5B0MA

Structure of moen5-sso7d fusion protein in complex with beta-dodecyl maltoside
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
264
structure length
264
Chain Sequence
DDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, dna binding protein
molecule keywords MoeN5,DNA-binding protein 7d
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
total genus 111
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b0mA00
3N5HF 2E8WA 3NPRA 5IKHA 4DWGA 2VF6A 1N24A 1FPSA 2AZLA 3W7FA 3WEFA 3RBMA 5IM1A 5JA0F 3ICNA 3WCGA 4LZ0A 4JXNA 4NKEA 2OGDA 3LG5A 1WKZA 3M0GA 5IL8A 4EA1A 3N49F 5DHIA 1YHLA 1N22A 2PS4A 3RYWA 3N3LF 1V4EA 3QKCA 4GA3A 3VJBA 1YV5A 5ILYA 5ERNA 4KVWA 5JV2F 4K10A 3WEIA 2F94F 3KBKA 5AFXA 5DGMF 4PVYF 2E4OA 5HN9A 1UBWA 1V4KA 5B0IA 3WSBA 5DGSF 3EFQA 2ZEVA 5EROA 5I1UA 4NFJF 4RXCA 3ICKA 5EASA 1YQ7A 4NFIF 1UBXA 3WSAA 1V4IA 5ILDA 4Q23A 3OABA 1YYTA 4L2XF 3VJ9A 5B0JA 4F6VA 4P0WA 3WC9A 3NRIA 2AZKA 1VG6A 4KFAA 3UCAA 3ICMA 5IVGA 4UMJA 3ACWA 1KIYA 3LZ9A 3S9VA 1UBYA 3QQVA 5ILZA 4H5CF 1PS1A 4KUXA 5JV1F 5CG5A 5B0KA 2OPMA 3NF2A 4LZ3A 4N1ZF 2F9KF 4QPFA 2J5CA 3LGZB 5IMIA 4KQSA 5B01A 4LPGF 5A0IA 3PYAA 1VG3A 3ID0A 3V66A 2ZCSA 3P5PA 3PH7A 3TS7A 2ONHA 1N23A 2Z4VA 3ZMBA 3WEKA 5IL3A 3ZCDA 2Z78A 5A0JA 1YJ4A 2Z4XA 5IKAA 3WCMA 3SDUA 2O1OA 4N9UA 3ZL6A 3Q30A 1HXGA 3WE9A 5B0LA 3LVSA 2Q80A 2F8CF 5IMNA 4LA6A 3N6KF 1VG4A 3N3DA 1WMWA 4QXSF 3KB9A 5DJVF 3LLWA 1JFGA 3LJIA 3OACB 4E1EA 4NKFA 5B00A 2E92A 5DHKA 2Z50A 2FTZA 4LUUA 3KRAB 3LMDA 3Q2ZA 3SAEA 5B0MA 1RQJA 4RXEA 5IMPA 5HN7A 5DGNF 3Q1OA 4NFKF 5B02A 4OKMA 2RAHA 3KRFB 3KRFA 1HX9A 4KQ5A 3WJKA 1WL1A 2PS7A 2F7MF 2E90A 4LZCA 3N5JF 4P0VA 4LIXA 4XQRF 3WCFA 3SDQA 3Q2QA 1VG2A 5KSXF 3TC1A 3ACYA 4RXDA 4KK2A 3M01A 3VJDA 4RYPA 1YHKA 1DI1A 3N0FA 2EWGA 4H5DF 5ILIA 2AZJA 4KKMA 3IPIA 3CP6A 3M9UA 3AQBB 2E93A 4JYXA 3ADZA 4LFEA 4DXJA 5IK6A 3MZVA 3N46F 3PYBA 3PDEA 5DIQF 3P8RA 3P5RA 4DWBA 4LTZA 2E8XA 4DHDA 3P41A 1HM7A 4GP1A 3WCLA 3DYHA 5ILJA 5AELA 3VJAA 2F92F 4HD1A 3N1VF 1V4HA 3ASXA 3LSNA 3ZMCA 5HNAA 4KVDA 5AYPA 4NUAA 2ZEUA 3KRPB 2ZCQA 2Q9YA 2I19A 1YYSA 1RTRA 3CC9A 1YYQA 3WCEA 3N0GA 1WL3A 4FP4A 2J1OA 4F62A 1DGPA 3AE0A 5H9DA 1WY0A 1EZFA 4P0XA 4XQSF 5ERMA 4KPDA 4NG6A 4ZQ8A 4WK5A 1VG7A 2J1PA 3TFPA 2PS5A 1N20A 5C05A 3LDWA 2E8VA 1N1ZA 4DI5A 3KRCB 3M02A 3IBAA 4E9ZA 3N1WF 3AQCB 5JV0F 4LXWA 3B7LA 3ACXA 4OMHA 5HN8A 3OACA 4RXAA 5CG6A 3SDRA 4JVJF 3N45F 4KWDA 3LEEA 4E9UA 5IN8A 3G4FA 4JZBA 2DH4A 5ER8A 3KRAA 3WCBA 2AETA 4KVYA 4LPHF 3RMGA 1ZW5A 1YHMA 3WJOA 3OYRA 2E8UA 5A0KA 2ONGA 4H5EF 5B03A 3EGTA 1RQIA 5ILKA 3LOMA 3VJCA 3LGKA 1V4JA 5E8LA 3WEJA 4DEMF 5E8HA 3BNYA 3PKOA 2ZY1A 3VJEA 5JUZF 3RYEA 3ZOUA 3V1VA 1JFAA 1WL0A 2ZCRA 4MC3A 2ZCOA 4LFVF 3WCIA 3EZ3A 4MC8A 5DJPF 5E8KA 4JXYA 1YYUA 3SDVA 4MC0A 2Z52A 1HXCA 4KQUA 2P1CA 2OA6A 2E95A 5DZ2A 3MAVA 3LK5A 1HM4A 3BNXA 1N1BA 1WL2A 3ICZA 3TFVA 4OMGA 4OGUA 2PS6A 2F8ZF 2E91A 3KROB 4LTVA 2AEKA 3KROA 4RNQA 2F89F 3DYGA 1KIZA 4FJQA 4GP2A 2E94A 3OABB 3V1XA 2E8TA 5ILHA 2Z7HA 1N21A 2FORA 4LA5A 3WCAA 3P8LA 3DYFA 3KRPA 4OKZA 4EA0A 3S4JA 4F6XA 3SDTA 2PS8A 3WCJA 4PVXF 2Z4YA 2QISA 3WCCA 1UBVA 4EA2A 4DZWA 2Z7IA 4JZXA 3APZA 5EATA 5AHUB 3WEGA 1YYRA 3AQ0A 4LFGA 3VJ8A 2Q9ZA 3G4DA 3WEHA 1HXAA 2OPNA 3M00A 3NPKA 3TFNA 2H8OA 4GAXA 3CKEA 2Z4WA 4LOBA 5IK9A 4XQTF 5EAUA 2Q58A 3KRCA 4KVIA 3WCHA 3WCDA 2AELA 5IK0A 4KPJA 5DW7A 4LLSA 2Z4ZA 5DJRF 3WJNA 4LLTA
chains in the Genus database with same CATH superfamily
3N5HF 2E8WA 3NPRA 5IKHA 4DWGA 2VF6A 1N24A 1FPSA 2AZLA 3W7FA 3WEFA 3RBMA 5IM1A 5JA0F 3ICNA 3WCGA 4LZ0A 4JXNA 4NKEA 2OGDA 3LG5A 1WKZA 3M0GA 5IL8A 4EA1A 3N49F 5DHIA 1YHLA 1N22A 2PS4A 3RYWA 3N3LF 1V4EA 3QKCA 4GA3A 3VJBA 1YV5A 5ILYA 5ERNA 4KVWA 5JV2F 4K10A 3WEIA 2F94F 3KBKA 5AFXA 5DGMF 4PVYF 2E4OA 5HN9A 1UBWA 1V4KA 5B0IA 3WSBA 5DGSF 3EFQA 2ZEVA 5EROA 5I1UA 4NFJF 4RXCA 3ICKA 5EASA 1YQ7A 4NFIF 1UBXA 3WSAA 1V4IA 5ILDA 4Q23A 3OABA 1YYTA 4L2XF 3VJ9A 5B0JA 4F6VA 4P0WA 3WC9A 3NRIA 2AZKA 1VG6A 4KFAA 3UCAA 3ICMA 5IVGA 4UMJA 3ACWA 1KIYA 3LZ9A 3S9VA 1UBYA 3QQVA 5ILZA 4H5CF 1PS1A 4KUXA 5JV1F 5CG5A 5B0KA 2OPMA 3NF2A 4LZ3A 4N1ZF 2F9KF 4QPFA 2J5CA 3LGZB 5IMIA 4KQSA 5B01A 4LPGF 5A0IA 3PYAA 1VG3A 3ID0A 3V66A 2ZCSA 3P5PA 3PH7A 3TS7A 2ONHA 1N23A 2Z4VA 3ZMBA 3WEKA 5IL3A 3ZCDA 2Z78A 5A0JA 1YJ4A 2Z4XA 5IKAA 3WCMA 3SDUA 2O1OA 4N9UA 3ZL6A 3Q30A 1HXGA 3WE9A 5B0LA 3LVSA 2Q80A 2F8CF 5IMNA 4LA6A 3N6KF 1VG4A 3N3DA 1WMWA 4QXSF 3KB9A 5DJVF 3LLWA 1JFGA 3LJIA 3OACB 4E1EA 4NKFA 5B00A 2E92A 5DHKA 2Z50A 2FTZA 4LUUA 3KRAB 3LMDA 3Q2ZA 3SAEA 5B0MA 1RQJA 4RXEA 5IMPA 5HN7A 5DGNF 3Q1OA 4NFKF 5B02A 4OKMA 2RAHA 3KRFB 3KRFA 1HX9A 4KQ5A 3WJKA 1WL1A 2PS7A 2F7MF 2E90A 4LZCA 3N5JF 4P0VA 4LIXA 4XQRF 3WCFA 3SDQA 3Q2QA 1VG2A 5KSXF 3TC1A 3ACYA 4RXDA 4KK2A 3M01A 3VJDA 4RYPA 1YHKA 1DI1A 3N0FA 2EWGA 4H5DF 5ILIA 2AZJA 4KKMA 3IPIA 3CP6A 3M9UA 3AQBB 2E93A 4JYXA 3ADZA 4LFEA 4DXJA 5IK6A 3MZVA 3N46F 3PYBA 3PDEA 5DIQF 3P8RA 3P5RA 4DWBA 4LTZA 2E8XA 4DHDA 3P41A 1HM7A 4GP1A 3WCLA 3DYHA 5ILJA 5AELA 3VJAA 2F92F 4HD1A 3N1VF 1V4HA 3ASXA 3LSNA 3ZMCA 5HNAA 4KVDA 5AYPA 4NUAA 2ZEUA 3KRPB 2ZCQA 2Q9YA 2I19A 1YYSA 1RTRA 3CC9A 1YYQA 3WCEA 3N0GA 1WL3A 4FP4A 2J1OA 4F62A 1DGPA 3AE0A 5H9DA 1WY0A 1EZFA 4P0XA 4XQSF 5ERMA 4KPDA 4NG6A 4ZQ8A 4WK5A 1VG7A 2J1PA 3TFPA 2PS5A 1N20A 5C05A 3LDWA 2E8VA 1N1ZA 4DI5A 3KRCB 3M02A 3IBAA 4E9ZA 3N1WF 3AQCB 5JV0F 4LXWA 3B7LA 3ACXA 4OMHA 5HN8A 3OACA 4RXAA 5CG6A 3SDRA 4JVJF 3N45F 4KWDA 3LEEA 4E9UA 5IN8A 3G4FA 4JZBA 2DH4A 5ER8A 3KRAA 3WCBA 2AETA 4KVYA 4LPHF 3RMGA 1ZW5A 1YHMA 3WJOA 3OYRA 2E8UA 5A0KA 2ONGA 4H5EF 5B03A 3EGTA 1RQIA 5ILKA 3LOMA 3VJCA 3LGKA 1V4JA 5E8LA 3WEJA 4DEMF 5E8HA 3BNYA 3PKOA 2ZY1A 3VJEA 5JUZF 3RYEA 3ZOUA 3V1VA 1JFAA 1WL0A 2ZCRA 4MC3A 2ZCOA 4LFVF 3WCIA 3EZ3A 4MC8A 5DJPF 5E8KA 4JXYA 1YYUA 3SDVA 4MC0A 2Z52A 1HXCA 4KQUA 2P1CA 2OA6A 2E95A 5DZ2A 3MAVA 3LK5A 1HM4A 3BNXA 1N1BA 1WL2A 3ICZA 3TFVA 4OMGA 4OGUA 2PS6A 2F8ZF 2E91A 3KROB 4LTVA 2AEKA 3KROA 4RNQA 2F89F 3DYGA 1KIZA 4FJQA 4GP2A 2E94A 3OABB 3V1XA 2E8TA 5ILHA 2Z7HA 1N21A 2FORA 4LA5A 3WCAA 3P8LA 3DYFA 3KRPA 4OKZA 4EA0A 3S4JA 4F6XA 3SDTA 2PS8A 3WCJA 4PVXF 2Z4YA 2QISA 3WCCA 1UBVA 4EA2A 4DZWA 2Z7IA 4JZXA 3APZA 5EATA 5AHUB 3WEGA 1YYRA 3AQ0A 4LFGA 3VJ8A 2Q9ZA 3G4DA 3WEHA 1HXAA 2OPNA 3M00A 3NPKA 3TFNA 2H8OA 4GAXA 3CKEA 2Z4WA 4LOBA 5IK9A 4XQTF 5EAUA 2Q58A 3KRCA 4KVIA 3WCHA 3WCDA 2AELA 5IK0A 4KPJA 5DW7A 4LLSA 2Z4ZA 5DJRF 3WJNA 4LLTA
chains in the Genus database with same CATH topology
3N5HF 2E8WA 3NPRA 5IKHA 4DWGA 2VF6A 1N24A 1FPSA 2AZLA 3W7FA 3WEFA 3RBMA 5IM1A 5JA0F 3ICNA 3WCGA 4LZ0A 4JXNA 4NKEA 2OGDA 3LG5A 1WKZA 3M0GA 5IL8A 4EA1A 3N49F 5DHIA 1YHLA 1N22A 2PS4A 3RYWA 3N3LF 1V4EA 3QKCA 4GA3A 3VJBA 1YV5A 5ILYA 5ERNA 4KVWA 5JV2F 4K10A 3WEIA 2F94F 3KBKA 5AFXA 5DGMF 4PVYF 2E4OA 5HN9A 1UBWA 1V4KA 5B0IA 3WSBA 5DGSF 3EFQA 2ZEVA 5EROA 5I1UA 4NFJF 4RXCA 3ICKA 5EASA 1YQ7A 4NFIF 1UBXA 3WSAA 1V4IA 5ILDA 4Q23A 3OABA 1YYTA 4L2XF 3VJ9A 5B0JA 4F6VA 4P0WA 3WC9A 3NRIA 2AZKA 1VG6A 4KFAA 3UCAA 3ICMA 5IVGA 4UMJA 3ACWA 1KIYA 3LZ9A 3S9VA 1UBYA 3QQVA 5ILZA 4H5CF 1PS1A 4KUXA 5JV1F 5CG5A 5B0KA 2OPMA 3NF2A 4LZ3A 4N1ZF 2F9KF 4QPFA 2J5CA 3LGZB 5IMIA 4KQSA 5B01A 4LPGF 5A0IA 3PYAA 1VG3A 3ID0A 3V66A 2ZCSA 3P5PA 3PH7A 3TS7A 2ONHA 1N23A 2Z4VA 3ZMBA 3WEKA 5IL3A 3ZCDA 2Z78A 5A0JA 1YJ4A 2Z4XA 5IKAA 3WCMA 3SDUA 2O1OA 4N9UA 3ZL6A 3Q30A 1HXGA 3WE9A 5B0LA 3LVSA 2Q80A 2F8CF 5IMNA 4LA6A 3N6KF 1VG4A 3N3DA 1WMWA 4QXSF 3KB9A 5DJVF 3LLWA 1JFGA 3LJIA 3OACB 4E1EA 4NKFA 5B00A 2E92A 5DHKA 2Z50A 2FTZA 4LUUA 3KRAB 3LMDA 3Q2ZA 3SAEA 5B0MA 1RQJA 4RXEA 5IMPA 5HN7A 5DGNF 3Q1OA 4NFKF 5B02A 4OKMA 2RAHA 3KRFB 3KRFA 1HX9A 4KQ5A 3WJKA 1WL1A 2PS7A 2F7MF 2E90A 4LZCA 3N5JF 4P0VA 4LIXA 4XQRF 3WCFA 3SDQA 3Q2QA 1VG2A 5KSXF 3TC1A 3ACYA 4RXDA 4KK2A 3M01A 3VJDA 4RYPA 1YHKA 1DI1A 3N0FA 2EWGA 4H5DF 5ILIA 2AZJA 4KKMA 3IPIA 3CP6A 3M9UA 3AQBB 2E93A 4JYXA 3ADZA 4LFEA 4DXJA 5IK6A 3MZVA 3N46F 3PYBA 3PDEA 5DIQF 3P8RA 3P5RA 4DWBA 4LTZA 2E8XA 4DHDA 3P41A 1HM7A 4GP1A 3WCLA 3DYHA 5ILJA 5AELA 3VJAA 2F92F 4HD1A 3N1VF 1V4HA 3ASXA 3LSNA 3ZMCA 5HNAA 4KVDA 5AYPA 4NUAA 2ZEUA 3KRPB 2ZCQA 2Q9YA 2I19A 1YYSA 1RTRA 3CC9A 1YYQA 3WCEA 3N0GA 1WL3A 4FP4A 2J1OA 4F62A 1DGPA 3AE0A 5H9DA 1WY0A 1EZFA 4P0XA 4XQSF 5ERMA 4KPDA 4NG6A 4ZQ8A 4WK5A 1VG7A 2J1PA 3TFPA 2PS5A 1N20A 5C05A 3LDWA 2E8VA 1N1ZA 4DI5A 3KRCB 3M02A 3IBAA 4E9ZA 3N1WF 3AQCB 5JV0F 4LXWA 3B7LA 3ACXA 4OMHA 5HN8A 3OACA 4RXAA 5CG6A 3SDRA 4JVJF 3N45F 4KWDA 3LEEA 4E9UA 5IN8A 3G4FA 4JZBA 2DH4A 5ER8A 3KRAA 3WCBA 2AETA 4KVYA 4LPHF 3RMGA 1ZW5A 1YHMA 3WJOA 3OYRA 2E8UA 5A0KA 2ONGA 4H5EF 5B03A 3EGTA 1RQIA 5ILKA 3LOMA 3VJCA 3LGKA 1V4JA 5E8LA 3WEJA 4DEMF 5E8HA 3BNYA 3PKOA 2ZY1A 3VJEA 5JUZF 3RYEA 3ZOUA 3V1VA 1JFAA 1WL0A 2ZCRA 4MC3A 2ZCOA 4LFVF 3WCIA 3EZ3A 4MC8A 5DJPF 5E8KA 4JXYA 1YYUA 3SDVA 4MC0A 2Z52A 1HXCA 4KQUA 2P1CA 2OA6A 2E95A 5DZ2A 3MAVA 3LK5A 1HM4A 3BNXA 1N1BA 1WL2A 3ICZA 3TFVA 4OMGA 4OGUA 2PS6A 2F8ZF 2E91A 3KROB 4LTVA 2AEKA 3KROA 4RNQA 2F89F 3DYGA 1KIZA 4FJQA 4GP2A 2E94A 3OABB 3V1XA 2E8TA 5ILHA 2Z7HA 1N21A 2FORA 4LA5A 3WCAA 3P8LA 3DYFA 3KRPA 4OKZA 4EA0A 3S4JA 4F6XA 3SDTA 2PS8A 3WCJA 4PVXF 2Z4YA 2QISA 3WCCA 1UBVA 4EA2A 4DZWA 2Z7IA 4JZXA 3APZA 5EATA 5AHUB 3WEGA 1YYRA 3AQ0A 4LFGA 3VJ8A 2Q9ZA 3G4DA 3WEHA 1HXAA 2OPNA 3M00A 3NPKA 3TFNA 2H8OA 4GAXA 3CKEA 2Z4WA 4LOBA 5IK9A 4XQTF 5EAUA 2Q58A 3KRCA 4KVIA 3WCHA 3WCDA 2AELA 5IK0A 4KPJA 5DW7A 4LLSA 2Z4ZA 5DJRF 3WJNA 4LLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5H F;  2E8W A;  3NPR A;  5IKH A;  4DWG A;  2VF6 A;  1N24 A;  1FPS A;  2AZL A;  3W7F A;  3WEF A;  3RBM A;  5IM1 A;  5JA0 F;  3ICN A;  3WCG A;  4LZ0 A;  4JXN A;  4NKE A;  2OGD A;  3LG5 A;  1WKZ A;  3M0G A;  5IL8 A;  4EA1 A;  3N49 F;  5DHI A;  1YHL A;  1N22 A;  2PS4 A;  3RYW A;  3N3L F;  1V4E A;  3QKC A;  4GA3 A;  3VJB A;  1YV5 A;  5ILY A;  5ERN A;  4KVW A;  5JV2 F;  4K10 A;  3WEI A;  2F94 F;  3KBK A;  5AFX A;  5DGM F;  4PVY F;  2E4O A;  5HN9 A;  1UBW A;  1V4K A;  5B0I A;  3WSB A;  5DGS F;  3EFQ A;  2ZEV A;  5ERO A;  5I1U A;  4NFJ F;  4RXC A;  3ICK A;  5EAS A;  1YQ7 A;  4NFI F;  1UBX A;  3WSA A;  1V4I A;  5ILD A;  4Q23 A;  3OAB A;  1YYT A;  4L2X F;  3VJ9 A;  5B0J A;  4F6V A;  4P0W A;  3WC9 A;  3NRI A;  2AZK A;  1VG6 A;  4KFA A;  3UCA A;  3ICM A;  5IVG A;  4UMJ A;  3ACW A;  1KIY A;  3LZ9 A;  3S9V A;  1UBY A;  3QQV A;  5ILZ A;  4H5C F;  1PS1 A;  4KUX A;  5JV1 F;  5CG5 A;  5B0K A;  2OPM A;  3NF2 A;  4LZ3 A;  4N1Z F;  2F9K F;  4QPF A;  2J5C A;  3LGZ B;  5IMI A;  4KQS A;  5B01 A;  4LPG F;  5A0I A;  3PYA A;  1VG3 A;  3ID0 A;  3V66 A;  2ZCS A;  3P5P A;  3PH7 A;  3TS7 A;  2ONH A;  1N23 A;  2Z4V A;  3ZMB A;  3WEK A;  5IL3 A;  3ZCD A;  2Z78 A;  5A0J A;  1YJ4 A;  2Z4X A;  5IKA A;  3WCM A;  3SDU A;  2O1O A;  4N9U A;  3ZL6 A;  3Q30 A;  1HXG A;  3WE9 A;  5B0L A;  3LVS A;  2Q80 A;  2F8C F;  5IMN A;  4LA6 A;  3N6K F;  1VG4 A;  3N3D A;  1WMW A;  4QXS F;  3KB9 A;  5DJV F;  3LLW A;  1JFG A;  3LJI A;  3OAC B;  4E1E A;  4NKF A;  5B00 A;  2E92 A;  5DHK A;  2Z50 A;  2FTZ A;  4LUU A;  3KRA B;  3LMD A;  3Q2Z A;  3SAE A;  5B0M A;  1RQJ A;  4RXE A;  5IMP A;  5HN7 A;  5DGN F;  3Q1O A;  4NFK F;  5B02 A;  4OKM A;  2RAH A;  3KRF B;  3KRF A;  1HX9 A;  4KQ5 A;  3WJK A;  1WL1 A;  2PS7 A;  2F7M F;  2E90 A;  4LZC A;  3N5J F;  4P0V A;  4LIX A;  4XQR F;  3WCF A;  3SDQ A;  3Q2Q A;  1VG2 A;  5KSX F;  3TC1 A;  3ACY A;  4RXD A;  4KK2 A;  3M01 A;  3VJD A;  4RYP A;  1YHK A;  1DI1 A;  3N0F A;  2EWG A;  4H5D F;  5ILI A;  2AZJ A;  4KKM A;  3IPI A;  3CP6 A;  3M9U A;  3AQB B;  2E93 A;  4JYX A;  3ADZ A;  4LFE A;  4DXJ A;  5IK6 A;  3MZV A;  3N46 F;  3PYB A;  3PDE A;  5DIQ F;  3P8R A;  3P5R A;  4DWB A;  4LTZ A;  2E8X A;  4DHD A;  3P41 A;  1HM7 A;  4GP1 A;  3WCL A;  3DYH A;  5ILJ A;  5AEL A;  3VJA A;  2F92 F;  4HD1 A;  3N1V F;  1V4H A;  3ASX A;  3LSN A;  3ZMC A;  5HNA A;  4KVD A;  5AYP A;  4NUA A;  2ZEU A;  3KRP B;  2ZCQ A;  2Q9Y A;  2I19 A;  1YYS A;  1RTR A;  3CC9 A;  1YYQ A;  3WCE A;  3N0G A;  1WL3 A;  4FP4 A;  2J1O A;  4F62 A;  1DGP A;  3AE0 A;  5H9D A;  1WY0 A;  1EZF A;  4P0X A;  4XQS F;  5ERM A;  4KPD A;  4NG6 A;  4ZQ8 A;  4WK5 A;  1VG7 A;  2J1P A;  3TFP A;  2PS5 A;  1N20 A;  5C05 A;  3LDW A;  2E8V A;  1N1Z A;  4DI5 A;  3KRC B;  3M02 A;  3IBA A;  4E9Z A;  3N1W F;  3AQC B;  5JV0 F;  4LXW A;  3B7L A;  3ACX A;  4OMH A;  5HN8 A;  3OAC A;  4RXA A;  5CG6 A;  3SDR A;  4JVJ F;  3N45 F;  4KWD A;  3LEE A;  4E9U A;  5IN8 A;  3G4F A;  4JZB A;  2DH4 A;  5ER8 A;  3KRA A;  3WCB A;  2AET A;  4KVY A;  4LPH F;  3RMG A;  1ZW5 A;  1YHM A;  3WJO A;  3OYR A;  2E8U A;  5A0K A;  2ONG A;  4H5E F;  5B03 A;  3EGT A;  1RQI A;  5ILK A;  3LOM A;  3VJC A;  3LGK A;  1V4J A;  5E8L A;  3WEJ A;  4DEM F;  5E8H A;  3BNY A;  3PKO A;  2ZY1 A;  3VJE A;  5JUZ F;  3RYE A;  3ZOU A;  3V1V A;  1JFA A;  1WL0 A;  2ZCR A;  4MC3 A;  2ZCO A;  4LFV F;  3WCI A;  3EZ3 A;  4MC8 A;  5DJP F;  5E8K A;  4JXY A;  1YYU A;  3SDV A;  4MC0 A;  2Z52 A;  1HXC A;  4KQU A;  2P1C A;  2OA6 A;  2E95 A;  5DZ2 A;  3MAV A;  3LK5 A;  1HM4 A;  3BNX A;  1N1B A;  1WL2 A;  3ICZ A;  3TFV A;  4OMG A;  4OGU A;  2PS6 A;  2F8Z F;  2E91 A;  3KRO B;  4LTV A;  2AEK A;  3KRO A;  4RNQ A;  2F89 F;  3DYG A;  1KIZ A;  4FJQ A;  4GP2 A;  2E94 A;  3OAB B;  3V1X A;  2E8T A;  5ILH A;  2Z7H A;  1N21 A;  2FOR A;  4LA5 A;  3WCA A;  3P8L A;  3DYF A;  3KRP A;  4OKZ A;  4EA0 A;  3S4J A;  4F6X A;  3SDT A;  2PS8 A;  3WCJ A;  4PVX F;  2Z4Y A;  2QIS A;  3WCC A;  1UBV A;  4EA2 A;  4DZW A;  2Z7I A;  4JZX A;  3APZ A;  5EAT A;  5AHU B;  3WEG A;  1YYR A;  3AQ0 A;  4LFG A;  3VJ8 A;  2Q9Z A;  3G4D A;  3WEH A;  1HXA A;  2OPN A;  3M00 A;  3NPK A;  3TFN A;  2H8O A;  4GAX A;  3CKE A;  2Z4W A;  4LOB A;  5IK9 A;  4XQT F;  5EAU A;  2Q58 A;  3KRC A;  4KVI A;  3WCH A;  3WCD A;  2AEL A;  5IK0 A;  4KPJ A;  5DW7 A;  4LLS A;  2Z4Z A;  5DJR F;  3WJN A;  4LLT A; 
#chains in the Genus database with same CATH topology
 3N5H F;  2E8W A;  3NPR A;  5IKH A;  4DWG A;  2VF6 A;  1N24 A;  1FPS A;  2AZL A;  3W7F A;  3WEF A;  3RBM A;  5IM1 A;  5JA0 F;  3ICN A;  3WCG A;  4LZ0 A;  4JXN A;  4NKE A;  2OGD A;  3LG5 A;  1WKZ A;  3M0G A;  5IL8 A;  4EA1 A;  3N49 F;  5DHI A;  1YHL A;  1N22 A;  2PS4 A;  3RYW A;  3N3L F;  1V4E A;  3QKC A;  4GA3 A;  3VJB A;  1YV5 A;  5ILY A;  5ERN A;  4KVW A;  5JV2 F;  4K10 A;  3WEI A;  2F94 F;  3KBK A;  5AFX A;  5DGM F;  4PVY F;  2E4O A;  5HN9 A;  1UBW A;  1V4K A;  5B0I A;  3WSB A;  5DGS F;  3EFQ A;  2ZEV A;  5ERO A;  5I1U A;  4NFJ F;  4RXC A;  3ICK A;  5EAS A;  1YQ7 A;  4NFI F;  1UBX A;  3WSA A;  1V4I A;  5ILD A;  4Q23 A;  3OAB A;  1YYT A;  4L2X F;  3VJ9 A;  5B0J A;  4F6V A;  4P0W A;  3WC9 A;  3NRI A;  2AZK A;  1VG6 A;  4KFA A;  3UCA A;  3ICM A;  5IVG A;  4UMJ A;  3ACW A;  1KIY A;  3LZ9 A;  3S9V A;  1UBY A;  3QQV A;  5ILZ A;  4H5C F;  1PS1 A;  4KUX A;  5JV1 F;  5CG5 A;  5B0K A;  2OPM A;  3NF2 A;  4LZ3 A;  4N1Z F;  2F9K F;  4QPF A;  2J5C A;  3LGZ B;  5IMI A;  4KQS A;  5B01 A;  4LPG F;  5A0I A;  3PYA A;  1VG3 A;  3ID0 A;  3V66 A;  2ZCS A;  3P5P A;  3PH7 A;  3TS7 A;  2ONH A;  1N23 A;  2Z4V A;  3ZMB A;  3WEK A;  5IL3 A;  3ZCD A;  2Z78 A;  5A0J A;  1YJ4 A;  2Z4X A;  5IKA A;  3WCM A;  3SDU A;  2O1O A;  4N9U A;  3ZL6 A;  3Q30 A;  1HXG A;  3WE9 A;  5B0L A;  3LVS A;  2Q80 A;  2F8C F;  5IMN A;  4LA6 A;  3N6K F;  1VG4 A;  3N3D A;  1WMW A;  4QXS F;  3KB9 A;  5DJV F;  3LLW A;  1JFG A;  3LJI A;  3OAC B;  4E1E A;  4NKF A;  5B00 A;  2E92 A;  5DHK A;  2Z50 A;  2FTZ A;  4LUU A;  3KRA B;  3LMD A;  3Q2Z A;  3SAE A;  5B0M A;  1RQJ A;  4RXE A;  5IMP A;  5HN7 A;  5DGN F;  3Q1O A;  4NFK F;  5B02 A;  4OKM A;  2RAH A;  3KRF B;  3KRF A;  1HX9 A;  4KQ5 A;  3WJK A;  1WL1 A;  2PS7 A;  2F7M F;  2E90 A;  4LZC A;  3N5J F;  4P0V A;  4LIX A;  4XQR F;  3WCF A;  3SDQ A;  3Q2Q A;  1VG2 A;  5KSX F;  3TC1 A;  3ACY A;  4RXD A;  4KK2 A;  3M01 A;  3VJD A;  4RYP A;  1YHK A;  1DI1 A;  3N0F A;  2EWG A;  4H5D F;  5ILI A;  2AZJ A;  4KKM A;  3IPI A;  3CP6 A;  3M9U A;  3AQB B;  2E93 A;  4JYX A;  3ADZ A;  4LFE A;  4DXJ A;  5IK6 A;  3MZV A;  3N46 F;  3PYB A;  3PDE A;  5DIQ F;  3P8R A;  3P5R A;  4DWB A;  4LTZ A;  2E8X A;  4DHD A;  3P41 A;  1HM7 A;  4GP1 A;  3WCL A;  3DYH A;  5ILJ A;  5AEL A;  3VJA A;  2F92 F;  4HD1 A;  3N1V F;  1V4H A;  3ASX A;  3LSN A;  3ZMC A;  5HNA A;  4KVD A;  5AYP A;  4NUA A;  2ZEU A;  3KRP B;  2ZCQ A;  2Q9Y A;  2I19 A;  1YYS A;  1RTR A;  3CC9 A;  1YYQ A;  3WCE A;  3N0G A;  1WL3 A;  4FP4 A;  2J1O A;  4F62 A;  1DGP A;  3AE0 A;  5H9D A;  1WY0 A;  1EZF A;  4P0X A;  4XQS F;  5ERM A;  4KPD A;  4NG6 A;  4ZQ8 A;  4WK5 A;  1VG7 A;  2J1P A;  3TFP A;  2PS5 A;  1N20 A;  5C05 A;  3LDW A;  2E8V A;  1N1Z A;  4DI5 A;  3KRC B;  3M02 A;  3IBA A;  4E9Z A;  3N1W F;  3AQC B;  5JV0 F;  4LXW A;  3B7L A;  3ACX A;  4OMH A;  5HN8 A;  3OAC A;  4RXA A;  5CG6 A;  3SDR A;  4JVJ F;  3N45 F;  4KWD A;  3LEE A;  4E9U A;  5IN8 A;  3G4F A;  4JZB A;  2DH4 A;  5ER8 A;  3KRA A;  3WCB A;  2AET A;  4KVY A;  4LPH F;  3RMG A;  1ZW5 A;  1YHM A;  3WJO A;  3OYR A;  2E8U A;  5A0K A;  2ONG A;  4H5E F;  5B03 A;  3EGT A;  1RQI A;  5ILK A;  3LOM A;  3VJC A;  3LGK A;  1V4J A;  5E8L A;  3WEJ A;  4DEM F;  5E8H A;  3BNY A;  3PKO A;  2ZY1 A;  3VJE A;  5JUZ F;  3RYE A;  3ZOU A;  3V1V A;  1JFA A;  1WL0 A;  2ZCR A;  4MC3 A;  2ZCO A;  4LFV F;  3WCI A;  3EZ3 A;  4MC8 A;  5DJP F;  5E8K A;  4JXY A;  1YYU A;  3SDV A;  4MC0 A;  2Z52 A;  1HXC A;  4KQU A;  2P1C A;  2OA6 A;  2E95 A;  5DZ2 A;  3MAV A;  3LK5 A;  1HM4 A;  3BNX A;  1N1B A;  1WL2 A;  3ICZ A;  3TFV A;  4OMG A;  4OGU A;  2PS6 A;  2F8Z F;  2E91 A;  3KRO B;  4LTV A;  2AEK A;  3KRO A;  4RNQ A;  2F89 F;  3DYG A;  1KIZ A;  4FJQ A;  4GP2 A;  2E94 A;  3OAB B;  3V1X A;  2E8T A;  5ILH A;  2Z7H A;  1N21 A;  2FOR A;  4LA5 A;  3WCA A;  3P8L A;  3DYF A;  3KRP A;  4OKZ A;  4EA0 A;  3S4J A;  4F6X A;  3SDT A;  2PS8 A;  3WCJ A;  4PVX F;  2Z4Y A;  2QIS A;  3WCC A;  1UBV A;  4EA2 A;  4DZW A;  2Z7I A;  4JZX A;  3APZ A;  5EAT A;  5AHU B;  3WEG A;  1YYR A;  3AQ0 A;  4LFG A;  3VJ8 A;  2Q9Z A;  3G4D A;  3WEH A;  1HXA A;  2OPN A;  3M00 A;  3NPK A;  3TFN A;  2H8O A;  4GAX A;  3CKE A;  2Z4W A;  4LOB A;  5IK9 A;  4XQT F;  5EAU A;  2Q58 A;  3KRC A;  4KVI A;  3WCH A;  3WCD A;  2AEL A;  5IK0 A;  4KPJ A;  5DW7 A;  4LLS A;  2Z4Z A;  5DJR F;  3WJN A;  4LLT A; 
#chains in the Genus database with same CATH homology
 3N5H F;  2E8W A;  3NPR A;  5IKH A;  4DWG A;  2VF6 A;  1N24 A;  1FPS A;  2AZL A;  3W7F A;  3WEF A;  3RBM A;  5IM1 A;  5JA0 F;  3ICN A;  3WCG A;  4LZ0 A;  4JXN A;  4NKE A;  2OGD A;  3LG5 A;  1WKZ A;  3M0G A;  5IL8 A;  4EA1 A;  3N49 F;  5DHI A;  1YHL A;  1N22 A;  2PS4 A;  3RYW A;  3N3L F;  1V4E A;  3QKC A;  4GA3 A;  3VJB A;  1YV5 A;  5ILY A;  5ERN A;  4KVW A;  5JV2 F;  4K10 A;  3WEI A;  2F94 F;  3KBK A;  5AFX A;  5DGM F;  4PVY F;  2E4O A;  5HN9 A;  1UBW A;  1V4K A;  5B0I A;  3WSB A;  5DGS F;  3EFQ A;  2ZEV A;  5ERO A;  5I1U A;  4NFJ F;  4RXC A;  3ICK A;  5EAS A;  1YQ7 A;  4NFI F;  1UBX A;  3WSA A;  1V4I A;  5ILD A;  4Q23 A;  3OAB A;  1YYT A;  4L2X F;  3VJ9 A;  5B0J A;  4F6V A;  4P0W A;  3WC9 A;  3NRI A;  2AZK A;  1VG6 A;  4KFA A;  3UCA A;  3ICM A;  5IVG A;  4UMJ A;  3ACW A;  1KIY A;  3LZ9 A;  3S9V A;  1UBY A;  3QQV A;  5ILZ A;  4H5C F;  1PS1 A;  4KUX A;  5JV1 F;  5CG5 A;  5B0K A;  2OPM A;  3NF2 A;  4LZ3 A;  4N1Z F;  2F9K F;  4QPF A;  2J5C A;  3LGZ B;  5IMI A;  4KQS A;  5B01 A;  4LPG F;  5A0I A;  3PYA A;  1VG3 A;  3ID0 A;  3V66 A;  2ZCS A;  3P5P A;  3PH7 A;  3TS7 A;  2ONH A;  1N23 A;  2Z4V A;  3ZMB A;  3WEK A;  5IL3 A;  3ZCD A;  2Z78 A;  5A0J A;  1YJ4 A;  2Z4X A;  5IKA A;  3WCM A;  3SDU A;  2O1O A;  4N9U A;  3ZL6 A;  3Q30 A;  1HXG A;  3WE9 A;  5B0L A;  3LVS A;  2Q80 A;  2F8C F;  5IMN A;  4LA6 A;  3N6K F;  1VG4 A;  3N3D A;  1WMW A;  4QXS F;  3KB9 A;  5DJV F;  3LLW A;  1JFG A;  3LJI A;  3OAC B;  4E1E A;  4NKF A;  5B00 A;  2E92 A;  5DHK A;  2Z50 A;  2FTZ A;  4LUU A;  3KRA B;  3LMD A;  3Q2Z A;  3SAE A;  5B0M A;  1RQJ A;  4RXE A;  5IMP A;  5HN7 A;  5DGN F;  3Q1O A;  4NFK F;  5B02 A;  4OKM A;  2RAH A;  3KRF B;  3KRF A;  1HX9 A;  4KQ5 A;  3WJK A;  1WL1 A;  2PS7 A;  2F7M F;  2E90 A;  4LZC A;  3N5J F;  4P0V A;  4LIX A;  4XQR F;  3WCF A;  3SDQ A;  3Q2Q A;  1VG2 A;  5KSX F;  3TC1 A;  3ACY A;  4RXD A;  4KK2 A;  3M01 A;  3VJD A;  4RYP A;  1YHK A;  1DI1 A;  3N0F A;  2EWG A;  4H5D F;  5ILI A;  2AZJ A;  4KKM A;  3IPI A;  3CP6 A;  3M9U A;  3AQB B;  2E93 A;  4JYX A;  3ADZ A;  4LFE A;  4DXJ A;  5IK6 A;  3MZV A;  3N46 F;  3PYB A;  3PDE A;  5DIQ F;  3P8R A;  3P5R A;  4DWB A;  4LTZ A;  2E8X A;  4DHD A;  3P41 A;  1HM7 A;  4GP1 A;  3WCL A;  3DYH A;  5ILJ A;  5AEL A;  3VJA A;  2F92 F;  4HD1 A;  3N1V F;  1V4H A;  3ASX A;  3LSN A;  3ZMC A;  5HNA A;  4KVD A;  5AYP A;  4NUA A;  2ZEU A;  3KRP B;  2ZCQ A;  2Q9Y A;  2I19 A;  1YYS A;  1RTR A;  3CC9 A;  1YYQ A;  3WCE A;  3N0G A;  1WL3 A;  4FP4 A;  2J1O A;  4F62 A;  1DGP A;  3AE0 A;  5H9D A;  1WY0 A;  1EZF A;  4P0X A;  4XQS F;  5ERM A;  4KPD A;  4NG6 A;  4ZQ8 A;  4WK5 A;  1VG7 A;  2J1P A;  3TFP A;  2PS5 A;  1N20 A;  5C05 A;  3LDW A;  2E8V A;  1N1Z A;  4DI5 A;  3KRC B;  3M02 A;  3IBA A;  4E9Z A;  3N1W F;  3AQC B;  5JV0 F;  4LXW A;  3B7L A;  3ACX A;  4OMH A;  5HN8 A;  3OAC A;  4RXA A;  5CG6 A;  3SDR A;  4JVJ F;  3N45 F;  4KWD A;  3LEE A;  4E9U A;  5IN8 A;  3G4F A;  4JZB A;  2DH4 A;  5ER8 A;  3KRA A;  3WCB A;  2AET A;  4KVY A;  4LPH F;  3RMG A;  1ZW5 A;  1YHM A;  3WJO A;  3OYR A;  2E8U A;  5A0K A;  2ONG A;  4H5E F;  5B03 A;  3EGT A;  1RQI A;  5ILK A;  3LOM A;  3VJC A;  3LGK A;  1V4J A;  5E8L A;  3WEJ A;  4DEM F;  5E8H A;  3BNY A;  3PKO A;  2ZY1 A;  3VJE A;  5JUZ F;  3RYE A;  3ZOU A;  3V1V A;  1JFA A;  1WL0 A;  2ZCR A;  4MC3 A;  2ZCO A;  4LFV F;  3WCI A;  3EZ3 A;  4MC8 A;  5DJP F;  5E8K A;  4JXY A;  1YYU A;  3SDV A;  4MC0 A;  2Z52 A;  1HXC A;  4KQU A;  2P1C A;  2OA6 A;  2E95 A;  5DZ2 A;  3MAV A;  3LK5 A;  1HM4 A;  3BNX A;  1N1B A;  1WL2 A;  3ICZ A;  3TFV A;  4OMG A;  4OGU A;  2PS6 A;  2F8Z F;  2E91 A;  3KRO B;  4LTV A;  2AEK A;  3KRO A;  4RNQ A;  2F89 F;  3DYG A;  1KIZ A;  4FJQ A;  4GP2 A;  2E94 A;  3OAB B;  3V1X A;  2E8T A;  5ILH A;  2Z7H A;  1N21 A;  2FOR A;  4LA5 A;  3WCA A;  3P8L A;  3DYF A;  3KRP A;  4OKZ A;  4EA0 A;  3S4J A;  4F6X A;  3SDT A;  2PS8 A;  3WCJ A;  4PVX F;  2Z4Y A;  2QIS A;  3WCC A;  1UBV A;  4EA2 A;  4DZW A;  2Z7I A;  4JZX A;  3APZ A;  5EAT A;  5AHU B;  3WEG A;  1YYR A;  3AQ0 A;  4LFG A;  3VJ8 A;  2Q9Z A;  3G4D A;  3WEH A;  1HXA A;  2OPN A;  3M00 A;  3NPK A;  3TFN A;  2H8O A;  4GAX A;  3CKE A;  2Z4W A;  4LOB A;  5IK9 A;  4XQT F;  5EAU A;  2Q58 A;  3KRC A;  4KVI A;  3WCH A;  3WCD A;  2AEL A;  5IK0 A;  4KPJ A;  5DW7 A;  4LLS A;  2Z4Z A;  5DJR F;  3WJN A;  4LLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...