF 4LPGF 3MAVA 1UBVA 3KB9A 1RTRA 1YYQA 4DWBA 3WCFA 5ILHA 3ZMBA 4EA1A 3N6KF 5E8HA 4QXSF 3WCMA 4LOBA 3W7FA 5DZ2A 4RNQA 4OKMA 2Z4VA 3ZCDA 4RXAA 1HXAA 5ERNA 5KSXF 3SDRA 5IMNA 2F8ZF 2VF6A 1N1BA 4KKMA 4KWDA 3WCIA 2E8TA 1V4EA 2E92A 2E8WA 3VJDA 4JYXA 4NKFA 4LUUA 4LTVA 3P8LA 5JV2F 4LA6A 2PS8A 3IBAA 3LSNA 3WCAA 2E94A 4KFAA 4N9UA 3WEHA 4F6XA 1WKZA 1WMWA 4XQTF 3DYGA 5HN8A 3EGTA 3VJAA 3V66A 5H9DA 1UBXA 4P0WA 3TC1A 1N22A 2FTZA 2P1CA 5B0MA 4EA2A 3P8RA 2Z7HA 2Z52A 5IM1A 4JXYA 3LMDA 2QISA 3OYRA 3WCCA 3WJOA 3CKEA 2OPNA 1N21A 1N24A 4RXEA 1DGPA 1YJ4A 3TS7A 2J5CA 3BNYA 2AEKA 3Q2ZA 3QKCA 3VJ8A 3PH7A 3RMGA 3DYHA 5HNAA 3M02A 1JFAA 5B0JA 5AELA 5CG6A 2ZY1A 3ZOUA 2Q58A 2E8VA 4NFKF 1HXCA 5IKAA 3N46F 3P41A 4KVIA 5IKHA 3N5HF 4LPHF 4KPDA 2Z50A 3KRPA 3ICMA 2E8XA 3WCEA 3AQCB 4XQSF 4MC8A 5AHUB 3VJBA 4KK2A 3BNXA 3G4FA 3LOMA 2ZCQA 3EZ3A 2E4OA 3KROA 4LZ3A 3PYAA 3AQBB 4LTZA 3OABA 1YHKA 1FPSA 3DYFA 3Q1OA 3WJKA 3CC9A 1YHMA 4RYPA 5E8LA 5DHKA 2J1OA 1HXGA 3WEIA 2Q9YA 2PS5A 4LFVF 3KRPB 4HD1A 4P0VA 1YQ7A 3LJIA 1WL3A 3Q2QA 4NUAA 4DZWA 4GP1A 5I1UA 2OGDA 3KROB 1KIZA 5DJRF 4PVXF 5IK6A 3M9UA 3Q30A 3WEJA 1V4HA 1JFGA 3KRCA 3OABB 4MC0A 4DI5A 2E93A 2AELA 2PS6A 3EFQA 4LLSA 2OPMA 3LK5A 4KUXA 3QQVA 3ICKA 5IN8A 2E90A 3ASXA 3AE0A 1N23A 1YHLA 5HN7A 4H5EF 5ER8A 3N45F 3N1VF 3P5RA 3AQ0A 4F6VA 4NFIF 4DEMF 4DWGA 3G4DA 5IK9A 3WCHA 1DI1A 5DJVF 4KPJA 2F9KF 4OGUA 1RQIA 3TFVA 4JXNA 3N3DA 2AZKA 3KRAA 3LVSA 4GAXA 4QPFA 4KVWA 4N1ZF 3KRCB 1YV5A 1HM7A 4KQ5A 4LLTA 5IVGA 1HX9A 3N5JF 4K10A 5IL8A 1RQJA 5EASA 2J1PA 3M01A 1ZW5A 3TFNA 3WSBA 3N3LF 4NKEA 5B03A 3N1WF 3P5PA 1PS1A 5CG5A 2F89F 3WCDA 5IMIA 3PYBA 3WCGA 3WEFA 3RYEA 1UBWA 1YYSA 5JA0F 3ACXA 3ZMCA 5ILIA 2I19A 4E1EA 3S9VA 3WC9A 3LZ9A 3PKOA 3KRAB 3B7LA 2ONHA 3LGZB 5C05A 3WCLA 4KVDA 5IL3A 5B01A 4ZQ8A 3VJ9A 3VJCA 1WL0A 4LZ0A 2Z4ZA 2AETA 4UMJA 2E91A 2F92F 2DH4A
chains in the Genus database with same CATH superfamily
2EWGA 4WK5A 2Z4WA 2H8OA 4DHDA 1WL2A 4E9ZA 5JV1F 3WEGA 3ICNA 2Q9ZA 4LIXA 3LG5A 4OMHA 5ILJA 5B0KA 3RBMA 3TFPA 1YYUA 4RXCA 5EAUA 2Z7IA 1WL1A 5A0IA 4KQSA 5DHIA 3NF2A 3WSAA 4KQUA 2E8UA 1VG4A 2F94F 2RAHA 3SDTA 4JVJF 5ILKA 3UCAA 4FP4A 1V4JA 3WCBA 3ZL6A 4E9UA 2OA6A 2O1OA 5DIQF 5B0IA 3PDEA 1YYTA 3KBKA 4KVYA 3WEKA 5A0KA 1UBYA 3NRIA 5IMPA 2FORA 2PS4A 1VG3A 3CP6A 3ADZA 3S4JA 5IK0A 2ZCRA 1EZFA 4JZBA 4OMGA 3SDQA 1V4KA 3WE9A 5DGSF 2F7MF 1WY0A 3SAEA 4NFJF 3SDVA 4XQRF 2PS7A 3APZA 5DW7A 3ICZA 4LFGA 5AFXA 5JV0F 3LGKA 4P0XA 3M00A 3IPIA 3LEEA 5EATA 4LFEA 4GA3A 2F8CF 4MC3A 3N0GA 2AZLA 4GP2A 4H5CF 2ZEUA 3OACA 3N0FA 5AYPA 1N20A 2ZCSA 4LA5A 3V1XA 5HN9A 5A0JA 5DJPF 5ERMA 3KRFA 1YYRA 3ACWA 3NPKA 3SDUA 1VG7A 4FJQA 5E8KA 4F62A 4OKZA 2ZCOA 3VJEA 3V1VA 3WCJA 4DXJA 1VG2A 4EA0A 1HM4A 4NG6A 3N49F 4PVYF 1N1ZA 5DGMF 1V4IA 4JZXA 2E95A 3M0GA 5B00A 4LXWA 4H5DF 5JUZF 1VG6A 3RYWA 5B02A 2ZEVA 2AZJA 5ILYA 3LDWA 2Q80A 4LZCA 4Q23A 2Z4YA 3MZVA 2Z4XA 3OACB 3LLWA 3ACYA 5ILZA 4RXDA 3NPRA 3KRFB 5DGNF 5EROA 5ILDA 3ID0A 3WJNA 2ONGA 2Z78A 1KIYA 5B0LA 4L2XF 4LPGF 3MAVA 1UBVA 3KB9A 1RTRA 1YYQA 4DWBA 3WCFA 5ILHA 3ZMBA 4EA1A 3N6KF 5E8HA 4QXSF 3WCMA 4LOBA 3W7FA 5DZ2A 4RNQA 4OKMA 2Z4VA 3ZCDA 4RXAA 1HXAA 5ERNA 5KSXF 3SDRA 5IMNA 2F8ZF 2VF6A 1N1BA 4KKMA 4KWDA 3WCIA 2E8TA 1V4EA 2E92A 2E8WA 3VJDA 4JYXA 4NKFA 4LUUA 4LTVA 3P8LA 5JV2F 4LA6A 2PS8A 3IBAA 3LSNA 3WCAA 2E94A 4KFAA 4N9UA 3WEHA 4F6XA 1WKZA 1WMWA 4XQTF 3DYGA 5HN8A 3EGTA 3VJAA 3V66A 5H9DA 1UBXA 4P0WA 3TC1A 1N22A 2FTZA 2P1CA 5B0MA 4EA2A 3P8RA 2Z7HA 2Z52A 5IM1A 4JXYA 3LMDA 2QISA 3OYRA 3WCCA 3WJOA 3CKEA 2OPNA 1N21A 1N24A 4RXEA 1DGPA 1YJ4A 3TS7A 2J5CA 3BNYA 2AEKA 3Q2ZA 3QKCA 3VJ8A 3PH7A 3RMGA 3DYHA 5HNAA 3M02A 1JFAA 5B0JA 5AELA 5CG6A 2ZY1A 3ZOUA 2Q58A 2E8VA 4NFKF 1HXCA 5IKAA 3N46F 3P41A 4KVIA 5IKHA 3N5HF 4LPHF 4KPDA 2Z50A 3KRPA 3ICMA 2E8XA 3WCEA 3AQCB 4XQSF 4MC8A 5AHUB 3VJBA 4KK2A 3BNXA 3G4FA 3LOMA 2ZCQA 3EZ3A 2E4OA 3KROA 4LZ3A 3PYAA 3AQBB 4LTZA 3OABA 1YHKA 1FPSA 3DYFA 3Q1OA 3WJKA 3CC9A 1YHMA 4RYPA 5E8LA 5DHKA 2J1OA 1HXGA 3WEIA 2Q9YA 2PS5A 4LFVF 3KRPB 4HD1A 4P0VA 1YQ7A 3LJIA 1WL3A 3Q2QA 4NUAA 4DZWA 4GP1A 5I1UA 2OGDA 3KROB 1KIZA 5DJRF 4PVXF 5IK6A 3M9UA 3Q30A 3WEJA 1V4HA 1JFGA 3KRCA 3OABB 4MC0A 4DI5A 2E93A 2AELA 2PS6A 3EFQA 4LLSA 2OPMA 3LK5A 4KUXA 3QQVA 3ICKA 5IN8A 2E90A 3ASXA 3AE0A 1N23A 1YHLA 5HN7A 4H5EF 5ER8A 3N45F 3N1VF 3P5RA 3AQ0A 4F6VA 4NFIF 4DEMF 4DWGA 3G4DA 5IK9A 3WCHA 1DI1A 5DJVF 4KPJA 2F9KF 4OGUA 1RQIA 3TFVA 4JXNA 3N3DA 2AZKA 3KRAA 3LVSA 4GAXA 4QPFA 4KVWA 4N1ZF 3KRCB 1YV5A 1HM7A 4KQ5A 4LLTA 5IVGA 1HX9A 3N5JF 4K10A 5IL8A 1RQJA 5EASA 2J1PA 3M01A 1ZW5A 3TFNA 3WSBA 3N3LF 4NKEA 5B03A 3N1WF 3P5PA 1PS1A 5CG5A 2F89F 3WCDA 5IMIA 3PYBA 3WCGA 3WEFA 3RYEA 1UBWA 1YYSA 5JA0F 3ACXA 3ZMCA 5ILIA 2I19A 4E1EA 3S9VA 3WC9A 3LZ9A 3PKOA 3KRAB 3B7LA 2ONHA 3LGZB 5C05A 3WCLA 4KVDA 5IL3A 5B01A 4ZQ8A 3VJ9A 3VJCA 1WL0A 4LZ0A 2Z4ZA 2AETA 4UMJA 2E91A 2F92F 2DH4A
chains in the Genus database with same CATH topology
2EWGA 4WK5A 2Z4WA 2H8OA 4DHDA 1WL2A 4E9ZA 5JV1F 3WEGA 3ICNA 2Q9ZA 4LIXA 3LG5A 4OMHA 5ILJA 5B0KA 3RBMA 3TFPA 1YYUA 4RXCA 5EAUA 2Z7IA 1WL1A 5A0IA 4KQSA 5DHIA 3NF2A 3WSAA 4KQUA 2E8UA 1VG4A 2F94F 2RAHA 3SDTA 4JVJF 5ILKA 3UCAA 4FP4A 1V4JA 3WCBA 3ZL6A 4E9UA 2OA6A 2O1OA 5DIQF 5B0IA 3PDEA 1YYTA 3KBKA 4KVYA 3WEKA 5A0KA 1UBYA 3NRIA 5IMPA 2FORA 2PS4A 1VG3A 3CP6A 3ADZA 3S4JA 5IK0A 2ZCRA 1EZFA 4JZBA 4OMGA 3SDQA 1V4KA 3WE9A 5DGSF 2F7MF 1WY0A 3SAEA 4NFJF 3SDVA 4XQRF 2PS7A 3APZA 5DW7A 3ICZA 4LFGA 5AFXA 5JV0F 3LGKA 4P0XA 3M00A 3IPIA 3LEEA 5EATA 4LFEA 4GA3A 2F8CF 4MC3A 3N0GA 2AZLA 4GP2A 4H5CF 2ZEUA 3OACA 3N0FA 5AYPA 1N20A 2ZCSA 4LA5A 3V1XA 5HN9A 5A0JA 5DJPF 5ERMA 3KRFA 1YYRA 3ACWA 3NPKA 3SDUA 1VG7A 4FJQA 5E8KA 4F62A 4OKZA 2ZCOA 3VJEA 3V1VA 3WCJA 4DXJA 1VG2A 4EA0A 1HM4A 4NG6A 3N49F 4PVYF 1N1ZA 5DGMF 1V4IA 4JZXA 2E95A 3M0GA 5B00A 4LXWA 4H5DF 5JUZF 1VG6A 3RYWA 5B02A 2ZEVA 2AZJA 5ILYA 3LDWA 2Q80A 4LZCA 4Q23A 2Z4YA 3MZVA 2Z4XA 3OACB 3LLWA 3ACYA 5ILZA 4RXDA 3NPRA 3KRFB 5DGNF 5EROA 5ILDA 3ID0A 3WJNA 2ONGA 2Z78A 1KIYA 5B0LA 4L2XF 4LPGF 3MAVA 1UBVA 3KB9A 1RTRA 1YYQA 4DWBA 3WCFA 5ILHA 3ZMBA 4EA1A 3N6KF 5E8HA 4QXSF 3WCMA 4LOBA 3W7FA 5DZ2A 4RNQA 4OKMA 2Z4VA 3ZCDA 4RXAA 1HXAA 5ERNA 5KSXF 3SDRA 5IMNA 2F8ZF 2VF6A 1N1BA 4KKMA 4KWDA 3WCIA 2E8TA 1V4EA 2E92A 2E8WA 3VJDA 4JYXA 4NKFA 4LUUA 4LTVA 3P8LA 5JV2F 4LA6A 2PS8A 3IBAA 3LSNA 3WCAA 2E94A 4KFAA 4N9UA 3WEHA 4F6XA 1WKZA 1WMWA 4XQTF 3DYGA 5HN8A 3EGTA 3VJAA 3V66A 5H9DA 1UBXA 4P0WA 3TC1A 1N22A 2FTZA 2P1CA 5B0MA 4EA2A 3P8RA 2Z7HA 2Z52A 5IM1A 4JXYA 3LMDA 2QISA 3OYRA 3WCCA 3WJOA 3CKEA 2OPNA 1N21A 1N24A 4RXEA 1DGPA 1YJ4A 3TS7A 2J5CA 3BNYA 2AEKA 3Q2ZA 3QKCA 3VJ8A 3PH7A 3RMGA 3DYHA 5HNAA 3M02A 1JFAA 5B0JA 5AELA 5CG6A 2ZY1A 3ZOUA 2Q58A 2E8VA 4NFKF 1HXCA 5IKAA 3N46F 3P41A 4KVIA 5IKHA 3N5HF 4LPHF 4KPDA 2Z50A 3KRPA 3ICMA 2E8XA 3WCEA 3AQCB 4XQSF 4MC8A 5AHUB 3VJBA 4KK2A 3BNXA 3G4FA 3LOMA 2ZCQA 3EZ3A 2E4OA 3KROA 4LZ3A 3PYAA 3AQBB 4LTZA 3OABA 1YHKA 1FPSA 3DYFA 3Q1OA 3WJKA 3CC9A 1YHMA 4RYPA 5E8LA 5DHKA 2J1OA 1HXGA 3WEIA 2Q9YA 2PS5A 4LFVF 3KRPB 4HD1A 4P0VA 1YQ7A 3LJIA 1WL3A 3Q2QA 4NUAA 4DZWA 4GP1A 5I1UA 2OGDA 3KROB 1KIZA 5DJRF 4PVXF 5IK6A 3M9UA 3Q30A 3WEJA 1V4HA 1JFGA 3KRCA 3OABB 4MC0A 4DI5A 2E93A 2AELA 2PS6A 3EFQA 4LLSA 2OPMA 3LK5A 4KUXA 3QQVA 3ICKA 5IN8A 2E90A 3ASXA 3AE0A 1N23A 1YHLA 5HN7A 4H5EF 5ER8A 3N45F 3N1VF 3P5RA 3AQ0A 4F6VA 4NFIF 4DEMF 4DWGA 3G4DA 5IK9A 3WCHA 1DI1A 5DJVF 4KPJA 2F9KF 4OGUA 1RQIA 3TFVA 4JXNA 3N3DA 2AZKA 3KRAA 3LVSA 4GAXA 4QPFA 4KVWA 4N1ZF 3KRCB 1YV5A 1HM7A 4KQ5A 4LLTA 5IVGA 1HX9A 3N5JF 4K10A 5IL8A 1RQJA 5EASA 2J1PA 3M01A 1ZW5A 3TFNA 3WSBA 3N3LF 4NKEA 5B03A 3N1WF 3P5PA 1PS1A 5CG5A 2F89F 3WCDA 5IMIA 3PYBA 3WCGA 3WEFA 3RYEA 1UBWA 1YYSA 5JA0F 3ACXA 3ZMCA 5ILIA 2I19A 4E1EA 3S9VA 3WC9A 3LZ9A 3PKOA 3KRAB 3B7LA 2ONHA 3LGZB 5C05A 3WCLA 4KVDA 5IL3A 5B01A 4ZQ8A 3VJ9A 3VJCA 1WL0A 4LZ0A 2Z4ZA 2AETA 4UMJA 2E91A 2F92F 2DH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWG A;  4WK5 A;  2Z4W A;  2H8O A;  4DHD A;  1WL2 A;  4E9Z A;  5JV1 F;  3WEG A;  3ICN A;  2Q9Z A;  4LIX A;  3LG5 A;  4OMH A;  5ILJ A;  5B0K A;  3RBM A;  3TFP A;  1YYU A;  4RXC A;  5EAU A;  2Z7I A;  1WL1 A;  5A0I A;  4KQS A;  5DHI A;  3NF2 A;  3WSA A;  4KQU A;  2E8U A;  1VG4 A;  2F94 F;  2RAH A;  3SDT A;  4JVJ F;  5ILK A;  3UCA A;  4FP4 A;  1V4J A;  3WCB A;  3ZL6 A;  4E9U A;  2OA6 A;  2O1O A;  5DIQ F;  5B0I A;  3PDE A;  1YYT A;  3KBK A;  4KVY A;  3WEK A;  5A0K A;  1UBY A;  3NRI A;  5IMP A;  2FOR A;  2PS4 A;  1VG3 A;  3CP6 A;  3ADZ A;  3S4J A;  5IK0 A;  2ZCR A;  1EZF A;  4JZB A;  4OMG A;  3SDQ A;  1V4K A;  3WE9 A;  5DGS F;  2F7M F;  1WY0 A;  3SAE A;  4NFJ F;  3SDV A;  4XQR F;  2PS7 A;  3APZ A;  5DW7 A;  3ICZ A;  4LFG A;  5AFX A;  5JV0 F;  3LGK A;  4P0X A;  3M00 A;  3IPI A;  3LEE A;  5EAT A;  4LFE A;  4GA3 A;  2F8C F;  4MC3 A;  3N0G A;  2AZL A;  4GP2 A;  4H5C F;  2ZEU A;  3OAC A;  3N0F A;  5AYP A;  1N20 A;  2ZCS A;  4LA5 A;  3V1X A;  5HN9 A;  5A0J A;  5DJP F;  5ERM A;  3KRF A;  1YYR A;  3ACW A;  3NPK A;  3SDU A;  1VG7 A;  4FJQ A;  5E8K A;  4F62 A;  4OKZ A;  2ZCO A;  3VJE A;  3V1V A;  3WCJ A;  4DXJ A;  1VG2 A;  4EA0 A;  1HM4 A;  4NG6 A;  3N49 F;  4PVY F;  1N1Z A;  5DGM F;  1V4I A;  4JZX A;  2E95 A;  3M0G A;  5B00 A;  4LXW A;  4H5D F;  5JUZ F;  1VG6 A;  3RYW A;  5B02 A;  2ZEV A;  2AZJ A;  5ILY A;  3LDW A;  2Q80 A;  4LZC A;  4Q23 A;  2Z4Y A;  3MZV A;  2Z4X A;  3OAC B;  3LLW A;  3ACY A;  5ILZ A;  4RXD A;  3NPR A;  3KRF B;  5DGN F;  5ERO A;  5ILD A;  3ID0 A;  3WJN A;  2ONG A;  2Z78 A;  1KIY A;  5B0L A;  4L2X F;  4LPG F;  3MAV A;  1UBV A;  3KB9 A;  1RTR A;  1YYQ A;  4DWB A;  3WCF A;  5ILH A;  3ZMB A;  4EA1 A;  3N6K F;  5E8H A;  4QXS F;  3WCM A;  4LOB A;  3W7F A;  5DZ2 A;  4RNQ A;  4OKM A;  2Z4V A;  3ZCD A;  4RXA A;  1HXA A;  5ERN A;  5KSX F;  3SDR A;  5IMN A;  2F8Z F;  2VF6 A;  1N1B A;  4KKM A;  4KWD A;  3WCI A;  2E8T A;  1V4E A;  2E92 A;  2E8W A;  3VJD A;  4JYX A;  4NKF A;  4LUU A;  4LTV A;  3P8L A;  5JV2 F;  4LA6 A;  2PS8 A;  3IBA A;  3LSN A;  3WCA A;  2E94 A;  4KFA A;  4N9U A;  3WEH A;  4F6X A;  1WKZ A;  1WMW A;  4XQT F;  3DYG A;  5HN8 A;  3EGT A;  3VJA A;  3V66 A;  5H9D A;  1UBX A;  4P0W A;  3TC1 A;  1N22 A;  2FTZ A;  2P1C A;  5B0M A;  4EA2 A;  3P8R A;  2Z7H A;  2Z52 A;  5IM1 A;  4JXY A;  3LMD A;  2QIS A;  3OYR A;  3WCC A;  3WJO A;  3CKE A;  2OPN A;  1N21 A;  1N24 A;  4RXE A;  1DGP A;  1YJ4 A;  3TS7 A;  2J5C A;  3BNY A;  2AEK A;  3Q2Z A;  3QKC A;  3VJ8 A;  3PH7 A;  3RMG A;  3DYH A;  5HNA A;  3M02 A;  1JFA A;  5B0J A;  5AEL A;  5CG6 A;  2ZY1 A;  3ZOU A;  2Q58 A;  2E8V A;  4NFK F;  1HXC A;  5IKA A;  3N46 F;  3P41 A;  4KVI A;  5IKH A;  3N5H F;  4LPH F;  4KPD A;  2Z50 A;  3KRP A;  3ICM A;  2E8X A;  3WCE A;  3AQC B;  4XQS F;  4MC8 A;  5AHU B;  3VJB A;  4KK2 A;  3BNX A;  3G4F A;  3LOM A;  2ZCQ A;  3EZ3 A;  2E4O A;  3KRO A;  4LZ3 A;  3PYA A;  3AQB B;  4LTZ A;  3OAB A;  1YHK A;  1FPS A;  3DYF A;  3Q1O A;  3WJK A;  3CC9 A;  1YHM A;  4RYP A;  5E8L A;  5DHK A;  2J1O A;  1HXG A;  3WEI A;  2Q9Y A;  2PS5 A;  4LFV F;  3KRP B;  4HD1 A;  4P0V A;  1YQ7 A;  3LJI A;  1WL3 A;  3Q2Q A;  4NUA A;  4DZW A;  4GP1 A;  5I1U A;  2OGD A;  3KRO B;  1KIZ A;  5DJR F;  4PVX F;  5IK6 A;  3M9U A;  3Q30 A;  3WEJ A;  1V4H A;  1JFG A;  3KRC A;  3OAB B;  4MC0 A;  4DI5 A;  2E93 A;  2AEL A;  2PS6 A;  3EFQ A;  4LLS A;  2OPM A;  3LK5 A;  4KUX A;  3QQV A;  3ICK A;  5IN8 A;  2E90 A;  3ASX A;  3AE0 A;  1N23 A;  1YHL A;  5HN7 A;  4H5E F;  5ER8 A;  3N45 F;  3N1V F;  3P5R A;  3AQ0 A;  4F6V A;  4NFI F;  4DEM F;  4DWG A;  3G4D A;  5IK9 A;  3WCH A;  1DI1 A;  5DJV F;  4KPJ A;  2F9K F;  4OGU A;  1RQI A;  3TFV A;  4JXN A;  3N3D A;  2AZK A;  3KRA A;  3LVS A;  4GAX A;  4QPF A;  4KVW A;  4N1Z F;  3KRC B;  1YV5 A;  1HM7 A;  4KQ5 A;  4LLT A;  5IVG A;  1HX9 A;  3N5J F;  4K10 A;  5IL8 A;  1RQJ A;  5EAS A;  2J1P A;  3M01 A;  1ZW5 A;  3TFN A;  3WSB A;  3N3L F;  4NKE A;  5B03 A;  3N1W F;  3P5P A;  1PS1 A;  5CG5 A;  2F89 F;  3WCD A;  5IMI A;  3PYB A;  3WCG A;  3WEF A;  3RYE A;  1UBW A;  1YYS A;  5JA0 F;  3ACX A;  3ZMC A;  5ILI A;  2I19 A;  4E1E A;  3S9V A;  3WC9 A;  3LZ9 A;  3PKO A;  3KRA B;  3B7L A;  2ONH A;  3LGZ B;  5C05 A;  3WCL A;  4KVD A;  5IL3 A;  5B01 A;  4ZQ8 A;  3VJ9 A;  3VJC A;  1WL0 A;  4LZ0 A;  2Z4Z A;  2AET A;  4UMJ A;  2E91 A;  2F92 F;  2DH4 A; 
#chains in the Genus database with same CATH topology
 2EWG A;  4WK5 A;  2Z4W A;  2H8O A;  4DHD A;  1WL2 A;  4E9Z A;  5JV1 F;  3WEG A;  3ICN A;  2Q9Z A;  4LIX A;  3LG5 A;  4OMH A;  5ILJ A;  5B0K A;  3RBM A;  3TFP A;  1YYU A;  4RXC A;  5EAU A;  2Z7I A;  1WL1 A;  5A0I A;  4KQS A;  5DHI A;  3NF2 A;  3WSA A;  4KQU A;  2E8U A;  1VG4 A;  2F94 F;  2RAH A;  3SDT A;  4JVJ F;  5ILK A;  3UCA A;  4FP4 A;  1V4J A;  3WCB A;  3ZL6 A;  4E9U A;  2OA6 A;  2O1O A;  5DIQ F;  5B0I A;  3PDE A;  1YYT A;  3KBK A;  4KVY A;  3WEK A;  5A0K A;  1UBY A;  3NRI A;  5IMP A;  2FOR A;  2PS4 A;  1VG3 A;  3CP6 A;  3ADZ A;  3S4J A;  5IK0 A;  2ZCR A;  1EZF A;  4JZB A;  4OMG A;  3SDQ A;  1V4K A;  3WE9 A;  5DGS F;  2F7M F;  1WY0 A;  3SAE A;  4NFJ F;  3SDV A;  4XQR F;  2PS7 A;  3APZ A;  5DW7 A;  3ICZ A;  4LFG A;  5AFX A;  5JV0 F;  3LGK A;  4P0X A;  3M00 A;  3IPI A;  3LEE A;  5EAT A;  4LFE A;  4GA3 A;  2F8C F;  4MC3 A;  3N0G A;  2AZL A;  4GP2 A;  4H5C F;  2ZEU A;  3OAC A;  3N0F A;  5AYP A;  1N20 A;  2ZCS A;  4LA5 A;  3V1X A;  5HN9 A;  5A0J A;  5DJP F;  5ERM A;  3KRF A;  1YYR A;  3ACW A;  3NPK A;  3SDU A;  1VG7 A;  4FJQ A;  5E8K A;  4F62 A;  4OKZ A;  2ZCO A;  3VJE A;  3V1V A;  3WCJ A;  4DXJ A;  1VG2 A;  4EA0 A;  1HM4 A;  4NG6 A;  3N49 F;  4PVY F;  1N1Z A;  5DGM F;  1V4I A;  4JZX A;  2E95 A;  3M0G A;  5B00 A;  4LXW A;  4H5D F;  5JUZ F;  1VG6 A;  3RYW A;  5B02 A;  2ZEV A;  2AZJ A;  5ILY A;  3LDW A;  2Q80 A;  4LZC A;  4Q23 A;  2Z4Y A;  3MZV A;  2Z4X A;  3OAC B;  3LLW A;  3ACY A;  5ILZ A;  4RXD A;  3NPR A;  3KRF B;  5DGN F;  5ERO A;  5ILD A;  3ID0 A;  3WJN A;  2ONG A;  2Z78 A;  1KIY A;  5B0L A;  4L2X F;  4LPG F;  3MAV A;  1UBV A;  3KB9 A;  1RTR A;  1YYQ A;  4DWB A;  3WCF A;  5ILH A;  3ZMB A;  4EA1 A;  3N6K F;  5E8H A;  4QXS F;  3WCM A;  4LOB A;  3W7F A;  5DZ2 A;  4RNQ A;  4OKM A;  2Z4V A;  3ZCD A;  4RXA A;  1HXA A;  5ERN A;  5KSX F;  3SDR A;  5IMN A;  2F8Z F;  2VF6 A;  1N1B A;  4KKM A;  4KWD A;  3WCI A;  2E8T A;  1V4E A;  2E92 A;  2E8W A;  3VJD A;  4JYX A;  4NKF A;  4LUU A;  4LTV A;  3P8L A;  5JV2 F;  4LA6 A;  2PS8 A;  3IBA A;  3LSN A;  3WCA A;  2E94 A;  4KFA A;  4N9U A;  3WEH A;  4F6X A;  1WKZ A;  1WMW A;  4XQT F;  3DYG A;  5HN8 A;  3EGT A;  3VJA A;  3V66 A;  5H9D A;  1UBX A;  4P0W A;  3TC1 A;  1N22 A;  2FTZ A;  2P1C A;  5B0M A;  4EA2 A;  3P8R A;  2Z7H A;  2Z52 A;  5IM1 A;  4JXY A;  3LMD A;  2QIS A;  3OYR A;  3WCC A;  3WJO A;  3CKE A;  2OPN A;  1N21 A;  1N24 A;  4RXE A;  1DGP A;  1YJ4 A;  3TS7 A;  2J5C A;  3BNY A;  2AEK A;  3Q2Z A;  3QKC A;  3VJ8 A;  3PH7 A;  3RMG A;  3DYH A;  5HNA A;  3M02 A;  1JFA A;  5B0J A;  5AEL A;  5CG6 A;  2ZY1 A;  3ZOU A;  2Q58 A;  2E8V A;  4NFK F;  1HXC A;  5IKA A;  3N46 F;  3P41 A;  4KVI A;  5IKH A;  3N5H F;  4LPH F;  4KPD A;  2Z50 A;  3KRP A;  3ICM A;  2E8X A;  3WCE A;  3AQC B;  4XQS F;  4MC8 A;  5AHU B;  3VJB A;  4KK2 A;  3BNX A;  3G4F A;  3LOM A;  2ZCQ A;  3EZ3 A;  2E4O A;  3KRO A;  4LZ3 A;  3PYA A;  3AQB B;  4LTZ A;  3OAB A;  1YHK A;  1FPS A;  3DYF A;  3Q1O A;  3WJK A;  3CC9 A;  1YHM A;  4RYP A;  5E8L A;  5DHK A;  2J1O A;  1HXG A;  3WEI A;  2Q9Y A;  2PS5 A;  4LFV F;  3KRP B;  4HD1 A;  4P0V A;  1YQ7 A;  3LJI A;  1WL3 A;  3Q2Q A;  4NUA A;  4DZW A;  4GP1 A;  5I1U A;  2OGD A;  3KRO B;  1KIZ A;  5DJR F;  4PVX F;  5IK6 A;  3M9U A;  3Q30 A;  3WEJ A;  1V4H A;  1JFG A;  3KRC A;  3OAB B;  4MC0 A;  4DI5 A;  2E93 A;  2AEL A;  2PS6 A;  3EFQ A;  4LLS A;  2OPM A;  3LK5 A;  4KUX A;  3QQV A;  3ICK A;  5IN8 A;  2E90 A;  3ASX A;  3AE0 A;  1N23 A;  1YHL A;  5HN7 A;  4H5E F;  5ER8 A;  3N45 F;  3N1V F;  3P5R A;  3AQ0 A;  4F6V A;  4NFI F;  4DEM F;  4DWG A;  3G4D A;  5IK9 A;  3WCH A;  1DI1 A;  5DJV F;  4KPJ A;  2F9K F;  4OGU A;  1RQI A;  3TFV A;  4JXN A;  3N3D A;  2AZK A;  3KRA A;  3LVS A;  4GAX A;  4QPF A;  4KVW A;  4N1Z F;  3KRC B;  1YV5 A;  1HM7 A;  4KQ5 A;  4LLT A;  5IVG A;  1HX9 A;  3N5J F;  4K10 A;  5IL8 A;  1RQJ A;  5EAS A;  2J1P A;  3M01 A;  1ZW5 A;  3TFN A;  3WSB A;  3N3L F;  4NKE A;  5B03 A;  3N1W F;  3P5P A;  1PS1 A;  5CG5 A;  2F89 F;  3WCD A;  5IMI A;  3PYB A;  3WCG A;  3WEF A;  3RYE A;  1UBW A;  1YYS A;  5JA0 F;  3ACX A;  3ZMC A;  5ILI A;  2I19 A;  4E1E A;  3S9V A;  3WC9 A;  3LZ9 A;  3PKO A;  3KRA B;  3B7L A;  2ONH A;  3LGZ B;  5C05 A;  3WCL A;  4KVD A;  5IL3 A;  5B01 A;  4ZQ8 A;  3VJ9 A;  3VJC A;  1WL0 A;  4LZ0 A;  2Z4Z A;  2AET A;  4UMJ A;  2E91 A;  2F92 F;  2DH4 A; 
#chains in the Genus database with same CATH homology
 2EWG A;  4WK5 A;  2Z4W A;  2H8O A;  4DHD A;  1WL2 A;  4E9Z A;  5JV1 F;  3WEG A;  3ICN A;  2Q9Z A;  4LIX A;  3LG5 A;  4OMH A;  5ILJ A;  5B0K A;  3RBM A;  3TFP A;  1YYU A;  4RXC A;  5EAU A;  2Z7I A;  1WL1 A;  5A0I A;  4KQS A;  5DHI A;  3NF2 A;  3WSA A;  4KQU A;  2E8U A;  1VG4 A;  2F94 F;  2RAH A;  3SDT A;  4JVJ F;  5ILK A;  3UCA A;  4FP4 A;  1V4J A;  3WCB A;  3ZL6 A;  4E9U A;  2OA6 A;  2O1O A;  5DIQ F;  5B0I A;  3PDE A;  1YYT A;  3KBK A;  4KVY A;  3WEK A;  5A0K A;  1UBY A;  3NRI A;  5IMP A;  2FOR A;  2PS4 A;  1VG3 A;  3CP6 A;  3ADZ A;  3S4J A;  5IK0 A;  2ZCR A;  1EZF A;  4JZB A;  4OMG A;  3SDQ A;  1V4K A;  3WE9 A;  5DGS F;  2F7M F;  1WY0 A;  3SAE A;  4NFJ F;  3SDV A;  4XQR F;  2PS7 A;  3APZ A;  5DW7 A;  3ICZ A;  4LFG A;  5AFX A;  5JV0 F;  3LGK A;  4P0X A;  3M00 A;  3IPI A;  3LEE A;  5EAT A;  4LFE A;  4GA3 A;  2F8C F;  4MC3 A;  3N0G A;  2AZL A;  4GP2 A;  4H5C F;  2ZEU A;  3OAC A;  3N0F A;  5AYP A;  1N20 A;  2ZCS A;  4LA5 A;  3V1X A;  5HN9 A;  5A0J A;  5DJP F;  5ERM A;  3KRF A;  1YYR A;  3ACW A;  3NPK A;  3SDU A;  1VG7 A;  4FJQ A;  5E8K A;  4F62 A;  4OKZ A;  2ZCO A;  3VJE A;  3V1V A;  3WCJ A;  4DXJ A;  1VG2 A;  4EA0 A;  1HM4 A;  4NG6 A;  3N49 F;  4PVY F;  1N1Z A;  5DGM F;  1V4I A;  4JZX A;  2E95 A;  3M0G A;  5B00 A;  4LXW A;  4H5D F;  5JUZ F;  1VG6 A;  3RYW A;  5B02 A;  2ZEV A;  2AZJ A;  5ILY A;  3LDW A;  2Q80 A;  4LZC A;  4Q23 A;  2Z4Y A;  3MZV A;  2Z4X A;  3OAC B;  3LLW A;  3ACY A;  5ILZ A;  4RXD A;  3NPR A;  3KRF B;  5DGN F;  5ERO A;  5ILD A;  3ID0 A;  3WJN A;  2ONG A;  2Z78 A;  1KIY A;  5B0L A;  4L2X F;  4LPG F;  3MAV A;  1UBV A;  3KB9 A;  1RTR A;  1YYQ A;  4DWB A;  3WCF A;  5ILH A;  3ZMB A;  4EA1 A;  3N6K F;  5E8H A;  4QXS F;  3WCM A;  4LOB A;  3W7F A;  5DZ2 A;  4RNQ A;  4OKM A;  2Z4V A;  3ZCD A;  4RXA A;  1HXA A;  5ERN A;  5KSX F;  3SDR A;  5IMN A;  2F8Z F;  2VF6 A;  1N1B A;  4KKM A;  4KWD A;  3WCI A;  2E8T A;  1V4E A;  2E92 A;  2E8W A;  3VJD A;  4JYX A;  4NKF A;  4LUU A;  4LTV A;  3P8L A;  5JV2 F;  4LA6 A;  2PS8 A;  3IBA A;  3LSN A;  3WCA A;  2E94 A;  4KFA A;  4N9U A;  3WEH A;  4F6X A;  1WKZ A;  1WMW A;  4XQT F;  3DYG A;  5HN8 A;  3EGT A;  3VJA A;  3V66 A;  5H9D A;  1UBX A;  4P0W A;  3TC1 A;  1N22 A;  2FTZ A;  2P1C A;  5B0M A;  4EA2 A;  3P8R A;  2Z7H A;  2Z52 A;  5IM1 A;  4JXY A;  3LMD A;  2QIS A;  3OYR A;  3WCC A;  3WJO A;  3CKE A;  2OPN A;  1N21 A;  1N24 A;  4RXE A;  1DGP A;  1YJ4 A;  3TS7 A;  2J5C A;  3BNY A;  2AEK A;  3Q2Z A;  3QKC A;  3VJ8 A;  3PH7 A;  3RMG A;  3DYH A;  5HNA A;  3M02 A;  1JFA A;  5B0J A;  5AEL A;  5CG6 A;  2ZY1 A;  3ZOU A;  2Q58 A;  2E8V A;  4NFK F;  1HXC A;  5IKA A;  3N46 F;  3P41 A;  4KVI A;  5IKH A;  3N5H F;  4LPH F;  4KPD A;  2Z50 A;  3KRP A;  3ICM A;  2E8X A;  3WCE A;  3AQC B;  4XQS F;  4MC8 A;  5AHU B;  3VJB A;  4KK2 A;  3BNX A;  3G4F A;  3LOM A;  2ZCQ A;  3EZ3 A;  2E4O A;  3KRO A;  4LZ3 A;  3PYA A;  3AQB B;  4LTZ A;  3OAB A;  1YHK A;  1FPS A;  3DYF A;  3Q1O A;  3WJK A;  3CC9 A;  1YHM A;  4RYP A;  5E8L A;  5DHK A;  2J1O A;  1HXG A;  3WEI A;  2Q9Y A;  2PS5 A;  4LFV F;  3KRP B;  4HD1 A;  4P0V A;  1YQ7 A;  3LJI A;  1WL3 A;  3Q2Q A;  4NUA A;  4DZW A;  4GP1 A;  5I1U A;  2OGD A;  3KRO B;  1KIZ A;  5DJR F;  4PVX F;  5IK6 A;  3M9U A;  3Q30 A;  3WEJ A;  1V4H A;  1JFG A;  3KRC A;  3OAB B;  4MC0 A;  4DI5 A;  2E93 A;  2AEL A;  2PS6 A;  3EFQ A;  4LLS A;  2OPM A;  3LK5 A;  4KUX A;  3QQV A;  3ICK A;  5IN8 A;  2E90 A;  3ASX A;  3AE0 A;  1N23 A;  1YHL A;  5HN7 A;  4H5E F;  5ER8 A;  3N45 F;  3N1V F;  3P5R A;  3AQ0 A;  4F6V A;  4NFI F;  4DEM F;  4DWG A;  3G4D A;  5IK9 A;  3WCH A;  1DI1 A;  5DJV F;  4KPJ A;  2F9K F;  4OGU A;  1RQI A;  3TFV A;  4JXN A;  3N3D A;  2AZK A;  3KRA A;  3LVS A;  4GAX A;  4QPF A;  4KVW A;  4N1Z F;  3KRC B;  1YV5 A;  1HM7 A;  4KQ5 A;  4LLT A;  5IVG A;  1HX9 A;  3N5J F;  4K10 A;  5IL8 A;  1RQJ A;  5EAS A;  2J1P A;  3M01 A;  1ZW5 A;  3TFN A;  3WSB A;  3N3L F;  4NKE A;  5B03 A;  3N1W F;  3P5P A;  1PS1 A;  5CG5 A;  2F89 F;  3WCD A;  5IMI A;  3PYB A;  3WCG A;  3WEF A;  3RYE A;  1UBW A;  1YYS A;  5JA0 F;  3ACX A;  3ZMC A;  5ILI A;  2I19 A;  4E1E A;  3S9V A;  3WC9 A;  3LZ9 A;  3PKO A;  3KRA B;  3B7L A;  2ONH A;  3LGZ B;  5C05 A;  3WCL A;  4KVD A;  5IL3 A;  5B01 A;  4ZQ8 A;  3VJ9 A;  3VJC A;  1WL0 A;  4LZ0 A;  2Z4Z A;  2AET A;  4UMJ A;  2E91 A;  2F92 F;  2DH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...