3ACYA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bph-702
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Mechanism of action and inhibition of dehydrosqualene synthase
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 118
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3acyA00
3OACB 2Q9YA 4RXCA 5DHKA 2O1OA 3UCAA 2Z52A 4KKMA 3TFPA 2EWGA 3AE0A 3KB9A 5B02A 3VJBA 3WJOA 2E8UA 2PS5A 2F94F 3ZMCA 2P1CA 3TFVA 4DHDA 2OPMA 2F8CF 3G4DA 3IPIA 4DI5A 1YHLA 2F89F 4LZ0A 4LTVA 1V4EA 4KQSA 1HXGA 5EAUA 2ZCQA 3P8LA 4E9ZA 3P41A 1N23A 5B0IA 2I19A 5DJVF 3P5RA 3WCAA 1HM7A 4F6XA 4KVDA 4RXAA 5JV1F 3WEHA 4FP4A 4XQTF 3AQBB 4DEMF 3DYGA 4NUAA 4E1EA 3N1VF 3Q30A 4LA5A 3LVSA 3OACA 3LDWA 4QXSF 5H9DA 1YYSA 3ACXA 5DJPF 5DHIA 3WEKA 4PVXF 5A0IA 4XQSF 3N5JF 3LGKA 4LUUA 3N1WF 3LLWA 3ADZA 2AEKA 3KBKA 5A0JA 3VJDA 3Q1OA 2E8WA 3W7FA 4KVYA 4QPFA 4LA6A 1UBYA 2PS8A 3PYAA 3KRAA 4LIXA 1PS1A 2Z7HA 4RXEA 4NG6A 1RQJA 4Q23A 5IL3A 3VJEA 3ZCDA 4KK2A 3VJ8A 3OYRA 5HNAA 2AZJA 4E9UA 5IMIA 2E90A 2E8XA 2RAHA 3NF2A 4MC8A 4RYPA 2F9KF 3AQCB 1ZW5A 1N22A 3AQ0A 3V1XA 5HN7A 4LZCA 2E4OA 4XQRF 2Z4VA 2Z4WA 3WCFA 1WL0A 4KPDA 3LJIA 4LFEA 3EGTA 1VG7A 4NKFA 4OMHA 4EA2A 4FJQA 3VJCA 4OKMA 1WL2A 4JXYA 3DYHA 5JV0F 1UBWA 3N0GA 5IK0A 3LOMA 5B0JA 1YYTA 3EZ3A 3PKOA 3M0GA 3N45F 4MC0A 3CP6A 1KIYA 4RXDA 3WCBA 5B0MA 3PH7A 4JXNA 3ACWA 3ICNA 3KRAB 3N3DA 3NPRA 2ZCOA 4KUXA 2ONHA 2J1OA 4LLSA 3WEFA 3RMGA 3ICKA 4KPJA 5KSXF 3KRPB 1EZFA 1V4JA 5IK6A 3WE9A 5ERMA 4DWBA 1WKZA 4P0VA 4JYXA 5ER8A 5AFXA 3VJAA 2ZCSA 5DJRF 2VF6A 4GP2A 3M01A 4H5CF 5I1UA 1N20A 3MAVA 2PS7A 4LPGF 4K10A 5EROA 4UMJA 3BNYA 2F7MF 3N46F 4N9UA 3SDQA 3WCJA 5AYPA 5C05A 1DI1A 1JFAA 4N1ZF 5DZ2A 3ZMBA 3SAEA 3S4JA 1UBXA 3N3LF 5B00A 5IMNA 5HN8A 5CG6A 5DW7A 5ILJA 1YJ4A 3NRIA 2Z78A 3ICMA 5ILDA 3LK5A 4RNQA 2Z4YA 5IL8A 5EATA 3VJ9A 2Z50A 3ZOUA 3N6KF 3P5PA 2OA6A 3ICZA 4LLTA 4LOBA 3KRFB 3KRPA 2E8VA 3TFNA 3WJKA 2J1PA 4WK5A 5E8KA 1V4KA 2F92F 2E8TA 5AELA 4OMGA 3WCHA 5AHUB 1VG3A 3IBAA 5EASA 2H8OA 4NFJF 1HXCA 4JZBA 4NFIF 2QISA 2ZY1A 4OGUA 5IMPA 2E95A 3M02A 2Q80A 1JFGA 1HXAA 2ZEVA 2ZEUA 5ERNA 1FPSA 1WL3A 3NPKA 1VG6A 1WY0A 3RBMA 3SDTA 2OGDA 4KFAA 1YQ7A 3CC9A 5IM1A 3WCCA 4NFKF 1HX9A 3V1VA 1N1ZA 3EFQA 1YHMA 3WSAA 5B0KA 3DYFA 4NKEA 3WCMA 3WCDA 4EA0A 5ILZA 3P8RA 4LXWA 3WCEA 4KWDA 5ILHA 2Z4ZA 5JA0F 5DGMF 3OABB 4GP1A 4LTZA 5ILYA 5IVGA 5B0LA 4KVIA 3B7LA 2PS6A 3KROB 3KRFA 3LSNA 3N5HF 1V4HA 3G4FA 3LGZB 3WSBA 2ZCRA 4HD1A 5IKAA 3V66A 3LZ9A 4GA3A 5JUZF 4H5DF 1UBVA 4EA1A 5DGSF 5B01A 2Q58A 4LFGA 4F62A 4DXJA 2J5CA 3KRCA 4GAXA 2OPNA 4ZQ8A 1RQIA 2AETA 3MZVA 5DIQF 2FTZA 3SDUA 3N0FA 3WCIA 1YHKA 3SDRA 3N49F 4KVWA 3Q2ZA 1N24A 3PYBA 4OKZA 3SDVA 3ZL6A 2AELA 2DH4A 3OABA 5IN8A 3ID0A 1VG4A 3LMDA 2FORA 4DZWA 3QKCA 4LPHF 5CG5A 1YYQA 5HN9A 3WC9A 1WL1A 5IKHA 3KROA 4JZXA 5ILKA 3CKEA 4LZ3A 4F6VA 5IK9A 2E91A 3PDEA 3WCGA 3Q2QA 2F8ZF 2Z7IA 1YV5A 4L2XF 3LEEA 5JV2F 4P0XA 3S9VA 1N1BA 2ONGA 4LFVF 3WEJA 5E8HA 5DGNF 3TC1A 3TS7A 3WCLA 3ACYA 3RYEA 3RYWA 2AZLA 4H5EF 2E93A 2Q9ZA 4MC3A 2Z4XA 3BNXA 1WMWA 5E8LA 4PVYF 3LG5A 2E92A 5B03A 1V4IA 4P0WA 3M9UA 4KQ5A 2E94A 1KIZA 4JVJF 1DGPA 1YYUA 1YYRA 2AZKA 5A0KA 3ASXA 3WEIA 3KRCB 3APZA 5ILIA 1HM4A 3QQVA 4KQUA 3M00A 1VG2A 1N21A 4DWGA 2PS4A 3WJNA 1RTRA 3WEGA
chains in the Genus database with same CATH superfamily
3OACB 2Q9YA 4RXCA 5DHKA 2O1OA 3UCAA 2Z52A 4KKMA 3TFPA 2EWGA 3AE0A 3KB9A 5B02A 3VJBA 3WJOA 2E8UA 2PS5A 2F94F 3ZMCA 2P1CA 3TFVA 4DHDA 2OPMA 2F8CF 3G4DA 3IPIA 4DI5A 1YHLA 2F89F 4LZ0A 4LTVA 1V4EA 4KQSA 1HXGA 5EAUA 2ZCQA 3P8LA 4E9ZA 3P41A 1N23A 5B0IA 2I19A 5DJVF 3P5RA 3WCAA 1HM7A 4F6XA 4KVDA 4RXAA 5JV1F 3WEHA 4FP4A 4XQTF 3AQBB 4DEMF 3DYGA 4NUAA 4E1EA 3N1VF 3Q30A 4LA5A 3LVSA 3OACA 3LDWA 4QXSF 5H9DA 1YYSA 3ACXA 5DJPF 5DHIA 3WEKA 4PVXF 5A0IA 4XQSF 3N5JF 3LGKA 4LUUA 3N1WF 3LLWA 3ADZA 2AEKA 3KBKA 5A0JA 3VJDA 3Q1OA 2E8WA 3W7FA 4KVYA 4QPFA 4LA6A 1UBYA 2PS8A 3PYAA 3KRAA 4LIXA 1PS1A 2Z7HA 4RXEA 4NG6A 1RQJA 4Q23A 5IL3A 3VJEA 3ZCDA 4KK2A 3VJ8A 3OYRA 5HNAA 2AZJA 4E9UA 5IMIA 2E90A 2E8XA 2RAHA 3NF2A 4MC8A 4RYPA 2F9KF 3AQCB 1ZW5A 1N22A 3AQ0A 3V1XA 5HN7A 4LZCA 2E4OA 4XQRF 2Z4VA 2Z4WA 3WCFA 1WL0A 4KPDA 3LJIA 4LFEA 3EGTA 1VG7A 4NKFA 4OMHA 4EA2A 4FJQA 3VJCA 4OKMA 1WL2A 4JXYA 3DYHA 5JV0F 1UBWA 3N0GA 5IK0A 3LOMA 5B0JA 1YYTA 3EZ3A 3PKOA 3M0GA 3N45F 4MC0A 3CP6A 1KIYA 4RXDA 3WCBA 5B0MA 3PH7A 4JXNA 3ACWA 3ICNA 3KRAB 3N3DA 3NPRA 2ZCOA 4KUXA 2ONHA 2J1OA 4LLSA 3WEFA 3RMGA 3ICKA 4KPJA 5KSXF 3KRPB 1EZFA 1V4JA 5IK6A 3WE9A 5ERMA 4DWBA 1WKZA 4P0VA 4JYXA 5ER8A 5AFXA 3VJAA 2ZCSA 5DJRF 2VF6A 4GP2A 3M01A 4H5CF 5I1UA 1N20A 3MAVA 2PS7A 4LPGF 4K10A 5EROA 4UMJA 3BNYA 2F7MF 3N46F 4N9UA 3SDQA 3WCJA 5AYPA 5C05A 1DI1A 1JFAA 4N1ZF 5DZ2A 3ZMBA 3SAEA 3S4JA 1UBXA 3N3LF 5B00A 5IMNA 5HN8A 5CG6A 5DW7A 5ILJA 1YJ4A 3NRIA 2Z78A 3ICMA 5ILDA 3LK5A 4RNQA 2Z4YA 5IL8A 5EATA 3VJ9A 2Z50A 3ZOUA 3N6KF 3P5PA 2OA6A 3ICZA 4LLTA 4LOBA 3KRFB 3KRPA 2E8VA 3TFNA 3WJKA 2J1PA 4WK5A 5E8KA 1V4KA 2F92F 2E8TA 5AELA 4OMGA 3WCHA 5AHUB 1VG3A 3IBAA 5EASA 2H8OA 4NFJF 1HXCA 4JZBA 4NFIF 2QISA 2ZY1A 4OGUA 5IMPA 2E95A 3M02A 2Q80A 1JFGA 1HXAA 2ZEVA 2ZEUA 5ERNA 1FPSA 1WL3A 3NPKA 1VG6A 1WY0A 3RBMA 3SDTA 2OGDA 4KFAA 1YQ7A 3CC9A 5IM1A 3WCCA 4NFKF 1HX9A 3V1VA 1N1ZA 3EFQA 1YHMA 3WSAA 5B0KA 3DYFA 4NKEA 3WCMA 3WCDA 4EA0A 5ILZA 3P8RA 4LXWA 3WCEA 4KWDA 5ILHA 2Z4ZA 5JA0F 5DGMF 3OABB 4GP1A 4LTZA 5ILYA 5IVGA 5B0LA 4KVIA 3B7LA 2PS6A 3KROB 3KRFA 3LSNA 3N5HF 1V4HA 3G4FA 3LGZB 3WSBA 2ZCRA 4HD1A 5IKAA 3V66A 3LZ9A 4GA3A 5JUZF 4H5DF 1UBVA 4EA1A 5DGSF 5B01A 2Q58A 4LFGA 4F62A 4DXJA 2J5CA 3KRCA 4GAXA 2OPNA 4ZQ8A 1RQIA 2AETA 3MZVA 5DIQF 2FTZA 3SDUA 3N0FA 3WCIA 1YHKA 3SDRA 3N49F 4KVWA 3Q2ZA 1N24A 3PYBA 4OKZA 3SDVA 3ZL6A 2AELA 2DH4A 3OABA 5IN8A 3ID0A 1VG4A 3LMDA 2FORA 4DZWA 3QKCA 4LPHF 5CG5A 1YYQA 5HN9A 3WC9A 1WL1A 5IKHA 3KROA 4JZXA 5ILKA 3CKEA 4LZ3A 4F6VA 5IK9A 2E91A 3PDEA 3WCGA 3Q2QA 2F8ZF 2Z7IA 1YV5A 4L2XF 3LEEA 5JV2F 4P0XA 3S9VA 1N1BA 2ONGA 4LFVF 3WEJA 5E8HA 5DGNF 3TC1A 3TS7A 3WCLA 3ACYA 3RYEA 3RYWA 2AZLA 4H5EF 2E93A 2Q9ZA 4MC3A 2Z4XA 3BNXA 1WMWA 5E8LA 4PVYF 3LG5A 2E92A 5B03A 1V4IA 4P0WA 3M9UA 4KQ5A 2E94A 1KIZA 4JVJF 1DGPA 1YYUA 1YYRA 2AZKA 5A0KA 3ASXA 3WEIA 3KRCB 3APZA 5ILIA 1HM4A 3QQVA 4KQUA 3M00A 1VG2A 1N21A 4DWGA 2PS4A 3WJNA 1RTRA 3WEGA
chains in the Genus database with same CATH topology
3OACB 2Q9YA 4RXCA 5DHKA 2O1OA 3UCAA 2Z52A 4KKMA 3TFPA 2EWGA 3AE0A 3KB9A 5B02A 3VJBA 3WJOA 2E8UA 2PS5A 2F94F 3ZMCA 2P1CA 3TFVA 4DHDA 2OPMA 2F8CF 3G4DA 3IPIA 4DI5A 1YHLA 2F89F 4LZ0A 4LTVA 1V4EA 4KQSA 1HXGA 5EAUA 2ZCQA 3P8LA 4E9ZA 3P41A 1N23A 5B0IA 2I19A 5DJVF 3P5RA 3WCAA 1HM7A 4F6XA 4KVDA 4RXAA 5JV1F 3WEHA 4FP4A 4XQTF 3AQBB 4DEMF 3DYGA 4NUAA 4E1EA 3N1VF 3Q30A 4LA5A 3LVSA 3OACA 3LDWA 4QXSF 5H9DA 1YYSA 3ACXA 5DJPF 5DHIA 3WEKA 4PVXF 5A0IA 4XQSF 3N5JF 3LGKA 4LUUA 3N1WF 3LLWA 3ADZA 2AEKA 3KBKA 5A0JA 3VJDA 3Q1OA 2E8WA 3W7FA 4KVYA 4QPFA 4LA6A 1UBYA 2PS8A 3PYAA 3KRAA 4LIXA 1PS1A 2Z7HA 4RXEA 4NG6A 1RQJA 4Q23A 5IL3A 3VJEA 3ZCDA 4KK2A 3VJ8A 3OYRA 5HNAA 2AZJA 4E9UA 5IMIA 2E90A 2E8XA 2RAHA 3NF2A 4MC8A 4RYPA 2F9KF 3AQCB 1ZW5A 1N22A 3AQ0A 3V1XA 5HN7A 4LZCA 2E4OA 4XQRF 2Z4VA 2Z4WA 3WCFA 1WL0A 4KPDA 3LJIA 4LFEA 3EGTA 1VG7A 4NKFA 4OMHA 4EA2A 4FJQA 3VJCA 4OKMA 1WL2A 4JXYA 3DYHA 5JV0F 1UBWA 3N0GA 5IK0A 3LOMA 5B0JA 1YYTA 3EZ3A 3PKOA 3M0GA 3N45F 4MC0A 3CP6A 1KIYA 4RXDA 3WCBA 5B0MA 3PH7A 4JXNA 3ACWA 3ICNA 3KRAB 3N3DA 3NPRA 2ZCOA 4KUXA 2ONHA 2J1OA 4LLSA 3WEFA 3RMGA 3ICKA 4KPJA 5KSXF 3KRPB 1EZFA 1V4JA 5IK6A 3WE9A 5ERMA 4DWBA 1WKZA 4P0VA 4JYXA 5ER8A 5AFXA 3VJAA 2ZCSA 5DJRF 2VF6A 4GP2A 3M01A 4H5CF 5I1UA 1N20A 3MAVA 2PS7A 4LPGF 4K10A 5EROA 4UMJA 3BNYA 2F7MF 3N46F 4N9UA 3SDQA 3WCJA 5AYPA 5C05A 1DI1A 1JFAA 4N1ZF 5DZ2A 3ZMBA 3SAEA 3S4JA 1UBXA 3N3LF 5B00A 5IMNA 5HN8A 5CG6A 5DW7A 5ILJA 1YJ4A 3NRIA 2Z78A 3ICMA 5ILDA 3LK5A 4RNQA 2Z4YA 5IL8A 5EATA 3VJ9A 2Z50A 3ZOUA 3N6KF 3P5PA 2OA6A 3ICZA 4LLTA 4LOBA 3KRFB 3KRPA 2E8VA 3TFNA 3WJKA 2J1PA 4WK5A 5E8KA 1V4KA 2F92F 2E8TA 5AELA 4OMGA 3WCHA 5AHUB 1VG3A 3IBAA 5EASA 2H8OA 4NFJF 1HXCA 4JZBA 4NFIF 2QISA 2ZY1A 4OGUA 5IMPA 2E95A 3M02A 2Q80A 1JFGA 1HXAA 2ZEVA 2ZEUA 5ERNA 1FPSA 1WL3A 3NPKA 1VG6A 1WY0A 3RBMA 3SDTA 2OGDA 4KFAA 1YQ7A 3CC9A 5IM1A 3WCCA 4NFKF 1HX9A 3V1VA 1N1ZA 3EFQA 1YHMA 3WSAA 5B0KA 3DYFA 4NKEA 3WCMA 3WCDA 4EA0A 5ILZA 3P8RA 4LXWA 3WCEA 4KWDA 5ILHA 2Z4ZA 5JA0F 5DGMF 3OABB 4GP1A 4LTZA 5ILYA 5IVGA 5B0LA 4KVIA 3B7LA 2PS6A 3KROB 3KRFA 3LSNA 3N5HF 1V4HA 3G4FA 3LGZB 3WSBA 2ZCRA 4HD1A 5IKAA 3V66A 3LZ9A 4GA3A 5JUZF 4H5DF 1UBVA 4EA1A 5DGSF 5B01A 2Q58A 4LFGA 4F62A 4DXJA 2J5CA 3KRCA 4GAXA 2OPNA 4ZQ8A 1RQIA 2AETA 3MZVA 5DIQF 2FTZA 3SDUA 3N0FA 3WCIA 1YHKA 3SDRA 3N49F 4KVWA 3Q2ZA 1N24A 3PYBA 4OKZA 3SDVA 3ZL6A 2AELA 2DH4A 3OABA 5IN8A 3ID0A 1VG4A 3LMDA 2FORA 4DZWA 3QKCA 4LPHF 5CG5A 1YYQA 5HN9A 3WC9A 1WL1A 5IKHA 3KROA 4JZXA 5ILKA 3CKEA 4LZ3A 4F6VA 5IK9A 2E91A 3PDEA 3WCGA 3Q2QA 2F8ZF 2Z7IA 1YV5A 4L2XF 3LEEA 5JV2F 4P0XA 3S9VA 1N1BA 2ONGA 4LFVF 3WEJA 5E8HA 5DGNF 3TC1A 3TS7A 3WCLA 3ACYA 3RYEA 3RYWA 2AZLA 4H5EF 2E93A 2Q9ZA 4MC3A 2Z4XA 3BNXA 1WMWA 5E8LA 4PVYF 3LG5A 2E92A 5B03A 1V4IA 4P0WA 3M9UA 4KQ5A 2E94A 1KIZA 4JVJF 1DGPA 1YYUA 1YYRA 2AZKA 5A0KA 3ASXA 3WEIA 3KRCB 3APZA 5ILIA 1HM4A 3QQVA 4KQUA 3M00A 1VG2A 1N21A 4DWGA 2PS4A 3WJNA 1RTRA 3WEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OAC B;  2Q9Y A;  4RXC A;  5DHK A;  2O1O A;  3UCA A;  2Z52 A;  4KKM A;  3TFP A;  2EWG A;  3AE0 A;  3KB9 A;  5B02 A;  3VJB A;  3WJO A;  2E8U A;  2PS5 A;  2F94 F;  3ZMC A;  2P1C A;  3TFV A;  4DHD A;  2OPM A;  2F8C F;  3G4D A;  3IPI A;  4DI5 A;  1YHL A;  2F89 F;  4LZ0 A;  4LTV A;  1V4E A;  4KQS A;  1HXG A;  5EAU A;  2ZCQ A;  3P8L A;  4E9Z A;  3P41 A;  1N23 A;  5B0I A;  2I19 A;  5DJV F;  3P5R A;  3WCA A;  1HM7 A;  4F6X A;  4KVD A;  4RXA A;  5JV1 F;  3WEH A;  4FP4 A;  4XQT F;  3AQB B;  4DEM F;  3DYG A;  4NUA A;  4E1E A;  3N1V F;  3Q30 A;  4LA5 A;  3LVS A;  3OAC A;  3LDW A;  4QXS F;  5H9D A;  1YYS A;  3ACX A;  5DJP F;  5DHI A;  3WEK A;  4PVX F;  5A0I A;  4XQS F;  3N5J F;  3LGK A;  4LUU A;  3N1W F;  3LLW A;  3ADZ A;  2AEK A;  3KBK A;  5A0J A;  3VJD A;  3Q1O A;  2E8W A;  3W7F A;  4KVY A;  4QPF A;  4LA6 A;  1UBY A;  2PS8 A;  3PYA A;  3KRA A;  4LIX A;  1PS1 A;  2Z7H A;  4RXE A;  4NG6 A;  1RQJ A;  4Q23 A;  5IL3 A;  3VJE A;  3ZCD A;  4KK2 A;  3VJ8 A;  3OYR A;  5HNA A;  2AZJ A;  4E9U A;  5IMI A;  2E90 A;  2E8X A;  2RAH A;  3NF2 A;  4MC8 A;  4RYP A;  2F9K F;  3AQC B;  1ZW5 A;  1N22 A;  3AQ0 A;  3V1X A;  5HN7 A;  4LZC A;  2E4O A;  4XQR F;  2Z4V A;  2Z4W A;  3WCF A;  1WL0 A;  4KPD A;  3LJI A;  4LFE A;  3EGT A;  1VG7 A;  4NKF A;  4OMH A;  4EA2 A;  4FJQ A;  3VJC A;  4OKM A;  1WL2 A;  4JXY A;  3DYH A;  5JV0 F;  1UBW A;  3N0G A;  5IK0 A;  3LOM A;  5B0J A;  1YYT A;  3EZ3 A;  3PKO A;  3M0G A;  3N45 F;  4MC0 A;  3CP6 A;  1KIY A;  4RXD A;  3WCB A;  5B0M A;  3PH7 A;  4JXN A;  3ACW A;  3ICN A;  3KRA B;  3N3D A;  3NPR A;  2ZCO A;  4KUX A;  2ONH A;  2J1O A;  4LLS A;  3WEF A;  3RMG A;  3ICK A;  4KPJ A;  5KSX F;  3KRP B;  1EZF A;  1V4J A;  5IK6 A;  3WE9 A;  5ERM A;  4DWB A;  1WKZ A;  4P0V A;  4JYX A;  5ER8 A;  5AFX A;  3VJA A;  2ZCS A;  5DJR F;  2VF6 A;  4GP2 A;  3M01 A;  4H5C F;  5I1U A;  1N20 A;  3MAV A;  2PS7 A;  4LPG F;  4K10 A;  5ERO A;  4UMJ A;  3BNY A;  2F7M F;  3N46 F;  4N9U A;  3SDQ A;  3WCJ A;  5AYP A;  5C05 A;  1DI1 A;  1JFA A;  4N1Z F;  5DZ2 A;  3ZMB A;  3SAE A;  3S4J A;  1UBX A;  3N3L F;  5B00 A;  5IMN A;  5HN8 A;  5CG6 A;  5DW7 A;  5ILJ A;  1YJ4 A;  3NRI A;  2Z78 A;  3ICM A;  5ILD A;  3LK5 A;  4RNQ A;  2Z4Y A;  5IL8 A;  5EAT A;  3VJ9 A;  2Z50 A;  3ZOU A;  3N6K F;  3P5P A;  2OA6 A;  3ICZ A;  4LLT A;  4LOB A;  3KRF B;  3KRP A;  2E8V A;  3TFN A;  3WJK A;  2J1P A;  4WK5 A;  5E8K A;  1V4K A;  2F92 F;  2E8T A;  5AEL A;  4OMG A;  3WCH A;  5AHU B;  1VG3 A;  3IBA A;  5EAS A;  2H8O A;  4NFJ F;  1HXC A;  4JZB A;  4NFI F;  2QIS A;  2ZY1 A;  4OGU A;  5IMP A;  2E95 A;  3M02 A;  2Q80 A;  1JFG A;  1HXA A;  2ZEV A;  2ZEU A;  5ERN A;  1FPS A;  1WL3 A;  3NPK A;  1VG6 A;  1WY0 A;  3RBM A;  3SDT A;  2OGD A;  4KFA A;  1YQ7 A;  3CC9 A;  5IM1 A;  3WCC A;  4NFK F;  1HX9 A;  3V1V A;  1N1Z A;  3EFQ A;  1YHM A;  3WSA A;  5B0K A;  3DYF A;  4NKE A;  3WCM A;  3WCD A;  4EA0 A;  5ILZ A;  3P8R A;  4LXW A;  3WCE A;  4KWD A;  5ILH A;  2Z4Z A;  5JA0 F;  5DGM F;  3OAB B;  4GP1 A;  4LTZ A;  5ILY A;  5IVG A;  5B0L A;  4KVI A;  3B7L A;  2PS6 A;  3KRO B;  3KRF A;  3LSN A;  3N5H F;  1V4H A;  3G4F A;  3LGZ B;  3WSB A;  2ZCR A;  4HD1 A;  5IKA A;  3V66 A;  3LZ9 A;  4GA3 A;  5JUZ F;  4H5D F;  1UBV A;  4EA1 A;  5DGS F;  5B01 A;  2Q58 A;  4LFG A;  4F62 A;  4DXJ A;  2J5C A;  3KRC A;  4GAX A;  2OPN A;  4ZQ8 A;  1RQI A;  2AET A;  3MZV A;  5DIQ F;  2FTZ A;  3SDU A;  3N0F A;  3WCI A;  1YHK A;  3SDR A;  3N49 F;  4KVW A;  3Q2Z A;  1N24 A;  3PYB A;  4OKZ A;  3SDV A;  3ZL6 A;  2AEL A;  2DH4 A;  3OAB A;  5IN8 A;  3ID0 A;  1VG4 A;  3LMD A;  2FOR A;  4DZW A;  3QKC A;  4LPH F;  5CG5 A;  1YYQ A;  5HN9 A;  3WC9 A;  1WL1 A;  5IKH A;  3KRO A;  4JZX A;  5ILK A;  3CKE A;  4LZ3 A;  4F6V A;  5IK9 A;  2E91 A;  3PDE A;  3WCG A;  3Q2Q A;  2F8Z F;  2Z7I A;  1YV5 A;  4L2X F;  3LEE A;  5JV2 F;  4P0X A;  3S9V A;  1N1B A;  2ONG A;  4LFV F;  3WEJ A;  5E8H A;  5DGN F;  3TC1 A;  3TS7 A;  3WCL A;  3ACY A;  3RYE A;  3RYW A;  2AZL A;  4H5E F;  2E93 A;  2Q9Z A;  4MC3 A;  2Z4X A;  3BNX A;  1WMW A;  5E8L A;  4PVY F;  3LG5 A;  2E92 A;  5B03 A;  1V4I A;  4P0W A;  3M9U A;  4KQ5 A;  2E94 A;  1KIZ A;  4JVJ F;  1DGP A;  1YYU A;  1YYR A;  2AZK A;  5A0K A;  3ASX A;  3WEI A;  3KRC B;  3APZ A;  5ILI A;  1HM4 A;  3QQV A;  4KQU A;  3M00 A;  1VG2 A;  1N21 A;  4DWG A;  2PS4 A;  3WJN A;  1RTR A;  3WEG A; 
#chains in the Genus database with same CATH topology
 3OAC B;  2Q9Y A;  4RXC A;  5DHK A;  2O1O A;  3UCA A;  2Z52 A;  4KKM A;  3TFP A;  2EWG A;  3AE0 A;  3KB9 A;  5B02 A;  3VJB A;  3WJO A;  2E8U A;  2PS5 A;  2F94 F;  3ZMC A;  2P1C A;  3TFV A;  4DHD A;  2OPM A;  2F8C F;  3G4D A;  3IPI A;  4DI5 A;  1YHL A;  2F89 F;  4LZ0 A;  4LTV A;  1V4E A;  4KQS A;  1HXG A;  5EAU A;  2ZCQ A;  3P8L A;  4E9Z A;  3P41 A;  1N23 A;  5B0I A;  2I19 A;  5DJV F;  3P5R A;  3WCA A;  1HM7 A;  4F6X A;  4KVD A;  4RXA A;  5JV1 F;  3WEH A;  4FP4 A;  4XQT F;  3AQB B;  4DEM F;  3DYG A;  4NUA A;  4E1E A;  3N1V F;  3Q30 A;  4LA5 A;  3LVS A;  3OAC A;  3LDW A;  4QXS F;  5H9D A;  1YYS A;  3ACX A;  5DJP F;  5DHI A;  3WEK A;  4PVX F;  5A0I A;  4XQS F;  3N5J F;  3LGK A;  4LUU A;  3N1W F;  3LLW A;  3ADZ A;  2AEK A;  3KBK A;  5A0J A;  3VJD A;  3Q1O A;  2E8W A;  3W7F A;  4KVY A;  4QPF A;  4LA6 A;  1UBY A;  2PS8 A;  3PYA A;  3KRA A;  4LIX A;  1PS1 A;  2Z7H A;  4RXE A;  4NG6 A;  1RQJ A;  4Q23 A;  5IL3 A;  3VJE A;  3ZCD A;  4KK2 A;  3VJ8 A;  3OYR A;  5HNA A;  2AZJ A;  4E9U A;  5IMI A;  2E90 A;  2E8X A;  2RAH A;  3NF2 A;  4MC8 A;  4RYP A;  2F9K F;  3AQC B;  1ZW5 A;  1N22 A;  3AQ0 A;  3V1X A;  5HN7 A;  4LZC A;  2E4O A;  4XQR F;  2Z4V A;  2Z4W A;  3WCF A;  1WL0 A;  4KPD A;  3LJI A;  4LFE A;  3EGT A;  1VG7 A;  4NKF A;  4OMH A;  4EA2 A;  4FJQ A;  3VJC A;  4OKM A;  1WL2 A;  4JXY A;  3DYH A;  5JV0 F;  1UBW A;  3N0G A;  5IK0 A;  3LOM A;  5B0J A;  1YYT A;  3EZ3 A;  3PKO A;  3M0G A;  3N45 F;  4MC0 A;  3CP6 A;  1KIY A;  4RXD A;  3WCB A;  5B0M A;  3PH7 A;  4JXN A;  3ACW A;  3ICN A;  3KRA B;  3N3D A;  3NPR A;  2ZCO A;  4KUX A;  2ONH A;  2J1O A;  4LLS A;  3WEF A;  3RMG A;  3ICK A;  4KPJ A;  5KSX F;  3KRP B;  1EZF A;  1V4J A;  5IK6 A;  3WE9 A;  5ERM A;  4DWB A;  1WKZ A;  4P0V A;  4JYX A;  5ER8 A;  5AFX A;  3VJA A;  2ZCS A;  5DJR F;  2VF6 A;  4GP2 A;  3M01 A;  4H5C F;  5I1U A;  1N20 A;  3MAV A;  2PS7 A;  4LPG F;  4K10 A;  5ERO A;  4UMJ A;  3BNY A;  2F7M F;  3N46 F;  4N9U A;  3SDQ A;  3WCJ A;  5AYP A;  5C05 A;  1DI1 A;  1JFA A;  4N1Z F;  5DZ2 A;  3ZMB A;  3SAE A;  3S4J A;  1UBX A;  3N3L F;  5B00 A;  5IMN A;  5HN8 A;  5CG6 A;  5DW7 A;  5ILJ A;  1YJ4 A;  3NRI A;  2Z78 A;  3ICM A;  5ILD A;  3LK5 A;  4RNQ A;  2Z4Y A;  5IL8 A;  5EAT A;  3VJ9 A;  2Z50 A;  3ZOU A;  3N6K F;  3P5P A;  2OA6 A;  3ICZ A;  4LLT A;  4LOB A;  3KRF B;  3KRP A;  2E8V A;  3TFN A;  3WJK A;  2J1P A;  4WK5 A;  5E8K A;  1V4K A;  2F92 F;  2E8T A;  5AEL A;  4OMG A;  3WCH A;  5AHU B;  1VG3 A;  3IBA A;  5EAS A;  2H8O A;  4NFJ F;  1HXC A;  4JZB A;  4NFI F;  2QIS A;  2ZY1 A;  4OGU A;  5IMP A;  2E95 A;  3M02 A;  2Q80 A;  1JFG A;  1HXA A;  2ZEV A;  2ZEU A;  5ERN A;  1FPS A;  1WL3 A;  3NPK A;  1VG6 A;  1WY0 A;  3RBM A;  3SDT A;  2OGD A;  4KFA A;  1YQ7 A;  3CC9 A;  5IM1 A;  3WCC A;  4NFK F;  1HX9 A;  3V1V A;  1N1Z A;  3EFQ A;  1YHM A;  3WSA A;  5B0K A;  3DYF A;  4NKE A;  3WCM A;  3WCD A;  4EA0 A;  5ILZ A;  3P8R A;  4LXW A;  3WCE A;  4KWD A;  5ILH A;  2Z4Z A;  5JA0 F;  5DGM F;  3OAB B;  4GP1 A;  4LTZ A;  5ILY A;  5IVG A;  5B0L A;  4KVI A;  3B7L A;  2PS6 A;  3KRO B;  3KRF A;  3LSN A;  3N5H F;  1V4H A;  3G4F A;  3LGZ B;  3WSB A;  2ZCR A;  4HD1 A;  5IKA A;  3V66 A;  3LZ9 A;  4GA3 A;  5JUZ F;  4H5D F;  1UBV A;  4EA1 A;  5DGS F;  5B01 A;  2Q58 A;  4LFG A;  4F62 A;  4DXJ A;  2J5C A;  3KRC A;  4GAX A;  2OPN A;  4ZQ8 A;  1RQI A;  2AET A;  3MZV A;  5DIQ F;  2FTZ A;  3SDU A;  3N0F A;  3WCI A;  1YHK A;  3SDR A;  3N49 F;  4KVW A;  3Q2Z A;  1N24 A;  3PYB A;  4OKZ A;  3SDV A;  3ZL6 A;  2AEL A;  2DH4 A;  3OAB A;  5IN8 A;  3ID0 A;  1VG4 A;  3LMD A;  2FOR A;  4DZW A;  3QKC A;  4LPH F;  5CG5 A;  1YYQ A;  5HN9 A;  3WC9 A;  1WL1 A;  5IKH A;  3KRO A;  4JZX A;  5ILK A;  3CKE A;  4LZ3 A;  4F6V A;  5IK9 A;  2E91 A;  3PDE A;  3WCG A;  3Q2Q A;  2F8Z F;  2Z7I A;  1YV5 A;  4L2X F;  3LEE A;  5JV2 F;  4P0X A;  3S9V A;  1N1B A;  2ONG A;  4LFV F;  3WEJ A;  5E8H A;  5DGN F;  3TC1 A;  3TS7 A;  3WCL A;  3ACY A;  3RYE A;  3RYW A;  2AZL A;  4H5E F;  2E93 A;  2Q9Z A;  4MC3 A;  2Z4X A;  3BNX A;  1WMW A;  5E8L A;  4PVY F;  3LG5 A;  2E92 A;  5B03 A;  1V4I A;  4P0W A;  3M9U A;  4KQ5 A;  2E94 A;  1KIZ A;  4JVJ F;  1DGP A;  1YYU A;  1YYR A;  2AZK A;  5A0K A;  3ASX A;  3WEI A;  3KRC B;  3APZ A;  5ILI A;  1HM4 A;  3QQV A;  4KQU A;  3M00 A;  1VG2 A;  1N21 A;  4DWG A;  2PS4 A;  3WJN A;  1RTR A;  3WEG A; 
#chains in the Genus database with same CATH homology
 3OAC B;  2Q9Y A;  4RXC A;  5DHK A;  2O1O A;  3UCA A;  2Z52 A;  4KKM A;  3TFP A;  2EWG A;  3AE0 A;  3KB9 A;  5B02 A;  3VJB A;  3WJO A;  2E8U A;  2PS5 A;  2F94 F;  3ZMC A;  2P1C A;  3TFV A;  4DHD A;  2OPM A;  2F8C F;  3G4D A;  3IPI A;  4DI5 A;  1YHL A;  2F89 F;  4LZ0 A;  4LTV A;  1V4E A;  4KQS A;  1HXG A;  5EAU A;  2ZCQ A;  3P8L A;  4E9Z A;  3P41 A;  1N23 A;  5B0I A;  2I19 A;  5DJV F;  3P5R A;  3WCA A;  1HM7 A;  4F6X A;  4KVD A;  4RXA A;  5JV1 F;  3WEH A;  4FP4 A;  4XQT F;  3AQB B;  4DEM F;  3DYG A;  4NUA A;  4E1E A;  3N1V F;  3Q30 A;  4LA5 A;  3LVS A;  3OAC A;  3LDW A;  4QXS F;  5H9D A;  1YYS A;  3ACX A;  5DJP F;  5DHI A;  3WEK A;  4PVX F;  5A0I A;  4XQS F;  3N5J F;  3LGK A;  4LUU A;  3N1W F;  3LLW A;  3ADZ A;  2AEK A;  3KBK A;  5A0J A;  3VJD A;  3Q1O A;  2E8W A;  3W7F A;  4KVY A;  4QPF A;  4LA6 A;  1UBY A;  2PS8 A;  3PYA A;  3KRA A;  4LIX A;  1PS1 A;  2Z7H A;  4RXE A;  4NG6 A;  1RQJ A;  4Q23 A;  5IL3 A;  3VJE A;  3ZCD A;  4KK2 A;  3VJ8 A;  3OYR A;  5HNA A;  2AZJ A;  4E9U A;  5IMI A;  2E90 A;  2E8X A;  2RAH A;  3NF2 A;  4MC8 A;  4RYP A;  2F9K F;  3AQC B;  1ZW5 A;  1N22 A;  3AQ0 A;  3V1X A;  5HN7 A;  4LZC A;  2E4O A;  4XQR F;  2Z4V A;  2Z4W A;  3WCF A;  1WL0 A;  4KPD A;  3LJI A;  4LFE A;  3EGT A;  1VG7 A;  4NKF A;  4OMH A;  4EA2 A;  4FJQ A;  3VJC A;  4OKM A;  1WL2 A;  4JXY A;  3DYH A;  5JV0 F;  1UBW A;  3N0G A;  5IK0 A;  3LOM A;  5B0J A;  1YYT A;  3EZ3 A;  3PKO A;  3M0G A;  3N45 F;  4MC0 A;  3CP6 A;  1KIY A;  4RXD A;  3WCB A;  5B0M A;  3PH7 A;  4JXN A;  3ACW A;  3ICN A;  3KRA B;  3N3D A;  3NPR A;  2ZCO A;  4KUX A;  2ONH A;  2J1O A;  4LLS A;  3WEF A;  3RMG A;  3ICK A;  4KPJ A;  5KSX F;  3KRP B;  1EZF A;  1V4J A;  5IK6 A;  3WE9 A;  5ERM A;  4DWB A;  1WKZ A;  4P0V A;  4JYX A;  5ER8 A;  5AFX A;  3VJA A;  2ZCS A;  5DJR F;  2VF6 A;  4GP2 A;  3M01 A;  4H5C F;  5I1U A;  1N20 A;  3MAV A;  2PS7 A;  4LPG F;  4K10 A;  5ERO A;  4UMJ A;  3BNY A;  2F7M F;  3N46 F;  4N9U A;  3SDQ A;  3WCJ A;  5AYP A;  5C05 A;  1DI1 A;  1JFA A;  4N1Z F;  5DZ2 A;  3ZMB A;  3SAE A;  3S4J A;  1UBX A;  3N3L F;  5B00 A;  5IMN A;  5HN8 A;  5CG6 A;  5DW7 A;  5ILJ A;  1YJ4 A;  3NRI A;  2Z78 A;  3ICM A;  5ILD A;  3LK5 A;  4RNQ A;  2Z4Y A;  5IL8 A;  5EAT A;  3VJ9 A;  2Z50 A;  3ZOU A;  3N6K F;  3P5P A;  2OA6 A;  3ICZ A;  4LLT A;  4LOB A;  3KRF B;  3KRP A;  2E8V A;  3TFN A;  3WJK A;  2J1P A;  4WK5 A;  5E8K A;  1V4K A;  2F92 F;  2E8T A;  5AEL A;  4OMG A;  3WCH A;  5AHU B;  1VG3 A;  3IBA A;  5EAS A;  2H8O A;  4NFJ F;  1HXC A;  4JZB A;  4NFI F;  2QIS A;  2ZY1 A;  4OGU A;  5IMP A;  2E95 A;  3M02 A;  2Q80 A;  1JFG A;  1HXA A;  2ZEV A;  2ZEU A;  5ERN A;  1FPS A;  1WL3 A;  3NPK A;  1VG6 A;  1WY0 A;  3RBM A;  3SDT A;  2OGD A;  4KFA A;  1YQ7 A;  3CC9 A;  5IM1 A;  3WCC A;  4NFK F;  1HX9 A;  3V1V A;  1N1Z A;  3EFQ A;  1YHM A;  3WSA A;  5B0K A;  3DYF A;  4NKE A;  3WCM A;  3WCD A;  4EA0 A;  5ILZ A;  3P8R A;  4LXW A;  3WCE A;  4KWD A;  5ILH A;  2Z4Z A;  5JA0 F;  5DGM F;  3OAB B;  4GP1 A;  4LTZ A;  5ILY A;  5IVG A;  5B0L A;  4KVI A;  3B7L A;  2PS6 A;  3KRO B;  3KRF A;  3LSN A;  3N5H F;  1V4H A;  3G4F A;  3LGZ B;  3WSB A;  2ZCR A;  4HD1 A;  5IKA A;  3V66 A;  3LZ9 A;  4GA3 A;  5JUZ F;  4H5D F;  1UBV A;  4EA1 A;  5DGS F;  5B01 A;  2Q58 A;  4LFG A;  4F62 A;  4DXJ A;  2J5C A;  3KRC A;  4GAX A;  2OPN A;  4ZQ8 A;  1RQI A;  2AET A;  3MZV A;  5DIQ F;  2FTZ A;  3SDU A;  3N0F A;  3WCI A;  1YHK A;  3SDR A;  3N49 F;  4KVW A;  3Q2Z A;  1N24 A;  3PYB A;  4OKZ A;  3SDV A;  3ZL6 A;  2AEL A;  2DH4 A;  3OAB A;  5IN8 A;  3ID0 A;  1VG4 A;  3LMD A;  2FOR A;  4DZW A;  3QKC A;  4LPH F;  5CG5 A;  1YYQ A;  5HN9 A;  3WC9 A;  1WL1 A;  5IKH A;  3KRO A;  4JZX A;  5ILK A;  3CKE A;  4LZ3 A;  4F6V A;  5IK9 A;  2E91 A;  3PDE A;  3WCG A;  3Q2Q A;  2F8Z F;  2Z7I A;  1YV5 A;  4L2X F;  3LEE A;  5JV2 F;  4P0X A;  3S9V A;  1N1B A;  2ONG A;  4LFV F;  3WEJ A;  5E8H A;  5DGN F;  3TC1 A;  3TS7 A;  3WCL A;  3ACY A;  3RYE A;  3RYW A;  2AZL A;  4H5E F;  2E93 A;  2Q9Z A;  4MC3 A;  2Z4X A;  3BNX A;  1WMW A;  5E8L A;  4PVY F;  3LG5 A;  2E92 A;  5B03 A;  1V4I A;  4P0W A;  3M9U A;  4KQ5 A;  2E94 A;  1KIZ A;  4JVJ F;  1DGP A;  1YYU A;  1YYR A;  2AZK A;  5A0K A;  3ASX A;  3WEI A;  3KRC B;  3APZ A;  5ILI A;  1HM4 A;  3QQV A;  4KQU A;  3M00 A;  1VG2 A;  1N21 A;  4DWG A;  2PS4 A;  3WJN A;  1RTR A;  3WEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...