4OMHA

Crystal structure of the bacterial diterpene cyclase cotb2 variant f149l
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
280
structure length
280
Chain Sequence
IGRSSVRPYLEECTRRFQEMFDRHVVTRPTKVELTDAELREVIDDCNAAVAPLGKTVSDERWISYVGVVLWSQSPRHIKDMEAFKAVCVLNCVTFVWDDMDPALHDFGLFLPQLRKICEKYYGPEDAEVAYEAARALVTSDHMFRDSPIKAALCTTSPEQYFRFRVTDIGVDFWMKMSYPIYRHPEFTEHAKTSLAARMTTRGLTIVNDFYSYDREVSLGQITNCFRLCDVSDETAFKEFFQARLDDMIEDIECIKAFDQLTQDVFLDLIYGNFVWTTSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl diphosphate cyclase
publication title The first structure of a bacterial diterpene cyclase: CotB2.
pubmed doi rcsb
source organism Streptomyces melanosporofaciens
molecule tags Lyase
total genus 125
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 4.2.3.146: Cyclooctat-9-en-7-ol synthase.
pdb deposition date 2014-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4omhA00
4KQ5A 3DYGA 5DHIA 1V4KA 5AYPA 2Q58A 5EAUA 3PDEA 3RYWA 2F89F 3M01A 4OGUA 1YYQA 5DW7A 3N45F 4KPDA 4L2XF 2E8XA 3KRFB 4E9ZA 1WKZA 3RMGA 2P1CA 4NUAA 3WEHA 3WCMA 3N49F 3P5PA 2J1OA 3CC9A 2H8OA 2Z7HA 3WSAA 2Q80A 4EA2A 2Z7IA 1N1ZA 3VJDA 5CG5A 4NKEA 3M0GA 1UBXA 4GP1A 3WEJA 3N1VF 4JYXA 5AELA 5IK9A 3N3LF 4P0WA 1N22A 3VJ8A 2PS4A 3M02A 4H5DF 1HX9A 5IKHA 3PH7A 2Z78A 3IPIA 2F8ZF 2E8WA 5JV1F 1WMWA 4LZCA 1V4EA 4NFJF 3PYAA 4LFEA 5IMPA 3AE0A 3ACXA 3B7LA 3V66A 4RXEA 5IM1A 3KRPB 4KVYA 5E8LA 5ERMA 3AQ0A 4KPJA 1V4HA 2E8UA 3BNXA 4GA3A 2ZCRA 2Z50A 3VJ9A 1HXGA 3ICZA 3OACB 3WEGA 3M9UA 4XQTF 3WCBA 3TFPA 3WCIA 3Q2ZA 5IKAA 4KK2A 5A0JA 3KRFA 3PYBA 1YQ7A 5E8HA 4HD1A 5DHKA 2AZKA 2F94F 5IN8A 3MAVA 4JZXA 3IBAA 2PS5A 5DGMF 4LOBA 2E92A 3LOMA 1KIYA 2Z4WA 3KRAB 1YHMA 5B0JA 4JZBA 2PS6A 1HM7A 1WY0A 4PVYF 1YYRA 5AFXA 5IL3A 3N1WF 3LLWA 1RQJA 5JUZF 3WCLA 2ZEVA 1HXAA 2E93A 4XQRF 1V4JA 1HXCA 4LFGA 4K10A 3SDVA 3WJNA 3Q30A 3V1XA 4LXWA 3SDTA 5A0KA 4GP2A 2O1OA 1N21A 5DGSF 4GAXA 4Q23A 3DYHA 1HM4A 3EZ3A 5DJPF 5IK0A 3KRPA 3OABB 4N1ZF 5DGNF 4QPFA 3M00A 1YHKA 4ZQ8A 5ILKA 4NFKF 3Q2QA 1V4IA 3P8LA 3LGZB 5DZ2A 5HNAA 1YV5A 3WCHA 3OACA 5EATA 2Z4VA 5B0LA 4NFIF 5EROA 3TC1A 4MC0A 1RQIA 4P0VA 5IK6A 3WE9A 3LGKA 4LFVF 4H5CF 4LUUA 3WEIA 5ERNA 3LZ9A 1ZW5A 3TFNA 3APZA 4EA1A 4DHDA 1YJ4A 2Z4YA 3VJAA 2E91A 3P5RA 3KRAA 3TFVA 2Z52A 2OGDA 3KRCA 3WCAA 3AQCB 4DI5A 1N20A 3CP6A 3SDUA 4LPGF 4LPHF 2Q9ZA 4OKMA 3N5JF 5EASA 2ZEUA 3OYRA 3ZOUA 3AQBB 3VJCA 4DWGA 5CG6A 4UMJA 3ADZA 5IMNA 4KVIA 4LZ3A 2E90A 4WK5A 4F6XA 3ZCDA 4KKMA 1EZFA 3WCCA 2AETA 5B0MA 3N3DA 5JV0F 4P0XA 3LMDA 1WL3A 3WSBA 2ZCOA 3OABA 1DI1A 1PS1A 3ASXA 3NPKA 4KVDA 2AELA 2PS8A 4NKFA 5ILJA 1WL2A 2J1PA 2F92F 3ICNA 3P41A 3UCAA 4DZWA 2AZJA 5B01A 5A0IA 2F7MF 2AEKA 3S4JA 2FORA 4KVWA 3ID0A 2J5CA 1UBWA 2E94A 3SAEA 3NPRA 4DWBA 5KSXF 3EFQA 1UBYA 1YHLA 4LLTA 5B0IA 3DYFA 5ILZA 4KUXA 2E95A 3QQVA 3G4FA 3WCEA 2EWGA 5HN7A 3N5HF 4E9UA 3S9VA 2VF6A 5AHUB 5ILYA 2ONHA 4MC8A 5B02A 3KB9A 4DEMF 3LDWA 2ZY1A 3WCJA 3WEFA 3WCDA 3RYEA 3SDQA 2QISA 5B0KA 4RXDA 2FTZA 2Z4ZA 1RTRA 2DH4A 1N1BA 5E8KA 1YYUA 5B03A 4RYPA 5H9DA 3TS7A 2OPNA 1VG4A 4F62A 3ICKA 5HN8A 1VG6A 3N46F 3MZVA 4RNQA 4KFAA 4NG6A 5IL8A 3BNYA 5JV2F 2E8TA 2AZLA 1JFAA 2E4OA 3KROB 3CKEA 4XQSF 5ER8A 2RAHA 4FJQA 3Q1OA 3V1VA 4N9UA 3NRIA 4OKZA 3ZL6A 1UBVA 3LK5A 3WCGA 1VG7A 1KIZA 4RXCA 5DJVF 3ZMCA 3ICMA 4QXSF 4LA6A 1YYTA 3ZMBA 3EGTA 3NF2A 5B00A 2F8CF 3VJBA 3QKCA 3WCFA 4H5EF 4FP4A 3WEKA 3LG5A 3SDRA 1VG3A 4JXNA 3ACWA 4LA5A 4LLSA 4LTVA 3N0FA 4OMHA 3RBMA 5ILDA 3G4DA 4F6VA 1VG2A 5IMIA 1WL1A 4JVJF 5DJRF 3WC9A 5ILIA 5I1UA 2ZCQA 5IVGA 3LSNA 4OMGA 5ILHA 3ACYA 2OPMA 4RXAA 1N23A 4LZ0A 4KQUA 3KROA 4MC3A 2OA6A 5JA0F 2ONGA 1JFGA 3VJEA 2Q9YA 3N6KF 3N0GA 2ZCSA 2Z4XA 3P8RA 4LTZA 4KWDA 4EA0A 2PS7A 3LEEA 1WL0A 3WJOA 3LJIA 3KBKA 3KRCB 4KQSA 4PVXF 4JXYA 2F9KF 3W7FA 1YYSA 5HN9A 5C05A 3PKOA 4DXJA 2E8VA 2I19A 5DIQF 1DGPA 1N24A 4E1EA 1FPSA 3LVSA 3WJKA 4LIXA
chains in the Genus database with same CATH superfamily
4KQ5A 3DYGA 5DHIA 1V4KA 5AYPA 2Q58A 5EAUA 3PDEA 3RYWA 2F89F 3M01A 4OGUA 1YYQA 5DW7A 3N45F 4KPDA 4L2XF 2E8XA 3KRFB 4E9ZA 1WKZA 3RMGA 2P1CA 4NUAA 3WEHA 3WCMA 3N49F 3P5PA 2J1OA 3CC9A 2H8OA 2Z7HA 3WSAA 2Q80A 4EA2A 2Z7IA 1N1ZA 3VJDA 5CG5A 4NKEA 3M0GA 1UBXA 4GP1A 3WEJA 3N1VF 4JYXA 5AELA 5IK9A 3N3LF 4P0WA 1N22A 3VJ8A 2PS4A 3M02A 4H5DF 1HX9A 5IKHA 3PH7A 2Z78A 3IPIA 2F8ZF 2E8WA 5JV1F 1WMWA 4LZCA 1V4EA 4NFJF 3PYAA 4LFEA 5IMPA 3AE0A 3ACXA 3B7LA 3V66A 4RXEA 5IM1A 3KRPB 4KVYA 5E8LA 5ERMA 3AQ0A 4KPJA 1V4HA 2E8UA 3BNXA 4GA3A 2ZCRA 2Z50A 3VJ9A 1HXGA 3ICZA 3OACB 3WEGA 3M9UA 4XQTF 3WCBA 3TFPA 3WCIA 3Q2ZA 5IKAA 4KK2A 5A0JA 3KRFA 3PYBA 1YQ7A 5E8HA 4HD1A 5DHKA 2AZKA 2F94F 5IN8A 3MAVA 4JZXA 3IBAA 2PS5A 5DGMF 4LOBA 2E92A 3LOMA 1KIYA 2Z4WA 3KRAB 1YHMA 5B0JA 4JZBA 2PS6A 1HM7A 1WY0A 4PVYF 1YYRA 5AFXA 5IL3A 3N1WF 3LLWA 1RQJA 5JUZF 3WCLA 2ZEVA 1HXAA 2E93A 4XQRF 1V4JA 1HXCA 4LFGA 4K10A 3SDVA 3WJNA 3Q30A 3V1XA 4LXWA 3SDTA 5A0KA 4GP2A 2O1OA 1N21A 5DGSF 4GAXA 4Q23A 3DYHA 1HM4A 3EZ3A 5DJPF 5IK0A 3KRPA 3OABB 4N1ZF 5DGNF 4QPFA 3M00A 1YHKA 4ZQ8A 5ILKA 4NFKF 3Q2QA 1V4IA 3P8LA 3LGZB 5DZ2A 5HNAA 1YV5A 3WCHA 3OACA 5EATA 2Z4VA 5B0LA 4NFIF 5EROA 3TC1A 4MC0A 1RQIA 4P0VA 5IK6A 3WE9A 3LGKA 4LFVF 4H5CF 4LUUA 3WEIA 5ERNA 3LZ9A 1ZW5A 3TFNA 3APZA 4EA1A 4DHDA 1YJ4A 2Z4YA 3VJAA 2E91A 3P5RA 3KRAA 3TFVA 2Z52A 2OGDA 3KRCA 3WCAA 3AQCB 4DI5A 1N20A 3CP6A 3SDUA 4LPGF 4LPHF 2Q9ZA 4OKMA 3N5JF 5EASA 2ZEUA 3OYRA 3ZOUA 3AQBB 3VJCA 4DWGA 5CG6A 4UMJA 3ADZA 5IMNA 4KVIA 4LZ3A 2E90A 4WK5A 4F6XA 3ZCDA 4KKMA 1EZFA 3WCCA 2AETA 5B0MA 3N3DA 5JV0F 4P0XA 3LMDA 1WL3A 3WSBA 2ZCOA 3OABA 1DI1A 1PS1A 3ASXA 3NPKA 4KVDA 2AELA 2PS8A 4NKFA 5ILJA 1WL2A 2J1PA 2F92F 3ICNA 3P41A 3UCAA 4DZWA 2AZJA 5B01A 5A0IA 2F7MF 2AEKA 3S4JA 2FORA 4KVWA 3ID0A 2J5CA 1UBWA 2E94A 3SAEA 3NPRA 4DWBA 5KSXF 3EFQA 1UBYA 1YHLA 4LLTA 5B0IA 3DYFA 5ILZA 4KUXA 2E95A 3QQVA 3G4FA 3WCEA 2EWGA 5HN7A 3N5HF 4E9UA 3S9VA 2VF6A 5AHUB 5ILYA 2ONHA 4MC8A 5B02A 3KB9A 4DEMF 3LDWA 2ZY1A 3WCJA 3WEFA 3WCDA 3RYEA 3SDQA 2QISA 5B0KA 4RXDA 2FTZA 2Z4ZA 1RTRA 2DH4A 1N1BA 5E8KA 1YYUA 5B03A 4RYPA 5H9DA 3TS7A 2OPNA 1VG4A 4F62A 3ICKA 5HN8A 1VG6A 3N46F 3MZVA 4RNQA 4KFAA 4NG6A 5IL8A 3BNYA 5JV2F 2E8TA 2AZLA 1JFAA 2E4OA 3KROB 3CKEA 4XQSF 5ER8A 2RAHA 4FJQA 3Q1OA 3V1VA 4N9UA 3NRIA 4OKZA 3ZL6A 1UBVA 3LK5A 3WCGA 1VG7A 1KIZA 4RXCA 5DJVF 3ZMCA 3ICMA 4QXSF 4LA6A 1YYTA 3ZMBA 3EGTA 3NF2A 5B00A 2F8CF 3VJBA 3QKCA 3WCFA 4H5EF 4FP4A 3WEKA 3LG5A 3SDRA 1VG3A 4JXNA 3ACWA 4LA5A 4LLSA 4LTVA 3N0FA 4OMHA 3RBMA 5ILDA 3G4DA 4F6VA 1VG2A 5IMIA 1WL1A 4JVJF 5DJRF 3WC9A 5ILIA 5I1UA 2ZCQA 5IVGA 3LSNA 4OMGA 5ILHA 3ACYA 2OPMA 4RXAA 1N23A 4LZ0A 4KQUA 3KROA 4MC3A 2OA6A 5JA0F 2ONGA 1JFGA 3VJEA 2Q9YA 3N6KF 3N0GA 2ZCSA 2Z4XA 3P8RA 4LTZA 4KWDA 4EA0A 2PS7A 3LEEA 1WL0A 3WJOA 3LJIA 3KBKA 3KRCB 4KQSA 4PVXF 4JXYA 2F9KF 3W7FA 1YYSA 5HN9A 5C05A 3PKOA 4DXJA 2E8VA 2I19A 5DIQF 1DGPA 1N24A 4E1EA 1FPSA 3LVSA 3WJKA 4LIXA
chains in the Genus database with same CATH topology
4KQ5A 3DYGA 5DHIA 1V4KA 5AYPA 2Q58A 5EAUA 3PDEA 3RYWA 2F89F 3M01A 4OGUA 1YYQA 5DW7A 3N45F 4KPDA 4L2XF 2E8XA 3KRFB 4E9ZA 1WKZA 3RMGA 2P1CA 4NUAA 3WEHA 3WCMA 3N49F 3P5PA 2J1OA 3CC9A 2H8OA 2Z7HA 3WSAA 2Q80A 4EA2A 2Z7IA 1N1ZA 3VJDA 5CG5A 4NKEA 3M0GA 1UBXA 4GP1A 3WEJA 3N1VF 4JYXA 5AELA 5IK9A 3N3LF 4P0WA 1N22A 3VJ8A 2PS4A 3M02A 4H5DF 1HX9A 5IKHA 3PH7A 2Z78A 3IPIA 2F8ZF 2E8WA 5JV1F 1WMWA 4LZCA 1V4EA 4NFJF 3PYAA 4LFEA 5IMPA 3AE0A 3ACXA 3B7LA 3V66A 4RXEA 5IM1A 3KRPB 4KVYA 5E8LA 5ERMA 3AQ0A 4KPJA 1V4HA 2E8UA 3BNXA 4GA3A 2ZCRA 2Z50A 3VJ9A 1HXGA 3ICZA 3OACB 3WEGA 3M9UA 4XQTF 3WCBA 3TFPA 3WCIA 3Q2ZA 5IKAA 4KK2A 5A0JA 3KRFA 3PYBA 1YQ7A 5E8HA 4HD1A 5DHKA 2AZKA 2F94F 5IN8A 3MAVA 4JZXA 3IBAA 2PS5A 5DGMF 4LOBA 2E92A 3LOMA 1KIYA 2Z4WA 3KRAB 1YHMA 5B0JA 4JZBA 2PS6A 1HM7A 1WY0A 4PVYF 1YYRA 5AFXA 5IL3A 3N1WF 3LLWA 1RQJA 5JUZF 3WCLA 2ZEVA 1HXAA 2E93A 4XQRF 1V4JA 1HXCA 4LFGA 4K10A 3SDVA 3WJNA 3Q30A 3V1XA 4LXWA 3SDTA 5A0KA 4GP2A 2O1OA 1N21A 5DGSF 4GAXA 4Q23A 3DYHA 1HM4A 3EZ3A 5DJPF 5IK0A 3KRPA 3OABB 4N1ZF 5DGNF 4QPFA 3M00A 1YHKA 4ZQ8A 5ILKA 4NFKF 3Q2QA 1V4IA 3P8LA 3LGZB 5DZ2A 5HNAA 1YV5A 3WCHA 3OACA 5EATA 2Z4VA 5B0LA 4NFIF 5EROA 3TC1A 4MC0A 1RQIA 4P0VA 5IK6A 3WE9A 3LGKA 4LFVF 4H5CF 4LUUA 3WEIA 5ERNA 3LZ9A 1ZW5A 3TFNA 3APZA 4EA1A 4DHDA 1YJ4A 2Z4YA 3VJAA 2E91A 3P5RA 3KRAA 3TFVA 2Z52A 2OGDA 3KRCA 3WCAA 3AQCB 4DI5A 1N20A 3CP6A 3SDUA 4LPGF 4LPHF 2Q9ZA 4OKMA 3N5JF 5EASA 2ZEUA 3OYRA 3ZOUA 3AQBB 3VJCA 4DWGA 5CG6A 4UMJA 3ADZA 5IMNA 4KVIA 4LZ3A 2E90A 4WK5A 4F6XA 3ZCDA 4KKMA 1EZFA 3WCCA 2AETA 5B0MA 3N3DA 5JV0F 4P0XA 3LMDA 1WL3A 3WSBA 2ZCOA 3OABA 1DI1A 1PS1A 3ASXA 3NPKA 4KVDA 2AELA 2PS8A 4NKFA 5ILJA 1WL2A 2J1PA 2F92F 3ICNA 3P41A 3UCAA 4DZWA 2AZJA 5B01A 5A0IA 2F7MF 2AEKA 3S4JA 2FORA 4KVWA 3ID0A 2J5CA 1UBWA 2E94A 3SAEA 3NPRA 4DWBA 5KSXF 3EFQA 1UBYA 1YHLA 4LLTA 5B0IA 3DYFA 5ILZA 4KUXA 2E95A 3QQVA 3G4FA 3WCEA 2EWGA 5HN7A 3N5HF 4E9UA 3S9VA 2VF6A 5AHUB 5ILYA 2ONHA 4MC8A 5B02A 3KB9A 4DEMF 3LDWA 2ZY1A 3WCJA 3WEFA 3WCDA 3RYEA 3SDQA 2QISA 5B0KA 4RXDA 2FTZA 2Z4ZA 1RTRA 2DH4A 1N1BA 5E8KA 1YYUA 5B03A 4RYPA 5H9DA 3TS7A 2OPNA 1VG4A 4F62A 3ICKA 5HN8A 1VG6A 3N46F 3MZVA 4RNQA 4KFAA 4NG6A 5IL8A 3BNYA 5JV2F 2E8TA 2AZLA 1JFAA 2E4OA 3KROB 3CKEA 4XQSF 5ER8A 2RAHA 4FJQA 3Q1OA 3V1VA 4N9UA 3NRIA 4OKZA 3ZL6A 1UBVA 3LK5A 3WCGA 1VG7A 1KIZA 4RXCA 5DJVF 3ZMCA 3ICMA 4QXSF 4LA6A 1YYTA 3ZMBA 3EGTA 3NF2A 5B00A 2F8CF 3VJBA 3QKCA 3WCFA 4H5EF 4FP4A 3WEKA 3LG5A 3SDRA 1VG3A 4JXNA 3ACWA 4LA5A 4LLSA 4LTVA 3N0FA 4OMHA 3RBMA 5ILDA 3G4DA 4F6VA 1VG2A 5IMIA 1WL1A 4JVJF 5DJRF 3WC9A 5ILIA 5I1UA 2ZCQA 5IVGA 3LSNA 4OMGA 5ILHA 3ACYA 2OPMA 4RXAA 1N23A 4LZ0A 4KQUA 3KROA 4MC3A 2OA6A 5JA0F 2ONGA 1JFGA 3VJEA 2Q9YA 3N6KF 3N0GA 2ZCSA 2Z4XA 3P8RA 4LTZA 4KWDA 4EA0A 2PS7A 3LEEA 1WL0A 3WJOA 3LJIA 3KBKA 3KRCB 4KQSA 4PVXF 4JXYA 2F9KF 3W7FA 1YYSA 5HN9A 5C05A 3PKOA 4DXJA 2E8VA 2I19A 5DIQF 1DGPA 1N24A 4E1EA 1FPSA 3LVSA 3WJKA 4LIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQ5 A;  3DYG A;  5DHI A;  1V4K A;  5AYP A;  2Q58 A;  5EAU A;  3PDE A;  3RYW A;  2F89 F;  3M01 A;  4OGU A;  1YYQ A;  5DW7 A;  3N45 F;  4KPD A;  4L2X F;  2E8X A;  3KRF B;  4E9Z A;  1WKZ A;  3RMG A;  2P1C A;  4NUA A;  3WEH A;  3WCM A;  3N49 F;  3P5P A;  2J1O A;  3CC9 A;  2H8O A;  2Z7H A;  3WSA A;  2Q80 A;  4EA2 A;  2Z7I A;  1N1Z A;  3VJD A;  5CG5 A;  4NKE A;  3M0G A;  1UBX A;  4GP1 A;  3WEJ A;  3N1V F;  4JYX A;  5AEL A;  5IK9 A;  3N3L F;  4P0W A;  1N22 A;  3VJ8 A;  2PS4 A;  3M02 A;  4H5D F;  1HX9 A;  5IKH A;  3PH7 A;  2Z78 A;  3IPI A;  2F8Z F;  2E8W A;  5JV1 F;  1WMW A;  4LZC A;  1V4E A;  4NFJ F;  3PYA A;  4LFE A;  5IMP A;  3AE0 A;  3ACX A;  3B7L A;  3V66 A;  4RXE A;  5IM1 A;  3KRP B;  4KVY A;  5E8L A;  5ERM A;  3AQ0 A;  4KPJ A;  1V4H A;  2E8U A;  3BNX A;  4GA3 A;  2ZCR A;  2Z50 A;  3VJ9 A;  1HXG A;  3ICZ A;  3OAC B;  3WEG A;  3M9U A;  4XQT F;  3WCB A;  3TFP A;  3WCI A;  3Q2Z A;  5IKA A;  4KK2 A;  5A0J A;  3KRF A;  3PYB A;  1YQ7 A;  5E8H A;  4HD1 A;  5DHK A;  2AZK A;  2F94 F;  5IN8 A;  3MAV A;  4JZX A;  3IBA A;  2PS5 A;  5DGM F;  4LOB A;  2E92 A;  3LOM A;  1KIY A;  2Z4W A;  3KRA B;  1YHM A;  5B0J A;  4JZB A;  2PS6 A;  1HM7 A;  1WY0 A;  4PVY F;  1YYR A;  5AFX A;  5IL3 A;  3N1W F;  3LLW A;  1RQJ A;  5JUZ F;  3WCL A;  2ZEV A;  1HXA A;  2E93 A;  4XQR F;  1V4J A;  1HXC A;  4LFG A;  4K10 A;  3SDV A;  3WJN A;  3Q30 A;  3V1X A;  4LXW A;  3SDT A;  5A0K A;  4GP2 A;  2O1O A;  1N21 A;  5DGS F;  4GAX A;  4Q23 A;  3DYH A;  1HM4 A;  3EZ3 A;  5DJP F;  5IK0 A;  3KRP A;  3OAB B;  4N1Z F;  5DGN F;  4QPF A;  3M00 A;  1YHK A;  4ZQ8 A;  5ILK A;  4NFK F;  3Q2Q A;  1V4I A;  3P8L A;  3LGZ B;  5DZ2 A;  5HNA A;  1YV5 A;  3WCH A;  3OAC A;  5EAT A;  2Z4V A;  5B0L A;  4NFI F;  5ERO A;  3TC1 A;  4MC0 A;  1RQI A;  4P0V A;  5IK6 A;  3WE9 A;  3LGK A;  4LFV F;  4H5C F;  4LUU A;  3WEI A;  5ERN A;  3LZ9 A;  1ZW5 A;  3TFN A;  3APZ A;  4EA1 A;  4DHD A;  1YJ4 A;  2Z4Y A;  3VJA A;  2E91 A;  3P5R A;  3KRA A;  3TFV A;  2Z52 A;  2OGD A;  3KRC A;  3WCA A;  3AQC B;  4DI5 A;  1N20 A;  3CP6 A;  3SDU A;  4LPG F;  4LPH F;  2Q9Z A;  4OKM A;  3N5J F;  5EAS A;  2ZEU A;  3OYR A;  3ZOU A;  3AQB B;  3VJC A;  4DWG A;  5CG6 A;  4UMJ A;  3ADZ A;  5IMN A;  4KVI A;  4LZ3 A;  2E90 A;  4WK5 A;  4F6X A;  3ZCD A;  4KKM A;  1EZF A;  3WCC A;  2AET A;  5B0M A;  3N3D A;  5JV0 F;  4P0X A;  3LMD A;  1WL3 A;  3WSB A;  2ZCO A;  3OAB A;  1DI1 A;  1PS1 A;  3ASX A;  3NPK A;  4KVD A;  2AEL A;  2PS8 A;  4NKF A;  5ILJ A;  1WL2 A;  2J1P A;  2F92 F;  3ICN A;  3P41 A;  3UCA A;  4DZW A;  2AZJ A;  5B01 A;  5A0I A;  2F7M F;  2AEK A;  3S4J A;  2FOR A;  4KVW A;  3ID0 A;  2J5C A;  1UBW A;  2E94 A;  3SAE A;  3NPR A;  4DWB A;  5KSX F;  3EFQ A;  1UBY A;  1YHL A;  4LLT A;  5B0I A;  3DYF A;  5ILZ A;  4KUX A;  2E95 A;  3QQV A;  3G4F A;  3WCE A;  2EWG A;  5HN7 A;  3N5H F;  4E9U A;  3S9V A;  2VF6 A;  5AHU B;  5ILY A;  2ONH A;  4MC8 A;  5B02 A;  3KB9 A;  4DEM F;  3LDW A;  2ZY1 A;  3WCJ A;  3WEF A;  3WCD A;  3RYE A;  3SDQ A;  2QIS A;  5B0K A;  4RXD A;  2FTZ A;  2Z4Z A;  1RTR A;  2DH4 A;  1N1B A;  5E8K A;  1YYU A;  5B03 A;  4RYP A;  5H9D A;  3TS7 A;  2OPN A;  1VG4 A;  4F62 A;  3ICK A;  5HN8 A;  1VG6 A;  3N46 F;  3MZV A;  4RNQ A;  4KFA A;  4NG6 A;  5IL8 A;  3BNY A;  5JV2 F;  2E8T A;  2AZL A;  1JFA A;  2E4O A;  3KRO B;  3CKE A;  4XQS F;  5ER8 A;  2RAH A;  4FJQ A;  3Q1O A;  3V1V A;  4N9U A;  3NRI A;  4OKZ A;  3ZL6 A;  1UBV A;  3LK5 A;  3WCG A;  1VG7 A;  1KIZ A;  4RXC A;  5DJV F;  3ZMC A;  3ICM A;  4QXS F;  4LA6 A;  1YYT A;  3ZMB A;  3EGT A;  3NF2 A;  5B00 A;  2F8C F;  3VJB A;  3QKC A;  3WCF A;  4H5E F;  4FP4 A;  3WEK A;  3LG5 A;  3SDR A;  1VG3 A;  4JXN A;  3ACW A;  4LA5 A;  4LLS A;  4LTV A;  3N0F A;  4OMH A;  3RBM A;  5ILD A;  3G4D A;  4F6V A;  1VG2 A;  5IMI A;  1WL1 A;  4JVJ F;  5DJR F;  3WC9 A;  5ILI A;  5I1U A;  2ZCQ A;  5IVG A;  3LSN A;  4OMG A;  5ILH A;  3ACY A;  2OPM A;  4RXA A;  1N23 A;  4LZ0 A;  4KQU A;  3KRO A;  4MC3 A;  2OA6 A;  5JA0 F;  2ONG A;  1JFG A;  3VJE A;  2Q9Y A;  3N6K F;  3N0G A;  2ZCS A;  2Z4X A;  3P8R A;  4LTZ A;  4KWD A;  4EA0 A;  2PS7 A;  3LEE A;  1WL0 A;  3WJO A;  3LJI A;  3KBK A;  3KRC B;  4KQS A;  4PVX F;  4JXY A;  2F9K F;  3W7F A;  1YYS A;  5HN9 A;  5C05 A;  3PKO A;  4DXJ A;  2E8V A;  2I19 A;  5DIQ F;  1DGP A;  1N24 A;  4E1E A;  1FPS A;  3LVS A;  3WJK A;  4LIX A; 
#chains in the Genus database with same CATH topology
 4KQ5 A;  3DYG A;  5DHI A;  1V4K A;  5AYP A;  2Q58 A;  5EAU A;  3PDE A;  3RYW A;  2F89 F;  3M01 A;  4OGU A;  1YYQ A;  5DW7 A;  3N45 F;  4KPD A;  4L2X F;  2E8X A;  3KRF B;  4E9Z A;  1WKZ A;  3RMG A;  2P1C A;  4NUA A;  3WEH A;  3WCM A;  3N49 F;  3P5P A;  2J1O A;  3CC9 A;  2H8O A;  2Z7H A;  3WSA A;  2Q80 A;  4EA2 A;  2Z7I A;  1N1Z A;  3VJD A;  5CG5 A;  4NKE A;  3M0G A;  1UBX A;  4GP1 A;  3WEJ A;  3N1V F;  4JYX A;  5AEL A;  5IK9 A;  3N3L F;  4P0W A;  1N22 A;  3VJ8 A;  2PS4 A;  3M02 A;  4H5D F;  1HX9 A;  5IKH A;  3PH7 A;  2Z78 A;  3IPI A;  2F8Z F;  2E8W A;  5JV1 F;  1WMW A;  4LZC A;  1V4E A;  4NFJ F;  3PYA A;  4LFE A;  5IMP A;  3AE0 A;  3ACX A;  3B7L A;  3V66 A;  4RXE A;  5IM1 A;  3KRP B;  4KVY A;  5E8L A;  5ERM A;  3AQ0 A;  4KPJ A;  1V4H A;  2E8U A;  3BNX A;  4GA3 A;  2ZCR A;  2Z50 A;  3VJ9 A;  1HXG A;  3ICZ A;  3OAC B;  3WEG A;  3M9U A;  4XQT F;  3WCB A;  3TFP A;  3WCI A;  3Q2Z A;  5IKA A;  4KK2 A;  5A0J A;  3KRF A;  3PYB A;  1YQ7 A;  5E8H A;  4HD1 A;  5DHK A;  2AZK A;  2F94 F;  5IN8 A;  3MAV A;  4JZX A;  3IBA A;  2PS5 A;  5DGM F;  4LOB A;  2E92 A;  3LOM A;  1KIY A;  2Z4W A;  3KRA B;  1YHM A;  5B0J A;  4JZB A;  2PS6 A;  1HM7 A;  1WY0 A;  4PVY F;  1YYR A;  5AFX A;  5IL3 A;  3N1W F;  3LLW A;  1RQJ A;  5JUZ F;  3WCL A;  2ZEV A;  1HXA A;  2E93 A;  4XQR F;  1V4J A;  1HXC A;  4LFG A;  4K10 A;  3SDV A;  3WJN A;  3Q30 A;  3V1X A;  4LXW A;  3SDT A;  5A0K A;  4GP2 A;  2O1O A;  1N21 A;  5DGS F;  4GAX A;  4Q23 A;  3DYH A;  1HM4 A;  3EZ3 A;  5DJP F;  5IK0 A;  3KRP A;  3OAB B;  4N1Z F;  5DGN F;  4QPF A;  3M00 A;  1YHK A;  4ZQ8 A;  5ILK A;  4NFK F;  3Q2Q A;  1V4I A;  3P8L A;  3LGZ B;  5DZ2 A;  5HNA A;  1YV5 A;  3WCH A;  3OAC A;  5EAT A;  2Z4V A;  5B0L A;  4NFI F;  5ERO A;  3TC1 A;  4MC0 A;  1RQI A;  4P0V A;  5IK6 A;  3WE9 A;  3LGK A;  4LFV F;  4H5C F;  4LUU A;  3WEI A;  5ERN A;  3LZ9 A;  1ZW5 A;  3TFN A;  3APZ A;  4EA1 A;  4DHD A;  1YJ4 A;  2Z4Y A;  3VJA A;  2E91 A;  3P5R A;  3KRA A;  3TFV A;  2Z52 A;  2OGD A;  3KRC A;  3WCA A;  3AQC B;  4DI5 A;  1N20 A;  3CP6 A;  3SDU A;  4LPG F;  4LPH F;  2Q9Z A;  4OKM A;  3N5J F;  5EAS A;  2ZEU A;  3OYR A;  3ZOU A;  3AQB B;  3VJC A;  4DWG A;  5CG6 A;  4UMJ A;  3ADZ A;  5IMN A;  4KVI A;  4LZ3 A;  2E90 A;  4WK5 A;  4F6X A;  3ZCD A;  4KKM A;  1EZF A;  3WCC A;  2AET A;  5B0M A;  3N3D A;  5JV0 F;  4P0X A;  3LMD A;  1WL3 A;  3WSB A;  2ZCO A;  3OAB A;  1DI1 A;  1PS1 A;  3ASX A;  3NPK A;  4KVD A;  2AEL A;  2PS8 A;  4NKF A;  5ILJ A;  1WL2 A;  2J1P A;  2F92 F;  3ICN A;  3P41 A;  3UCA A;  4DZW A;  2AZJ A;  5B01 A;  5A0I A;  2F7M F;  2AEK A;  3S4J A;  2FOR A;  4KVW A;  3ID0 A;  2J5C A;  1UBW A;  2E94 A;  3SAE A;  3NPR A;  4DWB A;  5KSX F;  3EFQ A;  1UBY A;  1YHL A;  4LLT A;  5B0I A;  3DYF A;  5ILZ A;  4KUX A;  2E95 A;  3QQV A;  3G4F A;  3WCE A;  2EWG A;  5HN7 A;  3N5H F;  4E9U A;  3S9V A;  2VF6 A;  5AHU B;  5ILY A;  2ONH A;  4MC8 A;  5B02 A;  3KB9 A;  4DEM F;  3LDW A;  2ZY1 A;  3WCJ A;  3WEF A;  3WCD A;  3RYE A;  3SDQ A;  2QIS A;  5B0K A;  4RXD A;  2FTZ A;  2Z4Z A;  1RTR A;  2DH4 A;  1N1B A;  5E8K A;  1YYU A;  5B03 A;  4RYP A;  5H9D A;  3TS7 A;  2OPN A;  1VG4 A;  4F62 A;  3ICK A;  5HN8 A;  1VG6 A;  3N46 F;  3MZV A;  4RNQ A;  4KFA A;  4NG6 A;  5IL8 A;  3BNY A;  5JV2 F;  2E8T A;  2AZL A;  1JFA A;  2E4O A;  3KRO B;  3CKE A;  4XQS F;  5ER8 A;  2RAH A;  4FJQ A;  3Q1O A;  3V1V A;  4N9U A;  3NRI A;  4OKZ A;  3ZL6 A;  1UBV A;  3LK5 A;  3WCG A;  1VG7 A;  1KIZ A;  4RXC A;  5DJV F;  3ZMC A;  3ICM A;  4QXS F;  4LA6 A;  1YYT A;  3ZMB A;  3EGT A;  3NF2 A;  5B00 A;  2F8C F;  3VJB A;  3QKC A;  3WCF A;  4H5E F;  4FP4 A;  3WEK A;  3LG5 A;  3SDR A;  1VG3 A;  4JXN A;  3ACW A;  4LA5 A;  4LLS A;  4LTV A;  3N0F A;  4OMH A;  3RBM A;  5ILD A;  3G4D A;  4F6V A;  1VG2 A;  5IMI A;  1WL1 A;  4JVJ F;  5DJR F;  3WC9 A;  5ILI A;  5I1U A;  2ZCQ A;  5IVG A;  3LSN A;  4OMG A;  5ILH A;  3ACY A;  2OPM A;  4RXA A;  1N23 A;  4LZ0 A;  4KQU A;  3KRO A;  4MC3 A;  2OA6 A;  5JA0 F;  2ONG A;  1JFG A;  3VJE A;  2Q9Y A;  3N6K F;  3N0G A;  2ZCS A;  2Z4X A;  3P8R A;  4LTZ A;  4KWD A;  4EA0 A;  2PS7 A;  3LEE A;  1WL0 A;  3WJO A;  3LJI A;  3KBK A;  3KRC B;  4KQS A;  4PVX F;  4JXY A;  2F9K F;  3W7F A;  1YYS A;  5HN9 A;  5C05 A;  3PKO A;  4DXJ A;  2E8V A;  2I19 A;  5DIQ F;  1DGP A;  1N24 A;  4E1E A;  1FPS A;  3LVS A;  3WJK A;  4LIX A; 
#chains in the Genus database with same CATH homology
 4KQ5 A;  3DYG A;  5DHI A;  1V4K A;  5AYP A;  2Q58 A;  5EAU A;  3PDE A;  3RYW A;  2F89 F;  3M01 A;  4OGU A;  1YYQ A;  5DW7 A;  3N45 F;  4KPD A;  4L2X F;  2E8X A;  3KRF B;  4E9Z A;  1WKZ A;  3RMG A;  2P1C A;  4NUA A;  3WEH A;  3WCM A;  3N49 F;  3P5P A;  2J1O A;  3CC9 A;  2H8O A;  2Z7H A;  3WSA A;  2Q80 A;  4EA2 A;  2Z7I A;  1N1Z A;  3VJD A;  5CG5 A;  4NKE A;  3M0G A;  1UBX A;  4GP1 A;  3WEJ A;  3N1V F;  4JYX A;  5AEL A;  5IK9 A;  3N3L F;  4P0W A;  1N22 A;  3VJ8 A;  2PS4 A;  3M02 A;  4H5D F;  1HX9 A;  5IKH A;  3PH7 A;  2Z78 A;  3IPI A;  2F8Z F;  2E8W A;  5JV1 F;  1WMW A;  4LZC A;  1V4E A;  4NFJ F;  3PYA A;  4LFE A;  5IMP A;  3AE0 A;  3ACX A;  3B7L A;  3V66 A;  4RXE A;  5IM1 A;  3KRP B;  4KVY A;  5E8L A;  5ERM A;  3AQ0 A;  4KPJ A;  1V4H A;  2E8U A;  3BNX A;  4GA3 A;  2ZCR A;  2Z50 A;  3VJ9 A;  1HXG A;  3ICZ A;  3OAC B;  3WEG A;  3M9U A;  4XQT F;  3WCB A;  3TFP A;  3WCI A;  3Q2Z A;  5IKA A;  4KK2 A;  5A0J A;  3KRF A;  3PYB A;  1YQ7 A;  5E8H A;  4HD1 A;  5DHK A;  2AZK A;  2F94 F;  5IN8 A;  3MAV A;  4JZX A;  3IBA A;  2PS5 A;  5DGM F;  4LOB A;  2E92 A;  3LOM A;  1KIY A;  2Z4W A;  3KRA B;  1YHM A;  5B0J A;  4JZB A;  2PS6 A;  1HM7 A;  1WY0 A;  4PVY F;  1YYR A;  5AFX A;  5IL3 A;  3N1W F;  3LLW A;  1RQJ A;  5JUZ F;  3WCL A;  2ZEV A;  1HXA A;  2E93 A;  4XQR F;  1V4J A;  1HXC A;  4LFG A;  4K10 A;  3SDV A;  3WJN A;  3Q30 A;  3V1X A;  4LXW A;  3SDT A;  5A0K A;  4GP2 A;  2O1O A;  1N21 A;  5DGS F;  4GAX A;  4Q23 A;  3DYH A;  1HM4 A;  3EZ3 A;  5DJP F;  5IK0 A;  3KRP A;  3OAB B;  4N1Z F;  5DGN F;  4QPF A;  3M00 A;  1YHK A;  4ZQ8 A;  5ILK A;  4NFK F;  3Q2Q A;  1V4I A;  3P8L A;  3LGZ B;  5DZ2 A;  5HNA A;  1YV5 A;  3WCH A;  3OAC A;  5EAT A;  2Z4V A;  5B0L A;  4NFI F;  5ERO A;  3TC1 A;  4MC0 A;  1RQI A;  4P0V A;  5IK6 A;  3WE9 A;  3LGK A;  4LFV F;  4H5C F;  4LUU A;  3WEI A;  5ERN A;  3LZ9 A;  1ZW5 A;  3TFN A;  3APZ A;  4EA1 A;  4DHD A;  1YJ4 A;  2Z4Y A;  3VJA A;  2E91 A;  3P5R A;  3KRA A;  3TFV A;  2Z52 A;  2OGD A;  3KRC A;  3WCA A;  3AQC B;  4DI5 A;  1N20 A;  3CP6 A;  3SDU A;  4LPG F;  4LPH F;  2Q9Z A;  4OKM A;  3N5J F;  5EAS A;  2ZEU A;  3OYR A;  3ZOU A;  3AQB B;  3VJC A;  4DWG A;  5CG6 A;  4UMJ A;  3ADZ A;  5IMN A;  4KVI A;  4LZ3 A;  2E90 A;  4WK5 A;  4F6X A;  3ZCD A;  4KKM A;  1EZF A;  3WCC A;  2AET A;  5B0M A;  3N3D A;  5JV0 F;  4P0X A;  3LMD A;  1WL3 A;  3WSB A;  2ZCO A;  3OAB A;  1DI1 A;  1PS1 A;  3ASX A;  3NPK A;  4KVD A;  2AEL A;  2PS8 A;  4NKF A;  5ILJ A;  1WL2 A;  2J1P A;  2F92 F;  3ICN A;  3P41 A;  3UCA A;  4DZW A;  2AZJ A;  5B01 A;  5A0I A;  2F7M F;  2AEK A;  3S4J A;  2FOR A;  4KVW A;  3ID0 A;  2J5C A;  1UBW A;  2E94 A;  3SAE A;  3NPR A;  4DWB A;  5KSX F;  3EFQ A;  1UBY A;  1YHL A;  4LLT A;  5B0I A;  3DYF A;  5ILZ A;  4KUX A;  2E95 A;  3QQV A;  3G4F A;  3WCE A;  2EWG A;  5HN7 A;  3N5H F;  4E9U A;  3S9V A;  2VF6 A;  5AHU B;  5ILY A;  2ONH A;  4MC8 A;  5B02 A;  3KB9 A;  4DEM F;  3LDW A;  2ZY1 A;  3WCJ A;  3WEF A;  3WCD A;  3RYE A;  3SDQ A;  2QIS A;  5B0K A;  4RXD A;  2FTZ A;  2Z4Z A;  1RTR A;  2DH4 A;  1N1B A;  5E8K A;  1YYU A;  5B03 A;  4RYP A;  5H9D A;  3TS7 A;  2OPN A;  1VG4 A;  4F62 A;  3ICK A;  5HN8 A;  1VG6 A;  3N46 F;  3MZV A;  4RNQ A;  4KFA A;  4NG6 A;  5IL8 A;  3BNY A;  5JV2 F;  2E8T A;  2AZL A;  1JFA A;  2E4O A;  3KRO B;  3CKE A;  4XQS F;  5ER8 A;  2RAH A;  4FJQ A;  3Q1O A;  3V1V A;  4N9U A;  3NRI A;  4OKZ A;  3ZL6 A;  1UBV A;  3LK5 A;  3WCG A;  1VG7 A;  1KIZ A;  4RXC A;  5DJV F;  3ZMC A;  3ICM A;  4QXS F;  4LA6 A;  1YYT A;  3ZMB A;  3EGT A;  3NF2 A;  5B00 A;  2F8C F;  3VJB A;  3QKC A;  3WCF A;  4H5E F;  4FP4 A;  3WEK A;  3LG5 A;  3SDR A;  1VG3 A;  4JXN A;  3ACW A;  4LA5 A;  4LLS A;  4LTV A;  3N0F A;  4OMH A;  3RBM A;  5ILD A;  3G4D A;  4F6V A;  1VG2 A;  5IMI A;  1WL1 A;  4JVJ F;  5DJR F;  3WC9 A;  5ILI A;  5I1U A;  2ZCQ A;  5IVG A;  3LSN A;  4OMG A;  5ILH A;  3ACY A;  2OPM A;  4RXA A;  1N23 A;  4LZ0 A;  4KQU A;  3KRO A;  4MC3 A;  2OA6 A;  5JA0 F;  2ONG A;  1JFG A;  3VJE A;  2Q9Y A;  3N6K F;  3N0G A;  2ZCS A;  2Z4X A;  3P8R A;  4LTZ A;  4KWD A;  4EA0 A;  2PS7 A;  3LEE A;  1WL0 A;  3WJO A;  3LJI A;  3KBK A;  3KRC B;  4KQS A;  4PVX F;  4JXY A;  2F9K F;  3W7F A;  1YYS A;  5HN9 A;  5C05 A;  3PKO A;  4DXJ A;  2E8V A;  2I19 A;  5DIQ F;  1DGP A;  1N24 A;  4E1E A;  1FPS A;  3LVS A;  3WJK A;  4LIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...