4OMHA

Crystal structure of the bacterial diterpene cyclase cotb2 variant f149l
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
280
structure length
280
Chain Sequence
IGRSSVRPYLEECTRRFQEMFDRHVVTRPTKVELTDAELREVIDDCNAAVAPLGKTVSDERWISYVGVVLWSQSPRHIKDMEAFKAVCVLNCVTFVWDDMDPALHDFGLFLPQLRKICEKYYGPEDAEVAYEAARALVTSDHMFRDSPIKAALCTTSPEQYFRFRVTDIGVDFWMKMSYPIYRHPEFTEHAKTSLAARMTTRGLTIVNDFYSYDREVSLGQITNCFRLCDVSDETAFKEFFQARLDDMIEDIECIKAFDQLTQDVFLDLIYGNFVWTTSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Geranylgeranyl diphosphate cyclase
publication title The first structure of a bacterial diterpene cyclase: CotB2.
pubmed doi rcsb
source organism Streptomyces melanosporofaciens
total genus 125
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature ec 4.2.3.146: Cyclooctat-9-en-7-ol synthase.
pdb deposition date 2014-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4omhA00
3N5HF 5ILDA 1WL2A 1V4JA 1UBWA 2AEKA 5EASA 5ILYA 5IM1A 4KVWA 5EAUA 5A0JA 5ER8A 3DYFA 2ZEUA 1HM7A 2ZCRA 5E8KA 4GA3A 3WEFA 1V4IA 5HNAA 4H5CF 5ILKA 2Z4WA 2ZCOA 5C05A 3SDRA 3TC1A 5DGSF 3NPKA 3ACWA 4H5EF 4LLTA 5EROA 5B00A 5HN8A 3G4FA 3ICKA 3M0GA 2E92A 2ONHA 2E91A 2F8ZF 4JYXA 3Q2QA 3N6KF 4FP4A 4KFAA 4NFIF 4QXSF 2PS6A 1ZW5A 4DHDA 4LFGA 3N3DA 3SDUA 4JZXA 3PDEA 4XQSF 3WCCA 4LFVF 2FTZA 3S9VA 4E1EA 3ZOUA 2E8XA 5JUZF 3BNXA 3KRFA 3WEGA 4KPDA 1HXCA 3DYGA 2AETA 3ZCDA 4DI5A 3SAEA 3KBKA 5IN8A 3WCEA 2E4OA 2ZCQA 1YV5A 3SDTA 1JFAA 1VG3A 5ERMA 3WEKA 4KVIA 4LOBA 4LA5A 4MC8A 2Z4XA 3WCGA 3M00A 3VJCA 3KRAB 2AELA 4PVXF 4EA2A 2Z78A 1N24A 1KIZA 3N0GA 5HN7A 3N1WF 4KVYA 3WCDA 1RQIA 3CP6A 5B03A 5CG5A 5IMPA 3OACB 5DJPF 4KWDA 3ADZA 4RXCA 5JV0F 4K10A 4OKMA 3WE9A 4JZBA 1YHMA 2AZLA 3LSNA 4GAXA 5ILJA 3TFPA 4NFJF 3ASXA 3DYHA 1V4HA 2E8TA 4RXDA 3KRPA 1PS1A 5DW7A 5B0LA 2F89F 4KQSA 3QKCA 5ILHA 5B0MA 3LGKA 2PS8A 1N22A 1UBVA 3AQBB 2E90A 3IBAA 2ZY1A 3WCJA 1N1ZA 3LVSA 3MZVA 1DGPA 3VJEA 3ACXA 5IKHA 4DWGA 4LA6A 2I19A 2OA6A 5E8LA 3WCFA 2E8VA 3V66A 3B7LA 4KQ5A 3NRIA 4LZ3A 5EATA 1VG4A 2Q58A 3WSAA 3N45F 4DXJA 4LFEA 4HD1A 3TFVA 3P8LA 3KROA 3WCBA 2F7MF 2E93A 1WKZA 5H9DA 4KVDA 4NKEA 3ICNA 3LGZB 5IMIA 2P1CA 4DWBA 3WCHA 1RTRA 3RMGA 4EA1A 3OABA 2PS7A 5IK6A 1N1BA 5DGMF 3WEJA 3APZA 3LLWA 3RBMA 4KKMA 5B0IA 1N20A 3PYBA 4OMHA 3LJIA 4N9UA 3AQCB 4LTVA 3M02A 4LTZA 5B02A 4KK2A 1WL1A 1YYUA 5DJRF 2E94A 3WEHA 3ZMCA 3UCAA 3N49F 3N5JF 5IL8A 2Z7HA 2J5CA 5I1UA 3Q2ZA 4EA0A 3TFNA 4KPJA 3KRCB 1WL3A 5ILZA 3EFQA 5AYPA 2Q80A 2E95A 1EZFA 2F94F 1KIYA 4E9ZA 1YHKA 5B0KA 2F8CF 3QQVA 5JV2F 3CKEA 3NF2A 4LXWA 4LLSA 4LZCA 5DHIA 1HM4A 2Z4YA 3WC9A 5A0IA 3N0FA 2AZKA 2ZEVA 5IL3A 3PH7A 4MC0A 4RNQA 3MAVA 4FJQA 3PKOA 4JXNA 4N1ZF 3LG5A 1WY0A 1YQ7A 1YYSA 3N46F 3G4DA 3W7FA 5ILIA 5HN9A 4NFKF 2Z50A 3P41A 1V4EA 4LZ0A 2FORA 3AQ0A 1HXAA 3M01A 2J1PA 4KQUA 5B01A 3PYAA 2QISA 2H8OA 4E9UA 2RAHA 2F9KF 4GP2A 3KRAA 2OGDA 4PVYF 5DHKA 1V4KA 3LK5A 5DIQF 3OYRA 4RXAA 2O1OA 3Q30A 4RYPA 5AFXA 3LOMA 5JA0F 3OACA 4LPGF 2PS5A 4Q23A 3VJ9A 1VG2A 5B0JA 3P8RA 3RYWA 4OKZA 3KRFB 2Z4ZA 3LMDA 2Q9ZA 1VG7A 3BNYA 1N21A 3N1VF 4KUXA 4UMJA 3V1XA 1FPSA 1UBXA 2J1OA 1DI1A 3P5PA 2ZCSA 3TS7A 3LDWA 3V1VA 4NKFA 3ICMA 4LIXA 1VG6A 5KSXF 3RYEA 5CG6A 5JV1F 3VJ8A 3P5RA 5AELA 1YYRA 4P0VA 1JFGA 1HX9A 1RQJA 4F6VA 2OPNA 1YYQA 3M9UA 3WJNA 3WJOA 3EZ3A 3AE0A 3KRPB 4GP1A 5A0KA 5IMNA 5DGNF 3SDQA 3VJBA 3ICZA 1N23A 3IPIA 4XQTF 2Z52A 2PS4A 3SDVA 4JVJF 1YHLA 2Z4VA 3CC9A 4NG6A 4L2XF 4LUUA 3WCIA 3Q1OA 3EGTA 3WCAA 3ID0A 4JXYA 4OGUA 4RXEA 5DJVF 5IK0A 3VJDA 3ZL6A 1WL0A 2ONGA 4ZQ8A 3ZMBA 3ACYA 3WSBA 4XQRF 4H5DF 3LEEA 5IKAA 3WJKA 3S4JA 2OPMA 1YJ4A 3NPRA 4DZWA 4QPFA 5DZ2A 2E8WA 4F6XA 3VJAA 2EWGA 4MC3A 3LZ9A 5IK9A 2F92F 2E8UA 2DH4A 5IVGA 3N3LF 5ERNA 3KROB 5E8HA 1YYTA 4DEMF 3KB9A 3KRCA 3WCMA 2Z7IA 5AHUB 4P0WA 4NUAA 1HXGA 2AZJA 3WCLA 4WK5A 2Q9YA 4LPHF 4P0XA 2VF6A 4F62A 4OMGA 3OABB 1UBYA 3WEIA 1WMWA
chains in the Genus database with same CATH superfamily
3N5HF 5ILDA 1WL2A 1V4JA 1UBWA 2AEKA 5EASA 5ILYA 5IM1A 4KVWA 5EAUA 5A0JA 5ER8A 3DYFA 2ZEUA 1HM7A 2ZCRA 5E8KA 4GA3A 3WEFA 1V4IA 5HNAA 4H5CF 5ILKA 2Z4WA 2ZCOA 5C05A 3SDRA 3TC1A 5DGSF 3NPKA 3ACWA 4H5EF 4LLTA 5EROA 5B00A 5HN8A 3G4FA 3ICKA 3M0GA 2E92A 2ONHA 2E91A 2F8ZF 4JYXA 3Q2QA 3N6KF 4FP4A 4KFAA 4NFIF 4QXSF 2PS6A 1ZW5A 4DHDA 4LFGA 3N3DA 3SDUA 4JZXA 3PDEA 4XQSF 3WCCA 4LFVF 2FTZA 3S9VA 4E1EA 3ZOUA 2E8XA 5JUZF 3BNXA 3KRFA 3WEGA 4KPDA 1HXCA 3DYGA 2AETA 3ZCDA 4DI5A 3SAEA 3KBKA 5IN8A 3WCEA 2E4OA 2ZCQA 1YV5A 3SDTA 1JFAA 1VG3A 5ERMA 3WEKA 4KVIA 4LOBA 4LA5A 4MC8A 2Z4XA 3WCGA 3M00A 3VJCA 3KRAB 2AELA 4PVXF 4EA2A 2Z78A 1N24A 1KIZA 3N0GA 5HN7A 3N1WF 4KVYA 3WCDA 1RQIA 3CP6A 5B03A 5CG5A 5IMPA 3OACB 5DJPF 4KWDA 3ADZA 4RXCA 5JV0F 4K10A 4OKMA 3WE9A 4JZBA 1YHMA 2AZLA 3LSNA 4GAXA 5ILJA 3TFPA 4NFJF 3ASXA 3DYHA 1V4HA 2E8TA 4RXDA 3KRPA 1PS1A 5DW7A 5B0LA 2F89F 4KQSA 3QKCA 5ILHA 5B0MA 3LGKA 2PS8A 1N22A 1UBVA 3AQBB 2E90A 3IBAA 2ZY1A 3WCJA 1N1ZA 3LVSA 3MZVA 1DGPA 3VJEA 3ACXA 5IKHA 4DWGA 4LA6A 2I19A 2OA6A 5E8LA 3WCFA 2E8VA 3V66A 3B7LA 4KQ5A 3NRIA 4LZ3A 5EATA 1VG4A 2Q58A 3WSAA 3N45F 4DXJA 4LFEA 4HD1A 3TFVA 3P8LA 3KROA 3WCBA 2F7MF 2E93A 1WKZA 5H9DA 4KVDA 4NKEA 3ICNA 3LGZB 5IMIA 2P1CA 4DWBA 3WCHA 1RTRA 3RMGA 4EA1A 3OABA 2PS7A 5IK6A 1N1BA 5DGMF 3WEJA 3APZA 3LLWA 3RBMA 4KKMA 5B0IA 1N20A 3PYBA 4OMHA 3LJIA 4N9UA 3AQCB 4LTVA 3M02A 4LTZA 5B02A 4KK2A 1WL1A 1YYUA 5DJRF 2E94A 3WEHA 3ZMCA 3UCAA 3N49F 3N5JF 5IL8A 2Z7HA 2J5CA 5I1UA 3Q2ZA 4EA0A 3TFNA 4KPJA 3KRCB 1WL3A 5ILZA 3EFQA 5AYPA 2Q80A 2E95A 1EZFA 2F94F 1KIYA 4E9ZA 1YHKA 5B0KA 2F8CF 3QQVA 5JV2F 3CKEA 3NF2A 4LXWA 4LLSA 4LZCA 5DHIA 1HM4A 2Z4YA 3WC9A 5A0IA 3N0FA 2AZKA 2ZEVA 5IL3A 3PH7A 4MC0A 4RNQA 3MAVA 4FJQA 3PKOA 4JXNA 4N1ZF 3LG5A 1WY0A 1YQ7A 1YYSA 3N46F 3G4DA 3W7FA 5ILIA 5HN9A 4NFKF 2Z50A 3P41A 1V4EA 4LZ0A 2FORA 3AQ0A 1HXAA 3M01A 2J1PA 4KQUA 5B01A 3PYAA 2QISA 2H8OA 4E9UA 2RAHA 2F9KF 4GP2A 3KRAA 2OGDA 4PVYF 5DHKA 1V4KA 3LK5A 5DIQF 3OYRA 4RXAA 2O1OA 3Q30A 4RYPA 5AFXA 3LOMA 5JA0F 3OACA 4LPGF 2PS5A 4Q23A 3VJ9A 1VG2A 5B0JA 3P8RA 3RYWA 4OKZA 3KRFB 2Z4ZA 3LMDA 2Q9ZA 1VG7A 3BNYA 1N21A 3N1VF 4KUXA 4UMJA 3V1XA 1FPSA 1UBXA 2J1OA 1DI1A 3P5PA 2ZCSA 3TS7A 3LDWA 3V1VA 4NKFA 3ICMA 4LIXA 1VG6A 5KSXF 3RYEA 5CG6A 5JV1F 3VJ8A 3P5RA 5AELA 1YYRA 4P0VA 1JFGA 1HX9A 1RQJA 4F6VA 2OPNA 1YYQA 3M9UA 3WJNA 3WJOA 3EZ3A 3AE0A 3KRPB 4GP1A 5A0KA 5IMNA 5DGNF 3SDQA 3VJBA 3ICZA 1N23A 3IPIA 4XQTF 2Z52A 2PS4A 3SDVA 4JVJF 1YHLA 2Z4VA 3CC9A 4NG6A 4L2XF 4LUUA 3WCIA 3Q1OA 3EGTA 3WCAA 3ID0A 4JXYA 4OGUA 4RXEA 5DJVF 5IK0A 3VJDA 3ZL6A 1WL0A 2ONGA 4ZQ8A 3ZMBA 3ACYA 3WSBA 4XQRF 4H5DF 3LEEA 5IKAA 3WJKA 3S4JA 2OPMA 1YJ4A 3NPRA 4DZWA 4QPFA 5DZ2A 2E8WA 4F6XA 3VJAA 2EWGA 4MC3A 3LZ9A 5IK9A 2F92F 2E8UA 2DH4A 5IVGA 3N3LF 5ERNA 3KROB 5E8HA 1YYTA 4DEMF 3KB9A 3KRCA 3WCMA 2Z7IA 5AHUB 4P0WA 4NUAA 1HXGA 2AZJA 3WCLA 4WK5A 2Q9YA 4LPHF 4P0XA 2VF6A 4F62A 4OMGA 3OABB 1UBYA 3WEIA 1WMWA
chains in the Genus database with same CATH topology
3N5HF 5ILDA 1WL2A 1V4JA 1UBWA 2AEKA 5EASA 5ILYA 5IM1A 4KVWA 5EAUA 5A0JA 5ER8A 3DYFA 2ZEUA 1HM7A 2ZCRA 5E8KA 4GA3A 3WEFA 1V4IA 5HNAA 4H5CF 5ILKA 2Z4WA 2ZCOA 5C05A 3SDRA 3TC1A 5DGSF 3NPKA 3ACWA 4H5EF 4LLTA 5EROA 5B00A 5HN8A 3G4FA 3ICKA 3M0GA 2E92A 2ONHA 2E91A 2F8ZF 4JYXA 3Q2QA 3N6KF 4FP4A 4KFAA 4NFIF 4QXSF 2PS6A 1ZW5A 4DHDA 4LFGA 3N3DA 3SDUA 4JZXA 3PDEA 4XQSF 3WCCA 4LFVF 2FTZA 3S9VA 4E1EA 3ZOUA 2E8XA 5JUZF 3BNXA 3KRFA 3WEGA 4KPDA 1HXCA 3DYGA 2AETA 3ZCDA 4DI5A 3SAEA 3KBKA 5IN8A 3WCEA 2E4OA 2ZCQA 1YV5A 3SDTA 1JFAA 1VG3A 5ERMA 3WEKA 4KVIA 4LOBA 4LA5A 4MC8A 2Z4XA 3WCGA 3M00A 3VJCA 3KRAB 2AELA 4PVXF 4EA2A 2Z78A 1N24A 1KIZA 3N0GA 5HN7A 3N1WF 4KVYA 3WCDA 1RQIA 3CP6A 5B03A 5CG5A 5IMPA 3OACB 5DJPF 4KWDA 3ADZA 4RXCA 5JV0F 4K10A 4OKMA 3WE9A 4JZBA 1YHMA 2AZLA 3LSNA 4GAXA 5ILJA 3TFPA 4NFJF 3ASXA 3DYHA 1V4HA 2E8TA 4RXDA 3KRPA 1PS1A 5DW7A 5B0LA 2F89F 4KQSA 3QKCA 5ILHA 5B0MA 3LGKA 2PS8A 1N22A 1UBVA 3AQBB 2E90A 3IBAA 2ZY1A 3WCJA 1N1ZA 3LVSA 3MZVA 1DGPA 3VJEA 3ACXA 5IKHA 4DWGA 4LA6A 2I19A 2OA6A 5E8LA 3WCFA 2E8VA 3V66A 3B7LA 4KQ5A 3NRIA 4LZ3A 5EATA 1VG4A 2Q58A 3WSAA 3N45F 4DXJA 4LFEA 4HD1A 3TFVA 3P8LA 3KROA 3WCBA 2F7MF 2E93A 1WKZA 5H9DA 4KVDA 4NKEA 3ICNA 3LGZB 5IMIA 2P1CA 4DWBA 3WCHA 1RTRA 3RMGA 4EA1A 3OABA 2PS7A 5IK6A 1N1BA 5DGMF 3WEJA 3APZA 3LLWA 3RBMA 4KKMA 5B0IA 1N20A 3PYBA 4OMHA 3LJIA 4N9UA 3AQCB 4LTVA 3M02A 4LTZA 5B02A 4KK2A 1WL1A 1YYUA 5DJRF 2E94A 3WEHA 3ZMCA 3UCAA 3N49F 3N5JF 5IL8A 2Z7HA 2J5CA 5I1UA 3Q2ZA 4EA0A 3TFNA 4KPJA 3KRCB 1WL3A 5ILZA 3EFQA 5AYPA 2Q80A 2E95A 1EZFA 2F94F 1KIYA 4E9ZA 1YHKA 5B0KA 2F8CF 3QQVA 5JV2F 3CKEA 3NF2A 4LXWA 4LLSA 4LZCA 5DHIA 1HM4A 2Z4YA 3WC9A 5A0IA 3N0FA 2AZKA 2ZEVA 5IL3A 3PH7A 4MC0A 4RNQA 3MAVA 4FJQA 3PKOA 4JXNA 4N1ZF 3LG5A 1WY0A 1YQ7A 1YYSA 3N46F 3G4DA 3W7FA 5ILIA 5HN9A 4NFKF 2Z50A 3P41A 1V4EA 4LZ0A 2FORA 3AQ0A 1HXAA 3M01A 2J1PA 4KQUA 5B01A 3PYAA 2QISA 2H8OA 4E9UA 2RAHA 2F9KF 4GP2A 3KRAA 2OGDA 4PVYF 5DHKA 1V4KA 3LK5A 5DIQF 3OYRA 4RXAA 2O1OA 3Q30A 4RYPA 5AFXA 3LOMA 5JA0F 3OACA 4LPGF 2PS5A 4Q23A 3VJ9A 1VG2A 5B0JA 3P8RA 3RYWA 4OKZA 3KRFB 2Z4ZA 3LMDA 2Q9ZA 1VG7A 3BNYA 1N21A 3N1VF 4KUXA 4UMJA 3V1XA 1FPSA 1UBXA 2J1OA 1DI1A 3P5PA 2ZCSA 3TS7A 3LDWA 3V1VA 4NKFA 3ICMA 4LIXA 1VG6A 5KSXF 3RYEA 5CG6A 5JV1F 3VJ8A 3P5RA 5AELA 1YYRA 4P0VA 1JFGA 1HX9A 1RQJA 4F6VA 2OPNA 1YYQA 3M9UA 3WJNA 3WJOA 3EZ3A 3AE0A 3KRPB 4GP1A 5A0KA 5IMNA 5DGNF 3SDQA 3VJBA 3ICZA 1N23A 3IPIA 4XQTF 2Z52A 2PS4A 3SDVA 4JVJF 1YHLA 2Z4VA 3CC9A 4NG6A 4L2XF 4LUUA 3WCIA 3Q1OA 3EGTA 3WCAA 3ID0A 4JXYA 4OGUA 4RXEA 5DJVF 5IK0A 3VJDA 3ZL6A 1WL0A 2ONGA 4ZQ8A 3ZMBA 3ACYA 3WSBA 4XQRF 4H5DF 3LEEA 5IKAA 3WJKA 3S4JA 2OPMA 1YJ4A 3NPRA 4DZWA 4QPFA 5DZ2A 2E8WA 4F6XA 3VJAA 2EWGA 4MC3A 3LZ9A 5IK9A 2F92F 2E8UA 2DH4A 5IVGA 3N3LF 5ERNA 3KROB 5E8HA 1YYTA 4DEMF 3KB9A 3KRCA 3WCMA 2Z7IA 5AHUB 4P0WA 4NUAA 1HXGA 2AZJA 3WCLA 4WK5A 2Q9YA 4LPHF 4P0XA 2VF6A 4F62A 4OMGA 3OABB 1UBYA 3WEIA 1WMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5H F;  5ILD A;  1WL2 A;  1V4J A;  1UBW A;  2AEK A;  5EAS A;  5ILY A;  5IM1 A;  4KVW A;  5EAU A;  5A0J A;  5ER8 A;  3DYF A;  2ZEU A;  1HM7 A;  2ZCR A;  5E8K A;  4GA3 A;  3WEF A;  1V4I A;  5HNA A;  4H5C F;  5ILK A;  2Z4W A;  2ZCO A;  5C05 A;  3SDR A;  3TC1 A;  5DGS F;  3NPK A;  3ACW A;  4H5E F;  4LLT A;  5ERO A;  5B00 A;  5HN8 A;  3G4F A;  3ICK A;  3M0G A;  2E92 A;  2ONH A;  2E91 A;  2F8Z F;  4JYX A;  3Q2Q A;  3N6K F;  4FP4 A;  4KFA A;  4NFI F;  4QXS F;  2PS6 A;  1ZW5 A;  4DHD A;  4LFG A;  3N3D A;  3SDU A;  4JZX A;  3PDE A;  4XQS F;  3WCC A;  4LFV F;  2FTZ A;  3S9V A;  4E1E A;  3ZOU A;  2E8X A;  5JUZ F;  3BNX A;  3KRF A;  3WEG A;  4KPD A;  1HXC A;  3DYG A;  2AET A;  3ZCD A;  4DI5 A;  3SAE A;  3KBK A;  5IN8 A;  3WCE A;  2E4O A;  2ZCQ A;  1YV5 A;  3SDT A;  1JFA A;  1VG3 A;  5ERM A;  3WEK A;  4KVI A;  4LOB A;  4LA5 A;  4MC8 A;  2Z4X A;  3WCG A;  3M00 A;  3VJC A;  3KRA B;  2AEL A;  4PVX F;  4EA2 A;  2Z78 A;  1N24 A;  1KIZ A;  3N0G A;  5HN7 A;  3N1W F;  4KVY A;  3WCD A;  1RQI A;  3CP6 A;  5B03 A;  5CG5 A;  5IMP A;  3OAC B;  5DJP F;  4KWD A;  3ADZ A;  4RXC A;  5JV0 F;  4K10 A;  4OKM A;  3WE9 A;  4JZB A;  1YHM A;  2AZL A;  3LSN A;  4GAX A;  5ILJ A;  3TFP A;  4NFJ F;  3ASX A;  3DYH A;  1V4H A;  2E8T A;  4RXD A;  3KRP A;  1PS1 A;  5DW7 A;  5B0L A;  2F89 F;  4KQS A;  3QKC A;  5ILH A;  5B0M A;  3LGK A;  2PS8 A;  1N22 A;  1UBV A;  3AQB B;  2E90 A;  3IBA A;  2ZY1 A;  3WCJ A;  1N1Z A;  3LVS A;  3MZV A;  1DGP A;  3VJE A;  3ACX A;  5IKH A;  4DWG A;  4LA6 A;  2I19 A;  2OA6 A;  5E8L A;  3WCF A;  2E8V A;  3V66 A;  3B7L A;  4KQ5 A;  3NRI A;  4LZ3 A;  5EAT A;  1VG4 A;  2Q58 A;  3WSA A;  3N45 F;  4DXJ A;  4LFE A;  4HD1 A;  3TFV A;  3P8L A;  3KRO A;  3WCB A;  2F7M F;  2E93 A;  1WKZ A;  5H9D A;  4KVD A;  4NKE A;  3ICN A;  3LGZ B;  5IMI A;  2P1C A;  4DWB A;  3WCH A;  1RTR A;  3RMG A;  4EA1 A;  3OAB A;  2PS7 A;  5IK6 A;  1N1B A;  5DGM F;  3WEJ A;  3APZ A;  3LLW A;  3RBM A;  4KKM A;  5B0I A;  1N20 A;  3PYB A;  4OMH A;  3LJI A;  4N9U A;  3AQC B;  4LTV A;  3M02 A;  4LTZ A;  5B02 A;  4KK2 A;  1WL1 A;  1YYU A;  5DJR F;  2E94 A;  3WEH A;  3ZMC A;  3UCA A;  3N49 F;  3N5J F;  5IL8 A;  2Z7H A;  2J5C A;  5I1U A;  3Q2Z A;  4EA0 A;  3TFN A;  4KPJ A;  3KRC B;  1WL3 A;  5ILZ A;  3EFQ A;  5AYP A;  2Q80 A;  2E95 A;  1EZF A;  2F94 F;  1KIY A;  4E9Z A;  1YHK A;  5B0K A;  2F8C F;  3QQV A;  5JV2 F;  3CKE A;  3NF2 A;  4LXW A;  4LLS A;  4LZC A;  5DHI A;  1HM4 A;  2Z4Y A;  3WC9 A;  5A0I A;  3N0F A;  2AZK A;  2ZEV A;  5IL3 A;  3PH7 A;  4MC0 A;  4RNQ A;  3MAV A;  4FJQ A;  3PKO A;  4JXN A;  4N1Z F;  3LG5 A;  1WY0 A;  1YQ7 A;  1YYS A;  3N46 F;  3G4D A;  3W7F A;  5ILI A;  5HN9 A;  4NFK F;  2Z50 A;  3P41 A;  1V4E A;  4LZ0 A;  2FOR A;  3AQ0 A;  1HXA A;  3M01 A;  2J1P A;  4KQU A;  5B01 A;  3PYA A;  2QIS A;  2H8O A;  4E9U A;  2RAH A;  2F9K F;  4GP2 A;  3KRA A;  2OGD A;  4PVY F;  5DHK A;  1V4K A;  3LK5 A;  5DIQ F;  3OYR A;  4RXA A;  2O1O A;  3Q30 A;  4RYP A;  5AFX A;  3LOM A;  5JA0 F;  3OAC A;  4LPG F;  2PS5 A;  4Q23 A;  3VJ9 A;  1VG2 A;  5B0J A;  3P8R A;  3RYW A;  4OKZ A;  3KRF B;  2Z4Z A;  3LMD A;  2Q9Z A;  1VG7 A;  3BNY A;  1N21 A;  3N1V F;  4KUX A;  4UMJ A;  3V1X A;  1FPS A;  1UBX A;  2J1O A;  1DI1 A;  3P5P A;  2ZCS A;  3TS7 A;  3LDW A;  3V1V A;  4NKF A;  3ICM A;  4LIX A;  1VG6 A;  5KSX F;  3RYE A;  5CG6 A;  5JV1 F;  3VJ8 A;  3P5R A;  5AEL A;  1YYR A;  4P0V A;  1JFG A;  1HX9 A;  1RQJ A;  4F6V A;  2OPN A;  1YYQ A;  3M9U A;  3WJN A;  3WJO A;  3EZ3 A;  3AE0 A;  3KRP B;  4GP1 A;  5A0K A;  5IMN A;  5DGN F;  3SDQ A;  3VJB A;  3ICZ A;  1N23 A;  3IPI A;  4XQT F;  2Z52 A;  2PS4 A;  3SDV A;  4JVJ F;  1YHL A;  2Z4V A;  3CC9 A;  4NG6 A;  4L2X F;  4LUU A;  3WCI A;  3Q1O A;  3EGT A;  3WCA A;  3ID0 A;  4JXY A;  4OGU A;  4RXE A;  5DJV F;  5IK0 A;  3VJD A;  3ZL6 A;  1WL0 A;  2ONG A;  4ZQ8 A;  3ZMB A;  3ACY A;  3WSB A;  4XQR F;  4H5D F;  3LEE A;  5IKA A;  3WJK A;  3S4J A;  2OPM A;  1YJ4 A;  3NPR A;  4DZW A;  4QPF A;  5DZ2 A;  2E8W A;  4F6X A;  3VJA A;  2EWG A;  4MC3 A;  3LZ9 A;  5IK9 A;  2F92 F;  2E8U A;  2DH4 A;  5IVG A;  3N3L F;  5ERN A;  3KRO B;  5E8H A;  1YYT A;  4DEM F;  3KB9 A;  3KRC A;  3WCM A;  2Z7I A;  5AHU B;  4P0W A;  4NUA A;  1HXG A;  2AZJ A;  3WCL A;  4WK5 A;  2Q9Y A;  4LPH F;  4P0X A;  2VF6 A;  4F62 A;  4OMG A;  3OAB B;  1UBY A;  3WEI A;  1WMW A; 
#chains in the Genus database with same CATH topology
 3N5H F;  5ILD A;  1WL2 A;  1V4J A;  1UBW A;  2AEK A;  5EAS A;  5ILY A;  5IM1 A;  4KVW A;  5EAU A;  5A0J A;  5ER8 A;  3DYF A;  2ZEU A;  1HM7 A;  2ZCR A;  5E8K A;  4GA3 A;  3WEF A;  1V4I A;  5HNA A;  4H5C F;  5ILK A;  2Z4W A;  2ZCO A;  5C05 A;  3SDR A;  3TC1 A;  5DGS F;  3NPK A;  3ACW A;  4H5E F;  4LLT A;  5ERO A;  5B00 A;  5HN8 A;  3G4F A;  3ICK A;  3M0G A;  2E92 A;  2ONH A;  2E91 A;  2F8Z F;  4JYX A;  3Q2Q A;  3N6K F;  4FP4 A;  4KFA A;  4NFI F;  4QXS F;  2PS6 A;  1ZW5 A;  4DHD A;  4LFG A;  3N3D A;  3SDU A;  4JZX A;  3PDE A;  4XQS F;  3WCC A;  4LFV F;  2FTZ A;  3S9V A;  4E1E A;  3ZOU A;  2E8X A;  5JUZ F;  3BNX A;  3KRF A;  3WEG A;  4KPD A;  1HXC A;  3DYG A;  2AET A;  3ZCD A;  4DI5 A;  3SAE A;  3KBK A;  5IN8 A;  3WCE A;  2E4O A;  2ZCQ A;  1YV5 A;  3SDT A;  1JFA A;  1VG3 A;  5ERM A;  3WEK A;  4KVI A;  4LOB A;  4LA5 A;  4MC8 A;  2Z4X A;  3WCG A;  3M00 A;  3VJC A;  3KRA B;  2AEL A;  4PVX F;  4EA2 A;  2Z78 A;  1N24 A;  1KIZ A;  3N0G A;  5HN7 A;  3N1W F;  4KVY A;  3WCD A;  1RQI A;  3CP6 A;  5B03 A;  5CG5 A;  5IMP A;  3OAC B;  5DJP F;  4KWD A;  3ADZ A;  4RXC A;  5JV0 F;  4K10 A;  4OKM A;  3WE9 A;  4JZB A;  1YHM A;  2AZL A;  3LSN A;  4GAX A;  5ILJ A;  3TFP A;  4NFJ F;  3ASX A;  3DYH A;  1V4H A;  2E8T A;  4RXD A;  3KRP A;  1PS1 A;  5DW7 A;  5B0L A;  2F89 F;  4KQS A;  3QKC A;  5ILH A;  5B0M A;  3LGK A;  2PS8 A;  1N22 A;  1UBV A;  3AQB B;  2E90 A;  3IBA A;  2ZY1 A;  3WCJ A;  1N1Z A;  3LVS A;  3MZV A;  1DGP A;  3VJE A;  3ACX A;  5IKH A;  4DWG A;  4LA6 A;  2I19 A;  2OA6 A;  5E8L A;  3WCF A;  2E8V A;  3V66 A;  3B7L A;  4KQ5 A;  3NRI A;  4LZ3 A;  5EAT A;  1VG4 A;  2Q58 A;  3WSA A;  3N45 F;  4DXJ A;  4LFE A;  4HD1 A;  3TFV A;  3P8L A;  3KRO A;  3WCB A;  2F7M F;  2E93 A;  1WKZ A;  5H9D A;  4KVD A;  4NKE A;  3ICN A;  3LGZ B;  5IMI A;  2P1C A;  4DWB A;  3WCH A;  1RTR A;  3RMG A;  4EA1 A;  3OAB A;  2PS7 A;  5IK6 A;  1N1B A;  5DGM F;  3WEJ A;  3APZ A;  3LLW A;  3RBM A;  4KKM A;  5B0I A;  1N20 A;  3PYB A;  4OMH A;  3LJI A;  4N9U A;  3AQC B;  4LTV A;  3M02 A;  4LTZ A;  5B02 A;  4KK2 A;  1WL1 A;  1YYU A;  5DJR F;  2E94 A;  3WEH A;  3ZMC A;  3UCA A;  3N49 F;  3N5J F;  5IL8 A;  2Z7H A;  2J5C A;  5I1U A;  3Q2Z A;  4EA0 A;  3TFN A;  4KPJ A;  3KRC B;  1WL3 A;  5ILZ A;  3EFQ A;  5AYP A;  2Q80 A;  2E95 A;  1EZF A;  2F94 F;  1KIY A;  4E9Z A;  1YHK A;  5B0K A;  2F8C F;  3QQV A;  5JV2 F;  3CKE A;  3NF2 A;  4LXW A;  4LLS A;  4LZC A;  5DHI A;  1HM4 A;  2Z4Y A;  3WC9 A;  5A0I A;  3N0F A;  2AZK A;  2ZEV A;  5IL3 A;  3PH7 A;  4MC0 A;  4RNQ A;  3MAV A;  4FJQ A;  3PKO A;  4JXN A;  4N1Z F;  3LG5 A;  1WY0 A;  1YQ7 A;  1YYS A;  3N46 F;  3G4D A;  3W7F A;  5ILI A;  5HN9 A;  4NFK F;  2Z50 A;  3P41 A;  1V4E A;  4LZ0 A;  2FOR A;  3AQ0 A;  1HXA A;  3M01 A;  2J1P A;  4KQU A;  5B01 A;  3PYA A;  2QIS A;  2H8O A;  4E9U A;  2RAH A;  2F9K F;  4GP2 A;  3KRA A;  2OGD A;  4PVY F;  5DHK A;  1V4K A;  3LK5 A;  5DIQ F;  3OYR A;  4RXA A;  2O1O A;  3Q30 A;  4RYP A;  5AFX A;  3LOM A;  5JA0 F;  3OAC A;  4LPG F;  2PS5 A;  4Q23 A;  3VJ9 A;  1VG2 A;  5B0J A;  3P8R A;  3RYW A;  4OKZ A;  3KRF B;  2Z4Z A;  3LMD A;  2Q9Z A;  1VG7 A;  3BNY A;  1N21 A;  3N1V F;  4KUX A;  4UMJ A;  3V1X A;  1FPS A;  1UBX A;  2J1O A;  1DI1 A;  3P5P A;  2ZCS A;  3TS7 A;  3LDW A;  3V1V A;  4NKF A;  3ICM A;  4LIX A;  1VG6 A;  5KSX F;  3RYE A;  5CG6 A;  5JV1 F;  3VJ8 A;  3P5R A;  5AEL A;  1YYR A;  4P0V A;  1JFG A;  1HX9 A;  1RQJ A;  4F6V A;  2OPN A;  1YYQ A;  3M9U A;  3WJN A;  3WJO A;  3EZ3 A;  3AE0 A;  3KRP B;  4GP1 A;  5A0K A;  5IMN A;  5DGN F;  3SDQ A;  3VJB A;  3ICZ A;  1N23 A;  3IPI A;  4XQT F;  2Z52 A;  2PS4 A;  3SDV A;  4JVJ F;  1YHL A;  2Z4V A;  3CC9 A;  4NG6 A;  4L2X F;  4LUU A;  3WCI A;  3Q1O A;  3EGT A;  3WCA A;  3ID0 A;  4JXY A;  4OGU A;  4RXE A;  5DJV F;  5IK0 A;  3VJD A;  3ZL6 A;  1WL0 A;  2ONG A;  4ZQ8 A;  3ZMB A;  3ACY A;  3WSB A;  4XQR F;  4H5D F;  3LEE A;  5IKA A;  3WJK A;  3S4J A;  2OPM A;  1YJ4 A;  3NPR A;  4DZW A;  4QPF A;  5DZ2 A;  2E8W A;  4F6X A;  3VJA A;  2EWG A;  4MC3 A;  3LZ9 A;  5IK9 A;  2F92 F;  2E8U A;  2DH4 A;  5IVG A;  3N3L F;  5ERN A;  3KRO B;  5E8H A;  1YYT A;  4DEM F;  3KB9 A;  3KRC A;  3WCM A;  2Z7I A;  5AHU B;  4P0W A;  4NUA A;  1HXG A;  2AZJ A;  3WCL A;  4WK5 A;  2Q9Y A;  4LPH F;  4P0X A;  2VF6 A;  4F62 A;  4OMG A;  3OAB B;  1UBY A;  3WEI A;  1WMW A; 
#chains in the Genus database with same CATH homology
 3N5H F;  5ILD A;  1WL2 A;  1V4J A;  1UBW A;  2AEK A;  5EAS A;  5ILY A;  5IM1 A;  4KVW A;  5EAU A;  5A0J A;  5ER8 A;  3DYF A;  2ZEU A;  1HM7 A;  2ZCR A;  5E8K A;  4GA3 A;  3WEF A;  1V4I A;  5HNA A;  4H5C F;  5ILK A;  2Z4W A;  2ZCO A;  5C05 A;  3SDR A;  3TC1 A;  5DGS F;  3NPK A;  3ACW A;  4H5E F;  4LLT A;  5ERO A;  5B00 A;  5HN8 A;  3G4F A;  3ICK A;  3M0G A;  2E92 A;  2ONH A;  2E91 A;  2F8Z F;  4JYX A;  3Q2Q A;  3N6K F;  4FP4 A;  4KFA A;  4NFI F;  4QXS F;  2PS6 A;  1ZW5 A;  4DHD A;  4LFG A;  3N3D A;  3SDU A;  4JZX A;  3PDE A;  4XQS F;  3WCC A;  4LFV F;  2FTZ A;  3S9V A;  4E1E A;  3ZOU A;  2E8X A;  5JUZ F;  3BNX A;  3KRF A;  3WEG A;  4KPD A;  1HXC A;  3DYG A;  2AET A;  3ZCD A;  4DI5 A;  3SAE A;  3KBK A;  5IN8 A;  3WCE A;  2E4O A;  2ZCQ A;  1YV5 A;  3SDT A;  1JFA A;  1VG3 A;  5ERM A;  3WEK A;  4KVI A;  4LOB A;  4LA5 A;  4MC8 A;  2Z4X A;  3WCG A;  3M00 A;  3VJC A;  3KRA B;  2AEL A;  4PVX F;  4EA2 A;  2Z78 A;  1N24 A;  1KIZ A;  3N0G A;  5HN7 A;  3N1W F;  4KVY A;  3WCD A;  1RQI A;  3CP6 A;  5B03 A;  5CG5 A;  5IMP A;  3OAC B;  5DJP F;  4KWD A;  3ADZ A;  4RXC A;  5JV0 F;  4K10 A;  4OKM A;  3WE9 A;  4JZB A;  1YHM A;  2AZL A;  3LSN A;  4GAX A;  5ILJ A;  3TFP A;  4NFJ F;  3ASX A;  3DYH A;  1V4H A;  2E8T A;  4RXD A;  3KRP A;  1PS1 A;  5DW7 A;  5B0L A;  2F89 F;  4KQS A;  3QKC A;  5ILH A;  5B0M A;  3LGK A;  2PS8 A;  1N22 A;  1UBV A;  3AQB B;  2E90 A;  3IBA A;  2ZY1 A;  3WCJ A;  1N1Z A;  3LVS A;  3MZV A;  1DGP A;  3VJE A;  3ACX A;  5IKH A;  4DWG A;  4LA6 A;  2I19 A;  2OA6 A;  5E8L A;  3WCF A;  2E8V A;  3V66 A;  3B7L A;  4KQ5 A;  3NRI A;  4LZ3 A;  5EAT A;  1VG4 A;  2Q58 A;  3WSA A;  3N45 F;  4DXJ A;  4LFE A;  4HD1 A;  3TFV A;  3P8L A;  3KRO A;  3WCB A;  2F7M F;  2E93 A;  1WKZ A;  5H9D A;  4KVD A;  4NKE A;  3ICN A;  3LGZ B;  5IMI A;  2P1C A;  4DWB A;  3WCH A;  1RTR A;  3RMG A;  4EA1 A;  3OAB A;  2PS7 A;  5IK6 A;  1N1B A;  5DGM F;  3WEJ A;  3APZ A;  3LLW A;  3RBM A;  4KKM A;  5B0I A;  1N20 A;  3PYB A;  4OMH A;  3LJI A;  4N9U A;  3AQC B;  4LTV A;  3M02 A;  4LTZ A;  5B02 A;  4KK2 A;  1WL1 A;  1YYU A;  5DJR F;  2E94 A;  3WEH A;  3ZMC A;  3UCA A;  3N49 F;  3N5J F;  5IL8 A;  2Z7H A;  2J5C A;  5I1U A;  3Q2Z A;  4EA0 A;  3TFN A;  4KPJ A;  3KRC B;  1WL3 A;  5ILZ A;  3EFQ A;  5AYP A;  2Q80 A;  2E95 A;  1EZF A;  2F94 F;  1KIY A;  4E9Z A;  1YHK A;  5B0K A;  2F8C F;  3QQV A;  5JV2 F;  3CKE A;  3NF2 A;  4LXW A;  4LLS A;  4LZC A;  5DHI A;  1HM4 A;  2Z4Y A;  3WC9 A;  5A0I A;  3N0F A;  2AZK A;  2ZEV A;  5IL3 A;  3PH7 A;  4MC0 A;  4RNQ A;  3MAV A;  4FJQ A;  3PKO A;  4JXN A;  4N1Z F;  3LG5 A;  1WY0 A;  1YQ7 A;  1YYS A;  3N46 F;  3G4D A;  3W7F A;  5ILI A;  5HN9 A;  4NFK F;  2Z50 A;  3P41 A;  1V4E A;  4LZ0 A;  2FOR A;  3AQ0 A;  1HXA A;  3M01 A;  2J1P A;  4KQU A;  5B01 A;  3PYA A;  2QIS A;  2H8O A;  4E9U A;  2RAH A;  2F9K F;  4GP2 A;  3KRA A;  2OGD A;  4PVY F;  5DHK A;  1V4K A;  3LK5 A;  5DIQ F;  3OYR A;  4RXA A;  2O1O A;  3Q30 A;  4RYP A;  5AFX A;  3LOM A;  5JA0 F;  3OAC A;  4LPG F;  2PS5 A;  4Q23 A;  3VJ9 A;  1VG2 A;  5B0J A;  3P8R A;  3RYW A;  4OKZ A;  3KRF B;  2Z4Z A;  3LMD A;  2Q9Z A;  1VG7 A;  3BNY A;  1N21 A;  3N1V F;  4KUX A;  4UMJ A;  3V1X A;  1FPS A;  1UBX A;  2J1O A;  1DI1 A;  3P5P A;  2ZCS A;  3TS7 A;  3LDW A;  3V1V A;  4NKF A;  3ICM A;  4LIX A;  1VG6 A;  5KSX F;  3RYE A;  5CG6 A;  5JV1 F;  3VJ8 A;  3P5R A;  5AEL A;  1YYR A;  4P0V A;  1JFG A;  1HX9 A;  1RQJ A;  4F6V A;  2OPN A;  1YYQ A;  3M9U A;  3WJN A;  3WJO A;  3EZ3 A;  3AE0 A;  3KRP B;  4GP1 A;  5A0K A;  5IMN A;  5DGN F;  3SDQ A;  3VJB A;  3ICZ A;  1N23 A;  3IPI A;  4XQT F;  2Z52 A;  2PS4 A;  3SDV A;  4JVJ F;  1YHL A;  2Z4V A;  3CC9 A;  4NG6 A;  4L2X F;  4LUU A;  3WCI A;  3Q1O A;  3EGT A;  3WCA A;  3ID0 A;  4JXY A;  4OGU A;  4RXE A;  5DJV F;  5IK0 A;  3VJD A;  3ZL6 A;  1WL0 A;  2ONG A;  4ZQ8 A;  3ZMB A;  3ACY A;  3WSB A;  4XQR F;  4H5D F;  3LEE A;  5IKA A;  3WJK A;  3S4J A;  2OPM A;  1YJ4 A;  3NPR A;  4DZW A;  4QPF A;  5DZ2 A;  2E8W A;  4F6X A;  3VJA A;  2EWG A;  4MC3 A;  3LZ9 A;  5IK9 A;  2F92 F;  2E8U A;  2DH4 A;  5IVG A;  3N3L F;  5ERN A;  3KRO B;  5E8H A;  1YYT A;  4DEM F;  3KB9 A;  3KRC A;  3WCM A;  2Z7I A;  5AHU B;  4P0W A;  4NUA A;  1HXG A;  2AZJ A;  3WCL A;  4WK5 A;  2Q9Y A;  4LPH F;  4P0X A;  2VF6 A;  4F62 A;  4OMG A;  3OAB B;  1UBY A;  3WEI A;  1WMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...