4KVDA

Crystal structure of aspergillus terreus aristolochene synthase complexed with (4as,7s)-1,4a-dimethyl-7-(prop-1-en-2-yl)decahydroquinolin-1-ium
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
304
structure length
304
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Aristolochene synthase
publication title Mechanistic insights from the binding of substrate and carbocation intermediate analogues to aristolochene synthase.
pubmed doi rcsb
source organism Aspergillus terreus
total genus 135
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2013-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4kvdA00
5ILHA 4DWGA 3OYRA 4Q23A 3VJ9A 4E1EA 3DYGA 4KFAA 3TC1A 4E9UA 4QPFA 5ILYA 3WEHA 1PS1A 2AETA 2E8UA 4E9ZA 3KROA 3VJDA 4FJQA 1RQIA 3OACB 4DI5A 1YV5A 5AELA 4RXDA 3WCJA 3V1XA 5IMNA 3P8RA 1YYRA 3WCBA 4NKEA 3P5RA 3ICMA 5DJVF 3SDRA 3Q2ZA 5B0LA 4LIXA 5IL8A 4DEMF 1JFAA 3LDWA 5DZ2A 3M9UA 3KROB 5IMPA 3WEFA 1YHLA 2VF6A 3P5PA 5B0KA 3LOMA 4H5CF 2E90A 4LTVA 3ID0A 4KUXA 5E8KA 2F9KF 2Z52A 4EA1A 1WKZA 1WL1A 1UBYA 2Z4ZA 1WMWA 4OMHA 3WSBA 3ICNA 2QISA 3N1WF 2F7MF 3ZCDA 5B02A 3WCCA 3MAVA 3WJOA 2FTZA 2ZY1A 5ERNA 3N5HF 3WCEA 2Q9YA 5HN7A 4MC3A 3CC9A 3SDUA 2OGDA 5C05A 1UBWA 2Z4WA 2AELA 5E8LA 1VG6A 2ZCOA 2Z50A 3WE9A 3TFPA 4NUAA 1HXGA 5A0IA 5CG6A 4NFJF 5I1UA 4LLTA 3WEKA 5B03A 2ZCSA 4LFVF 3WCDA 2PS5A 5JV1F 3B7LA 5IKHA 1YYUA 3CP6A 1WL2A 3ASXA 2O1OA 3P41A 1WL0A 5IN8A 3Q2QA 4GP2A 2E93A 3LG5A 3LEEA 3M01A 5EAUA 1UBXA 4KVWA 3PH7A 3EZ3A 4PVXF 4JZXA 3IPIA 3TFVA 1YYQA 5ILIA 5H9DA 3LMDA 4LFGA 1HXAA 3S4JA 5A0KA 2OA6A 3OACA 3NPRA 1DI1A 1YYSA 1DGPA 3TS7A 1YYTA 1N24A 3RMGA 2E8WA 4JYXA 3CKEA 5KSXF 4NG6A 2ZEVA 2AZLA 3N3DA 4GP1A 3Q30A 2E91A 4JVJF 4MC0A 3SDTA 4F62A 2P1CA 5JV0F 3ICZA 1KIYA 3KRFB 4LUUA 4P0XA 3VJEA 1FPSA 3TFNA 3WCFA 4OKMA 4KKMA 3ZMCA 5B0MA 3N49F 4KVYA 5EATA 2F94F 5IK0A 2E8XA 4LZ3A 2PS7A 1UBVA 4KVDA 3W7FA 4LA6A 3WJKA 3LK5A 3LSNA 4KVIA 1KIZA 1V4JA 5DGMF 3M00A 4RXCA 2ONGA 4UMJA 1N22A 3ICKA 2E8VA 4EA2A 5EROA 3SAEA 4P0WA 3LJIA 3NRIA 3ACYA 2PS4A 4RNQA 3N5JF 3KB9A 3M0GA 3ZMBA 4OKZA 4N9UA 1RQJA 4KPDA 3LLWA 1WY0A 1VG3A 4MC8A 3UCAA 3RYEA 4P0VA 5IM1A 4RXEA 3WJNA 3QKCA 5DIQF 4F6XA 4RXAA 3N6KF 2ZCQA 5B0IA 2J1PA 3KRAB 2F8CF 3ACXA 2Z4YA 4LTZA 3LGKA 3DYFA 3KRPB 4LOBA 3WCHA 1N20A 2DH4A 4JXYA 2Z7IA 4KK2A 3NF2A 2E95A 4DHDA 3WCMA 4KPJA 3IBAA 3WCGA 5JUZF 3VJAA 4DXJA 5EASA 2AEKA 3WSAA 3VJBA 2AZJA 5IKAA 3ADZA 4OGUA 3WEJA 3WC9A 5ILDA 4H5DF 3AQBB 3LGZB 3APZA 5IMIA 1V4HA 4DWBA 3G4DA 5CG5A 4NKFA 2FORA 3KRFA 2Z4XA 4K10A 4LLSA 3RYWA 1N23A 5JV2F 5B0JA 2ONHA 3WCIA 5JA0F 1N21A 2E4OA 2E8TA 2OPMA 5DGNF 4LXWA 3KRCB 5IK6A 5B01A 2AZKA 3Q1OA 4FP4A 3N46F 1VG7A 2H8OA 2ZCRA 1EZFA 3M02A 4GA3A 4F6VA 5HNAA 4LPHF 3OABB 1YHKA 3AE0A 3V1VA 3ZOUA 2E94A 3V66A 2EWGA 3MZVA 3N0FA 5DJPF 5HN9A 4XQSF 5ILZA 4KQSA 2F92F 1V4EA 4L2XF 4EA0A 3EFQA 1VG4A 2I19A 3DYHA 5DJRF 5IVGA 4DZWA 1YJ4A 3VJCA 2Q9ZA 3SDVA 3EGTA 3LZ9A 4LZ0A 1HX9A 3SDQA 1YHMA 5B00A 1HM4A 1YQ7A 3PYBA 5E8HA 4NFIF 3WCAA 4GAXA 4PVYF 2PS8A 3AQCB 2Q58A 4LA5A 5AYPA 4RYPA 3BNXA 2J5CA 3P8LA 3KRAA 3WEGA 3KRPA 5AFXA 5HN8A 3N3LF 3PYAA 5DGSF 3LVSA 4JXNA 2Z7HA 1RTRA 3S9VA 3PDEA 4H5EF 4QXSF 2F8ZF 5ERMA 4KQUA 1WL3A 3RBMA 4JZBA 4ZQ8A 3QQVA 3VJ8A 4XQRF 4N1ZF 4HD1A 3BNYA 3N1VF 1JFGA 2ZEUA 3NPKA 2Q80A 4KWDA 4NFKF 3WCLA 5DHKA 4XQTF 2OPNA 5IL3A 3AQ0A 3G4FA 3ACWA 5ILKA 2J1OA 5A0JA 5AHUB 2PS6A 4KQ5A 1HXCA 3WEIA 1ZW5A 2F89F 3N0GA 2Z4VA 3KRCA 4LZCA 1N1BA 1VG2A 2E92A 1HM7A 4OMGA 5ER8A 3ZL6A 1V4KA 3KBKA 2RAHA 2Z78A 5DHIA 1N1ZA 3PKOA 3N45F 3OABA 4WK5A 4LPGF 5IK9A 5ILJA 4LFEA 1V4IA 5DW7A
chains in the Genus database with same CATH superfamily
5ILHA 4DWGA 3OYRA 4Q23A 3VJ9A 4E1EA 3DYGA 4KFAA 3TC1A 4E9UA 4QPFA 5ILYA 3WEHA 1PS1A 2AETA 2E8UA 4E9ZA 3KROA 3VJDA 4FJQA 1RQIA 3OACB 4DI5A 1YV5A 5AELA 4RXDA 3WCJA 3V1XA 5IMNA 3P8RA 1YYRA 3WCBA 4NKEA 3P5RA 3ICMA 5DJVF 3SDRA 3Q2ZA 5B0LA 4LIXA 5IL8A 4DEMF 1JFAA 3LDWA 5DZ2A 3M9UA 3KROB 5IMPA 3WEFA 1YHLA 2VF6A 3P5PA 5B0KA 3LOMA 4H5CF 2E90A 4LTVA 3ID0A 4KUXA 5E8KA 2F9KF 2Z52A 4EA1A 1WKZA 1WL1A 1UBYA 2Z4ZA 1WMWA 4OMHA 3WSBA 3ICNA 2QISA 3N1WF 2F7MF 3ZCDA 5B02A 3WCCA 3MAVA 3WJOA 2FTZA 2ZY1A 5ERNA 3N5HF 3WCEA 2Q9YA 5HN7A 4MC3A 3CC9A 3SDUA 2OGDA 5C05A 1UBWA 2Z4WA 2AELA 5E8LA 1VG6A 2ZCOA 2Z50A 3WE9A 3TFPA 4NUAA 1HXGA 5A0IA 5CG6A 4NFJF 5I1UA 4LLTA 3WEKA 5B03A 2ZCSA 4LFVF 3WCDA 2PS5A 5JV1F 3B7LA 5IKHA 1YYUA 3CP6A 1WL2A 3ASXA 2O1OA 3P41A 1WL0A 5IN8A 3Q2QA 4GP2A 2E93A 3LG5A 3LEEA 3M01A 5EAUA 1UBXA 4KVWA 3PH7A 3EZ3A 4PVXF 4JZXA 3IPIA 3TFVA 1YYQA 5ILIA 5H9DA 3LMDA 4LFGA 1HXAA 3S4JA 5A0KA 2OA6A 3OACA 3NPRA 1DI1A 1YYSA 1DGPA 3TS7A 1YYTA 1N24A 3RMGA 2E8WA 4JYXA 3CKEA 5KSXF 4NG6A 2ZEVA 2AZLA 3N3DA 4GP1A 3Q30A 2E91A 4JVJF 4MC0A 3SDTA 4F62A 2P1CA 5JV0F 3ICZA 1KIYA 3KRFB 4LUUA 4P0XA 3VJEA 1FPSA 3TFNA 3WCFA 4OKMA 4KKMA 3ZMCA 5B0MA 3N49F 4KVYA 5EATA 2F94F 5IK0A 2E8XA 4LZ3A 2PS7A 1UBVA 4KVDA 3W7FA 4LA6A 3WJKA 3LK5A 3LSNA 4KVIA 1KIZA 1V4JA 5DGMF 3M00A 4RXCA 2ONGA 4UMJA 1N22A 3ICKA 2E8VA 4EA2A 5EROA 3SAEA 4P0WA 3LJIA 3NRIA 3ACYA 2PS4A 4RNQA 3N5JF 3KB9A 3M0GA 3ZMBA 4OKZA 4N9UA 1RQJA 4KPDA 3LLWA 1WY0A 1VG3A 4MC8A 3UCAA 3RYEA 4P0VA 5IM1A 4RXEA 3WJNA 3QKCA 5DIQF 4F6XA 4RXAA 3N6KF 2ZCQA 5B0IA 2J1PA 3KRAB 2F8CF 3ACXA 2Z4YA 4LTZA 3LGKA 3DYFA 3KRPB 4LOBA 3WCHA 1N20A 2DH4A 4JXYA 2Z7IA 4KK2A 3NF2A 2E95A 4DHDA 3WCMA 4KPJA 3IBAA 3WCGA 5JUZF 3VJAA 4DXJA 5EASA 2AEKA 3WSAA 3VJBA 2AZJA 5IKAA 3ADZA 4OGUA 3WEJA 3WC9A 5ILDA 4H5DF 3AQBB 3LGZB 3APZA 5IMIA 1V4HA 4DWBA 3G4DA 5CG5A 4NKFA 2FORA 3KRFA 2Z4XA 4K10A 4LLSA 3RYWA 1N23A 5JV2F 5B0JA 2ONHA 3WCIA 5JA0F 1N21A 2E4OA 2E8TA 2OPMA 5DGNF 4LXWA 3KRCB 5IK6A 5B01A 2AZKA 3Q1OA 4FP4A 3N46F 1VG7A 2H8OA 2ZCRA 1EZFA 3M02A 4GA3A 4F6VA 5HNAA 4LPHF 3OABB 1YHKA 3AE0A 3V1VA 3ZOUA 2E94A 3V66A 2EWGA 3MZVA 3N0FA 5DJPF 5HN9A 4XQSF 5ILZA 4KQSA 2F92F 1V4EA 4L2XF 4EA0A 3EFQA 1VG4A 2I19A 3DYHA 5DJRF 5IVGA 4DZWA 1YJ4A 3VJCA 2Q9ZA 3SDVA 3EGTA 3LZ9A 4LZ0A 1HX9A 3SDQA 1YHMA 5B00A 1HM4A 1YQ7A 3PYBA 5E8HA 4NFIF 3WCAA 4GAXA 4PVYF 2PS8A 3AQCB 2Q58A 4LA5A 5AYPA 4RYPA 3BNXA 2J5CA 3P8LA 3KRAA 3WEGA 3KRPA 5AFXA 5HN8A 3N3LF 3PYAA 5DGSF 3LVSA 4JXNA 2Z7HA 1RTRA 3S9VA 3PDEA 4H5EF 4QXSF 2F8ZF 5ERMA 4KQUA 1WL3A 3RBMA 4JZBA 4ZQ8A 3QQVA 3VJ8A 4XQRF 4N1ZF 4HD1A 3BNYA 3N1VF 1JFGA 2ZEUA 3NPKA 2Q80A 4KWDA 4NFKF 3WCLA 5DHKA 4XQTF 2OPNA 5IL3A 3AQ0A 3G4FA 3ACWA 5ILKA 2J1OA 5A0JA 5AHUB 2PS6A 4KQ5A 1HXCA 3WEIA 1ZW5A 2F89F 3N0GA 2Z4VA 3KRCA 4LZCA 1N1BA 1VG2A 2E92A 1HM7A 4OMGA 5ER8A 3ZL6A 1V4KA 3KBKA 2RAHA 2Z78A 5DHIA 1N1ZA 3PKOA 3N45F 3OABA 4WK5A 4LPGF 5IK9A 5ILJA 4LFEA 1V4IA 5DW7A
chains in the Genus database with same CATH topology
5ILHA 4DWGA 3OYRA 4Q23A 3VJ9A 4E1EA 3DYGA 4KFAA 3TC1A 4E9UA 4QPFA 5ILYA 3WEHA 1PS1A 2AETA 2E8UA 4E9ZA 3KROA 3VJDA 4FJQA 1RQIA 3OACB 4DI5A 1YV5A 5AELA 4RXDA 3WCJA 3V1XA 5IMNA 3P8RA 1YYRA 3WCBA 4NKEA 3P5RA 3ICMA 5DJVF 3SDRA 3Q2ZA 5B0LA 4LIXA 5IL8A 4DEMF 1JFAA 3LDWA 5DZ2A 3M9UA 3KROB 5IMPA 3WEFA 1YHLA 2VF6A 3P5PA 5B0KA 3LOMA 4H5CF 2E90A 4LTVA 3ID0A 4KUXA 5E8KA 2F9KF 2Z52A 4EA1A 1WKZA 1WL1A 1UBYA 2Z4ZA 1WMWA 4OMHA 3WSBA 3ICNA 2QISA 3N1WF 2F7MF 3ZCDA 5B02A 3WCCA 3MAVA 3WJOA 2FTZA 2ZY1A 5ERNA 3N5HF 3WCEA 2Q9YA 5HN7A 4MC3A 3CC9A 3SDUA 2OGDA 5C05A 1UBWA 2Z4WA 2AELA 5E8LA 1VG6A 2ZCOA 2Z50A 3WE9A 3TFPA 4NUAA 1HXGA 5A0IA 5CG6A 4NFJF 5I1UA 4LLTA 3WEKA 5B03A 2ZCSA 4LFVF 3WCDA 2PS5A 5JV1F 3B7LA 5IKHA 1YYUA 3CP6A 1WL2A 3ASXA 2O1OA 3P41A 1WL0A 5IN8A 3Q2QA 4GP2A 2E93A 3LG5A 3LEEA 3M01A 5EAUA 1UBXA 4KVWA 3PH7A 3EZ3A 4PVXF 4JZXA 3IPIA 3TFVA 1YYQA 5ILIA 5H9DA 3LMDA 4LFGA 1HXAA 3S4JA 5A0KA 2OA6A 3OACA 3NPRA 1DI1A 1YYSA 1DGPA 3TS7A 1YYTA 1N24A 3RMGA 2E8WA 4JYXA 3CKEA 5KSXF 4NG6A 2ZEVA 2AZLA 3N3DA 4GP1A 3Q30A 2E91A 4JVJF 4MC0A 3SDTA 4F62A 2P1CA 5JV0F 3ICZA 1KIYA 3KRFB 4LUUA 4P0XA 3VJEA 1FPSA 3TFNA 3WCFA 4OKMA 4KKMA 3ZMCA 5B0MA 3N49F 4KVYA 5EATA 2F94F 5IK0A 2E8XA 4LZ3A 2PS7A 1UBVA 4KVDA 3W7FA 4LA6A 3WJKA 3LK5A 3LSNA 4KVIA 1KIZA 1V4JA 5DGMF 3M00A 4RXCA 2ONGA 4UMJA 1N22A 3ICKA 2E8VA 4EA2A 5EROA 3SAEA 4P0WA 3LJIA 3NRIA 3ACYA 2PS4A 4RNQA 3N5JF 3KB9A 3M0GA 3ZMBA 4OKZA 4N9UA 1RQJA 4KPDA 3LLWA 1WY0A 1VG3A 4MC8A 3UCAA 3RYEA 4P0VA 5IM1A 4RXEA 3WJNA 3QKCA 5DIQF 4F6XA 4RXAA 3N6KF 2ZCQA 5B0IA 2J1PA 3KRAB 2F8CF 3ACXA 2Z4YA 4LTZA 3LGKA 3DYFA 3KRPB 4LOBA 3WCHA 1N20A 2DH4A 4JXYA 2Z7IA 4KK2A 3NF2A 2E95A 4DHDA 3WCMA 4KPJA 3IBAA 3WCGA 5JUZF 3VJAA 4DXJA 5EASA 2AEKA 3WSAA 3VJBA 2AZJA 5IKAA 3ADZA 4OGUA 3WEJA 3WC9A 5ILDA 4H5DF 3AQBB 3LGZB 3APZA 5IMIA 1V4HA 4DWBA 3G4DA 5CG5A 4NKFA 2FORA 3KRFA 2Z4XA 4K10A 4LLSA 3RYWA 1N23A 5JV2F 5B0JA 2ONHA 3WCIA 5JA0F 1N21A 2E4OA 2E8TA 2OPMA 5DGNF 4LXWA 3KRCB 5IK6A 5B01A 2AZKA 3Q1OA 4FP4A 3N46F 1VG7A 2H8OA 2ZCRA 1EZFA 3M02A 4GA3A 4F6VA 5HNAA 4LPHF 3OABB 1YHKA 3AE0A 3V1VA 3ZOUA 2E94A 3V66A 2EWGA 3MZVA 3N0FA 5DJPF 5HN9A 4XQSF 5ILZA 4KQSA 2F92F 1V4EA 4L2XF 4EA0A 3EFQA 1VG4A 2I19A 3DYHA 5DJRF 5IVGA 4DZWA 1YJ4A 3VJCA 2Q9ZA 3SDVA 3EGTA 3LZ9A 4LZ0A 1HX9A 3SDQA 1YHMA 5B00A 1HM4A 1YQ7A 3PYBA 5E8HA 4NFIF 3WCAA 4GAXA 4PVYF 2PS8A 3AQCB 2Q58A 4LA5A 5AYPA 4RYPA 3BNXA 2J5CA 3P8LA 3KRAA 3WEGA 3KRPA 5AFXA 5HN8A 3N3LF 3PYAA 5DGSF 3LVSA 4JXNA 2Z7HA 1RTRA 3S9VA 3PDEA 4H5EF 4QXSF 2F8ZF 5ERMA 4KQUA 1WL3A 3RBMA 4JZBA 4ZQ8A 3QQVA 3VJ8A 4XQRF 4N1ZF 4HD1A 3BNYA 3N1VF 1JFGA 2ZEUA 3NPKA 2Q80A 4KWDA 4NFKF 3WCLA 5DHKA 4XQTF 2OPNA 5IL3A 3AQ0A 3G4FA 3ACWA 5ILKA 2J1OA 5A0JA 5AHUB 2PS6A 4KQ5A 1HXCA 3WEIA 1ZW5A 2F89F 3N0GA 2Z4VA 3KRCA 4LZCA 1N1BA 1VG2A 2E92A 1HM7A 4OMGA 5ER8A 3ZL6A 1V4KA 3KBKA 2RAHA 2Z78A 5DHIA 1N1ZA 3PKOA 3N45F 3OABA 4WK5A 4LPGF 5IK9A 5ILJA 4LFEA 1V4IA 5DW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILH A;  4DWG A;  3OYR A;  4Q23 A;  3VJ9 A;  4E1E A;  3DYG A;  4KFA A;  3TC1 A;  4E9U A;  4QPF A;  5ILY A;  3WEH A;  1PS1 A;  2AET A;  2E8U A;  4E9Z A;  3KRO A;  3VJD A;  4FJQ A;  1RQI A;  3OAC B;  4DI5 A;  1YV5 A;  5AEL A;  4RXD A;  3WCJ A;  3V1X A;  5IMN A;  3P8R A;  1YYR A;  3WCB A;  4NKE A;  3P5R A;  3ICM A;  5DJV F;  3SDR A;  3Q2Z A;  5B0L A;  4LIX A;  5IL8 A;  4DEM F;  1JFA A;  3LDW A;  5DZ2 A;  3M9U A;  3KRO B;  5IMP A;  3WEF A;  1YHL A;  2VF6 A;  3P5P A;  5B0K A;  3LOM A;  4H5C F;  2E90 A;  4LTV A;  3ID0 A;  4KUX A;  5E8K A;  2F9K F;  2Z52 A;  4EA1 A;  1WKZ A;  1WL1 A;  1UBY A;  2Z4Z A;  1WMW A;  4OMH A;  3WSB A;  3ICN A;  2QIS A;  3N1W F;  2F7M F;  3ZCD A;  5B02 A;  3WCC A;  3MAV A;  3WJO A;  2FTZ A;  2ZY1 A;  5ERN A;  3N5H F;  3WCE A;  2Q9Y A;  5HN7 A;  4MC3 A;  3CC9 A;  3SDU A;  2OGD A;  5C05 A;  1UBW A;  2Z4W A;  2AEL A;  5E8L A;  1VG6 A;  2ZCO A;  2Z50 A;  3WE9 A;  3TFP A;  4NUA A;  1HXG A;  5A0I A;  5CG6 A;  4NFJ F;  5I1U A;  4LLT A;  3WEK A;  5B03 A;  2ZCS A;  4LFV F;  3WCD A;  2PS5 A;  5JV1 F;  3B7L A;  5IKH A;  1YYU A;  3CP6 A;  1WL2 A;  3ASX A;  2O1O A;  3P41 A;  1WL0 A;  5IN8 A;  3Q2Q A;  4GP2 A;  2E93 A;  3LG5 A;  3LEE A;  3M01 A;  5EAU A;  1UBX A;  4KVW A;  3PH7 A;  3EZ3 A;  4PVX F;  4JZX A;  3IPI A;  3TFV A;  1YYQ A;  5ILI A;  5H9D A;  3LMD A;  4LFG A;  1HXA A;  3S4J A;  5A0K A;  2OA6 A;  3OAC A;  3NPR A;  1DI1 A;  1YYS A;  1DGP A;  3TS7 A;  1YYT A;  1N24 A;  3RMG A;  2E8W A;  4JYX A;  3CKE A;  5KSX F;  4NG6 A;  2ZEV A;  2AZL A;  3N3D A;  4GP1 A;  3Q30 A;  2E91 A;  4JVJ F;  4MC0 A;  3SDT A;  4F62 A;  2P1C A;  5JV0 F;  3ICZ A;  1KIY A;  3KRF B;  4LUU A;  4P0X A;  3VJE A;  1FPS A;  3TFN A;  3WCF A;  4OKM A;  4KKM A;  3ZMC A;  5B0M A;  3N49 F;  4KVY A;  5EAT A;  2F94 F;  5IK0 A;  2E8X A;  4LZ3 A;  2PS7 A;  1UBV A;  4KVD A;  3W7F A;  4LA6 A;  3WJK A;  3LK5 A;  3LSN A;  4KVI A;  1KIZ A;  1V4J A;  5DGM F;  3M00 A;  4RXC A;  2ONG A;  4UMJ A;  1N22 A;  3ICK A;  2E8V A;  4EA2 A;  5ERO A;  3SAE A;  4P0W A;  3LJI A;  3NRI A;  3ACY A;  2PS4 A;  4RNQ A;  3N5J F;  3KB9 A;  3M0G A;  3ZMB A;  4OKZ A;  4N9U A;  1RQJ A;  4KPD A;  3LLW A;  1WY0 A;  1VG3 A;  4MC8 A;  3UCA A;  3RYE A;  4P0V A;  5IM1 A;  4RXE A;  3WJN A;  3QKC A;  5DIQ F;  4F6X A;  4RXA A;  3N6K F;  2ZCQ A;  5B0I A;  2J1P A;  3KRA B;  2F8C F;  3ACX A;  2Z4Y A;  4LTZ A;  3LGK A;  3DYF A;  3KRP B;  4LOB A;  3WCH A;  1N20 A;  2DH4 A;  4JXY A;  2Z7I A;  4KK2 A;  3NF2 A;  2E95 A;  4DHD A;  3WCM A;  4KPJ A;  3IBA A;  3WCG A;  5JUZ F;  3VJA A;  4DXJ A;  5EAS A;  2AEK A;  3WSA A;  3VJB A;  2AZJ A;  5IKA A;  3ADZ A;  4OGU A;  3WEJ A;  3WC9 A;  5ILD A;  4H5D F;  3AQB B;  3LGZ B;  3APZ A;  5IMI A;  1V4H A;  4DWB A;  3G4D A;  5CG5 A;  4NKF A;  2FOR A;  3KRF A;  2Z4X A;  4K10 A;  4LLS A;  3RYW A;  1N23 A;  5JV2 F;  5B0J A;  2ONH A;  3WCI A;  5JA0 F;  1N21 A;  2E4O A;  2E8T A;  2OPM A;  5DGN F;  4LXW A;  3KRC B;  5IK6 A;  5B01 A;  2AZK A;  3Q1O A;  4FP4 A;  3N46 F;  1VG7 A;  2H8O A;  2ZCR A;  1EZF A;  3M02 A;  4GA3 A;  4F6V A;  5HNA A;  4LPH F;  3OAB B;  1YHK A;  3AE0 A;  3V1V A;  3ZOU A;  2E94 A;  3V66 A;  2EWG A;  3MZV A;  3N0F A;  5DJP F;  5HN9 A;  4XQS F;  5ILZ A;  4KQS A;  2F92 F;  1V4E A;  4L2X F;  4EA0 A;  3EFQ A;  1VG4 A;  2I19 A;  3DYH A;  5DJR F;  5IVG A;  4DZW A;  1YJ4 A;  3VJC A;  2Q9Z A;  3SDV A;  3EGT A;  3LZ9 A;  4LZ0 A;  1HX9 A;  3SDQ A;  1YHM A;  5B00 A;  1HM4 A;  1YQ7 A;  3PYB A;  5E8H A;  4NFI F;  3WCA A;  4GAX A;  4PVY F;  2PS8 A;  3AQC B;  2Q58 A;  4LA5 A;  5AYP A;  4RYP A;  3BNX A;  2J5C A;  3P8L A;  3KRA A;  3WEG A;  3KRP A;  5AFX A;  5HN8 A;  3N3L F;  3PYA A;  5DGS F;  3LVS A;  4JXN A;  2Z7H A;  1RTR A;  3S9V A;  3PDE A;  4H5E F;  4QXS F;  2F8Z F;  5ERM A;  4KQU A;  1WL3 A;  3RBM A;  4JZB A;  4ZQ8 A;  3QQV A;  3VJ8 A;  4XQR F;  4N1Z F;  4HD1 A;  3BNY A;  3N1V F;  1JFG A;  2ZEU A;  3NPK A;  2Q80 A;  4KWD A;  4NFK F;  3WCL A;  5DHK A;  4XQT F;  2OPN A;  5IL3 A;  3AQ0 A;  3G4F A;  3ACW A;  5ILK A;  2J1O A;  5A0J A;  5AHU B;  2PS6 A;  4KQ5 A;  1HXC A;  3WEI A;  1ZW5 A;  2F89 F;  3N0G A;  2Z4V A;  3KRC A;  4LZC A;  1N1B A;  1VG2 A;  2E92 A;  1HM7 A;  4OMG A;  5ER8 A;  3ZL6 A;  1V4K A;  3KBK A;  2RAH A;  2Z78 A;  5DHI A;  1N1Z A;  3PKO A;  3N45 F;  3OAB A;  4WK5 A;  4LPG F;  5IK9 A;  5ILJ A;  4LFE A;  1V4I A;  5DW7 A; 
#chains in the Genus database with same CATH topology
 5ILH A;  4DWG A;  3OYR A;  4Q23 A;  3VJ9 A;  4E1E A;  3DYG A;  4KFA A;  3TC1 A;  4E9U A;  4QPF A;  5ILY A;  3WEH A;  1PS1 A;  2AET A;  2E8U A;  4E9Z A;  3KRO A;  3VJD A;  4FJQ A;  1RQI A;  3OAC B;  4DI5 A;  1YV5 A;  5AEL A;  4RXD A;  3WCJ A;  3V1X A;  5IMN A;  3P8R A;  1YYR A;  3WCB A;  4NKE A;  3P5R A;  3ICM A;  5DJV F;  3SDR A;  3Q2Z A;  5B0L A;  4LIX A;  5IL8 A;  4DEM F;  1JFA A;  3LDW A;  5DZ2 A;  3M9U A;  3KRO B;  5IMP A;  3WEF A;  1YHL A;  2VF6 A;  3P5P A;  5B0K A;  3LOM A;  4H5C F;  2E90 A;  4LTV A;  3ID0 A;  4KUX A;  5E8K A;  2F9K F;  2Z52 A;  4EA1 A;  1WKZ A;  1WL1 A;  1UBY A;  2Z4Z A;  1WMW A;  4OMH A;  3WSB A;  3ICN A;  2QIS A;  3N1W F;  2F7M F;  3ZCD A;  5B02 A;  3WCC A;  3MAV A;  3WJO A;  2FTZ A;  2ZY1 A;  5ERN A;  3N5H F;  3WCE A;  2Q9Y A;  5HN7 A;  4MC3 A;  3CC9 A;  3SDU A;  2OGD A;  5C05 A;  1UBW A;  2Z4W A;  2AEL A;  5E8L A;  1VG6 A;  2ZCO A;  2Z50 A;  3WE9 A;  3TFP A;  4NUA A;  1HXG A;  5A0I A;  5CG6 A;  4NFJ F;  5I1U A;  4LLT A;  3WEK A;  5B03 A;  2ZCS A;  4LFV F;  3WCD A;  2PS5 A;  5JV1 F;  3B7L A;  5IKH A;  1YYU A;  3CP6 A;  1WL2 A;  3ASX A;  2O1O A;  3P41 A;  1WL0 A;  5IN8 A;  3Q2Q A;  4GP2 A;  2E93 A;  3LG5 A;  3LEE A;  3M01 A;  5EAU A;  1UBX A;  4KVW A;  3PH7 A;  3EZ3 A;  4PVX F;  4JZX A;  3IPI A;  3TFV A;  1YYQ A;  5ILI A;  5H9D A;  3LMD A;  4LFG A;  1HXA A;  3S4J A;  5A0K A;  2OA6 A;  3OAC A;  3NPR A;  1DI1 A;  1YYS A;  1DGP A;  3TS7 A;  1YYT A;  1N24 A;  3RMG A;  2E8W A;  4JYX A;  3CKE A;  5KSX F;  4NG6 A;  2ZEV A;  2AZL A;  3N3D A;  4GP1 A;  3Q30 A;  2E91 A;  4JVJ F;  4MC0 A;  3SDT A;  4F62 A;  2P1C A;  5JV0 F;  3ICZ A;  1KIY A;  3KRF B;  4LUU A;  4P0X A;  3VJE A;  1FPS A;  3TFN A;  3WCF A;  4OKM A;  4KKM A;  3ZMC A;  5B0M A;  3N49 F;  4KVY A;  5EAT A;  2F94 F;  5IK0 A;  2E8X A;  4LZ3 A;  2PS7 A;  1UBV A;  4KVD A;  3W7F A;  4LA6 A;  3WJK A;  3LK5 A;  3LSN A;  4KVI A;  1KIZ A;  1V4J A;  5DGM F;  3M00 A;  4RXC A;  2ONG A;  4UMJ A;  1N22 A;  3ICK A;  2E8V A;  4EA2 A;  5ERO A;  3SAE A;  4P0W A;  3LJI A;  3NRI A;  3ACY A;  2PS4 A;  4RNQ A;  3N5J F;  3KB9 A;  3M0G A;  3ZMB A;  4OKZ A;  4N9U A;  1RQJ A;  4KPD A;  3LLW A;  1WY0 A;  1VG3 A;  4MC8 A;  3UCA A;  3RYE A;  4P0V A;  5IM1 A;  4RXE A;  3WJN A;  3QKC A;  5DIQ F;  4F6X A;  4RXA A;  3N6K F;  2ZCQ A;  5B0I A;  2J1P A;  3KRA B;  2F8C F;  3ACX A;  2Z4Y A;  4LTZ A;  3LGK A;  3DYF A;  3KRP B;  4LOB A;  3WCH A;  1N20 A;  2DH4 A;  4JXY A;  2Z7I A;  4KK2 A;  3NF2 A;  2E95 A;  4DHD A;  3WCM A;  4KPJ A;  3IBA A;  3WCG A;  5JUZ F;  3VJA A;  4DXJ A;  5EAS A;  2AEK A;  3WSA A;  3VJB A;  2AZJ A;  5IKA A;  3ADZ A;  4OGU A;  3WEJ A;  3WC9 A;  5ILD A;  4H5D F;  3AQB B;  3LGZ B;  3APZ A;  5IMI A;  1V4H A;  4DWB A;  3G4D A;  5CG5 A;  4NKF A;  2FOR A;  3KRF A;  2Z4X A;  4K10 A;  4LLS A;  3RYW A;  1N23 A;  5JV2 F;  5B0J A;  2ONH A;  3WCI A;  5JA0 F;  1N21 A;  2E4O A;  2E8T A;  2OPM A;  5DGN F;  4LXW A;  3KRC B;  5IK6 A;  5B01 A;  2AZK A;  3Q1O A;  4FP4 A;  3N46 F;  1VG7 A;  2H8O A;  2ZCR A;  1EZF A;  3M02 A;  4GA3 A;  4F6V A;  5HNA A;  4LPH F;  3OAB B;  1YHK A;  3AE0 A;  3V1V A;  3ZOU A;  2E94 A;  3V66 A;  2EWG A;  3MZV A;  3N0F A;  5DJP F;  5HN9 A;  4XQS F;  5ILZ A;  4KQS A;  2F92 F;  1V4E A;  4L2X F;  4EA0 A;  3EFQ A;  1VG4 A;  2I19 A;  3DYH A;  5DJR F;  5IVG A;  4DZW A;  1YJ4 A;  3VJC A;  2Q9Z A;  3SDV A;  3EGT A;  3LZ9 A;  4LZ0 A;  1HX9 A;  3SDQ A;  1YHM A;  5B00 A;  1HM4 A;  1YQ7 A;  3PYB A;  5E8H A;  4NFI F;  3WCA A;  4GAX A;  4PVY F;  2PS8 A;  3AQC B;  2Q58 A;  4LA5 A;  5AYP A;  4RYP A;  3BNX A;  2J5C A;  3P8L A;  3KRA A;  3WEG A;  3KRP A;  5AFX A;  5HN8 A;  3N3L F;  3PYA A;  5DGS F;  3LVS A;  4JXN A;  2Z7H A;  1RTR A;  3S9V A;  3PDE A;  4H5E F;  4QXS F;  2F8Z F;  5ERM A;  4KQU A;  1WL3 A;  3RBM A;  4JZB A;  4ZQ8 A;  3QQV A;  3VJ8 A;  4XQR F;  4N1Z F;  4HD1 A;  3BNY A;  3N1V F;  1JFG A;  2ZEU A;  3NPK A;  2Q80 A;  4KWD A;  4NFK F;  3WCL A;  5DHK A;  4XQT F;  2OPN A;  5IL3 A;  3AQ0 A;  3G4F A;  3ACW A;  5ILK A;  2J1O A;  5A0J A;  5AHU B;  2PS6 A;  4KQ5 A;  1HXC A;  3WEI A;  1ZW5 A;  2F89 F;  3N0G A;  2Z4V A;  3KRC A;  4LZC A;  1N1B A;  1VG2 A;  2E92 A;  1HM7 A;  4OMG A;  5ER8 A;  3ZL6 A;  1V4K A;  3KBK A;  2RAH A;  2Z78 A;  5DHI A;  1N1Z A;  3PKO A;  3N45 F;  3OAB A;  4WK5 A;  4LPG F;  5IK9 A;  5ILJ A;  4LFE A;  1V4I A;  5DW7 A; 
#chains in the Genus database with same CATH homology
 5ILH A;  4DWG A;  3OYR A;  4Q23 A;  3VJ9 A;  4E1E A;  3DYG A;  4KFA A;  3TC1 A;  4E9U A;  4QPF A;  5ILY A;  3WEH A;  1PS1 A;  2AET A;  2E8U A;  4E9Z A;  3KRO A;  3VJD A;  4FJQ A;  1RQI A;  3OAC B;  4DI5 A;  1YV5 A;  5AEL A;  4RXD A;  3WCJ A;  3V1X A;  5IMN A;  3P8R A;  1YYR A;  3WCB A;  4NKE A;  3P5R A;  3ICM A;  5DJV F;  3SDR A;  3Q2Z A;  5B0L A;  4LIX A;  5IL8 A;  4DEM F;  1JFA A;  3LDW A;  5DZ2 A;  3M9U A;  3KRO B;  5IMP A;  3WEF A;  1YHL A;  2VF6 A;  3P5P A;  5B0K A;  3LOM A;  4H5C F;  2E90 A;  4LTV A;  3ID0 A;  4KUX A;  5E8K A;  2F9K F;  2Z52 A;  4EA1 A;  1WKZ A;  1WL1 A;  1UBY A;  2Z4Z A;  1WMW A;  4OMH A;  3WSB A;  3ICN A;  2QIS A;  3N1W F;  2F7M F;  3ZCD A;  5B02 A;  3WCC A;  3MAV A;  3WJO A;  2FTZ A;  2ZY1 A;  5ERN A;  3N5H F;  3WCE A;  2Q9Y A;  5HN7 A;  4MC3 A;  3CC9 A;  3SDU A;  2OGD A;  5C05 A;  1UBW A;  2Z4W A;  2AEL A;  5E8L A;  1VG6 A;  2ZCO A;  2Z50 A;  3WE9 A;  3TFP A;  4NUA A;  1HXG A;  5A0I A;  5CG6 A;  4NFJ F;  5I1U A;  4LLT A;  3WEK A;  5B03 A;  2ZCS A;  4LFV F;  3WCD A;  2PS5 A;  5JV1 F;  3B7L A;  5IKH A;  1YYU A;  3CP6 A;  1WL2 A;  3ASX A;  2O1O A;  3P41 A;  1WL0 A;  5IN8 A;  3Q2Q A;  4GP2 A;  2E93 A;  3LG5 A;  3LEE A;  3M01 A;  5EAU A;  1UBX A;  4KVW A;  3PH7 A;  3EZ3 A;  4PVX F;  4JZX A;  3IPI A;  3TFV A;  1YYQ A;  5ILI A;  5H9D A;  3LMD A;  4LFG A;  1HXA A;  3S4J A;  5A0K A;  2OA6 A;  3OAC A;  3NPR A;  1DI1 A;  1YYS A;  1DGP A;  3TS7 A;  1YYT A;  1N24 A;  3RMG A;  2E8W A;  4JYX A;  3CKE A;  5KSX F;  4NG6 A;  2ZEV A;  2AZL A;  3N3D A;  4GP1 A;  3Q30 A;  2E91 A;  4JVJ F;  4MC0 A;  3SDT A;  4F62 A;  2P1C A;  5JV0 F;  3ICZ A;  1KIY A;  3KRF B;  4LUU A;  4P0X A;  3VJE A;  1FPS A;  3TFN A;  3WCF A;  4OKM A;  4KKM A;  3ZMC A;  5B0M A;  3N49 F;  4KVY A;  5EAT A;  2F94 F;  5IK0 A;  2E8X A;  4LZ3 A;  2PS7 A;  1UBV A;  4KVD A;  3W7F A;  4LA6 A;  3WJK A;  3LK5 A;  3LSN A;  4KVI A;  1KIZ A;  1V4J A;  5DGM F;  3M00 A;  4RXC A;  2ONG A;  4UMJ A;  1N22 A;  3ICK A;  2E8V A;  4EA2 A;  5ERO A;  3SAE A;  4P0W A;  3LJI A;  3NRI A;  3ACY A;  2PS4 A;  4RNQ A;  3N5J F;  3KB9 A;  3M0G A;  3ZMB A;  4OKZ A;  4N9U A;  1RQJ A;  4KPD A;  3LLW A;  1WY0 A;  1VG3 A;  4MC8 A;  3UCA A;  3RYE A;  4P0V A;  5IM1 A;  4RXE A;  3WJN A;  3QKC A;  5DIQ F;  4F6X A;  4RXA A;  3N6K F;  2ZCQ A;  5B0I A;  2J1P A;  3KRA B;  2F8C F;  3ACX A;  2Z4Y A;  4LTZ A;  3LGK A;  3DYF A;  3KRP B;  4LOB A;  3WCH A;  1N20 A;  2DH4 A;  4JXY A;  2Z7I A;  4KK2 A;  3NF2 A;  2E95 A;  4DHD A;  3WCM A;  4KPJ A;  3IBA A;  3WCG A;  5JUZ F;  3VJA A;  4DXJ A;  5EAS A;  2AEK A;  3WSA A;  3VJB A;  2AZJ A;  5IKA A;  3ADZ A;  4OGU A;  3WEJ A;  3WC9 A;  5ILD A;  4H5D F;  3AQB B;  3LGZ B;  3APZ A;  5IMI A;  1V4H A;  4DWB A;  3G4D A;  5CG5 A;  4NKF A;  2FOR A;  3KRF A;  2Z4X A;  4K10 A;  4LLS A;  3RYW A;  1N23 A;  5JV2 F;  5B0J A;  2ONH A;  3WCI A;  5JA0 F;  1N21 A;  2E4O A;  2E8T A;  2OPM A;  5DGN F;  4LXW A;  3KRC B;  5IK6 A;  5B01 A;  2AZK A;  3Q1O A;  4FP4 A;  3N46 F;  1VG7 A;  2H8O A;  2ZCR A;  1EZF A;  3M02 A;  4GA3 A;  4F6V A;  5HNA A;  4LPH F;  3OAB B;  1YHK A;  3AE0 A;  3V1V A;  3ZOU A;  2E94 A;  3V66 A;  2EWG A;  3MZV A;  3N0F A;  5DJP F;  5HN9 A;  4XQS F;  5ILZ A;  4KQS A;  2F92 F;  1V4E A;  4L2X F;  4EA0 A;  3EFQ A;  1VG4 A;  2I19 A;  3DYH A;  5DJR F;  5IVG A;  4DZW A;  1YJ4 A;  3VJC A;  2Q9Z A;  3SDV A;  3EGT A;  3LZ9 A;  4LZ0 A;  1HX9 A;  3SDQ A;  1YHM A;  5B00 A;  1HM4 A;  1YQ7 A;  3PYB A;  5E8H A;  4NFI F;  3WCA A;  4GAX A;  4PVY F;  2PS8 A;  3AQC B;  2Q58 A;  4LA5 A;  5AYP A;  4RYP A;  3BNX A;  2J5C A;  3P8L A;  3KRA A;  3WEG A;  3KRP A;  5AFX A;  5HN8 A;  3N3L F;  3PYA A;  5DGS F;  3LVS A;  4JXN A;  2Z7H A;  1RTR A;  3S9V A;  3PDE A;  4H5E F;  4QXS F;  2F8Z F;  5ERM A;  4KQU A;  1WL3 A;  3RBM A;  4JZB A;  4ZQ8 A;  3QQV A;  3VJ8 A;  4XQR F;  4N1Z F;  4HD1 A;  3BNY A;  3N1V F;  1JFG A;  2ZEU A;  3NPK A;  2Q80 A;  4KWD A;  4NFK F;  3WCL A;  5DHK A;  4XQT F;  2OPN A;  5IL3 A;  3AQ0 A;  3G4F A;  3ACW A;  5ILK A;  2J1O A;  5A0J A;  5AHU B;  2PS6 A;  4KQ5 A;  1HXC A;  3WEI A;  1ZW5 A;  2F89 F;  3N0G A;  2Z4V A;  3KRC A;  4LZC A;  1N1B A;  1VG2 A;  2E92 A;  1HM7 A;  4OMG A;  5ER8 A;  3ZL6 A;  1V4K A;  3KBK A;  2RAH A;  2Z78 A;  5DHI A;  1N1Z A;  3PKO A;  3N45 F;  3OAB A;  4WK5 A;  4LPG F;  5IK9 A;  5ILJ A;  4LFE A;  1V4I A;  5DW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...