4LOBA

Crystal structure of polyprenyl diphosphate synthase a1s_2732 (target efi-509223) from acinetobacter baumannii
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
340
structure length
326
Chain Sequence
HSSGVDLGTENLYFQSMVIDFKQDILAPVATDFAAMDHLINEGISSKVGLVMSVSKHVVEAGGKRMRPIMCLLAARACDLDNMQNAQRLAAIIEMLHTATLVHDDVVDWNNQTAVLVGDFLIARAFDLLVDLNNMTLLKDFSTGTCEIAEGEVLQLQSQHQPDTTEETYLKIIHGKTSRLFELATEGAAILAGQEAYREPLRLFAGHFGNAFQIIDDILDYTSDAETLGKNIGDDLMEGKPTLPLISALAHSTGEEHAIIRRSIATGGVDQLPKVIEIVQKSGALDYCQRRAQEETEAALQALSILPDTPYRQALINLTRLALHRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprenyl synthetase
publication title Crystal structure of polyprenyl diphosphate synthase from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
molecule tags Transferase
total genus 133
structure length 326
sequence length 340
ec nomenclature ec 2.5.1.-:
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4lobA00
3WJOA 1KIYA 3PKOA 1ZW5A 3WCHA 5IL3A 2DH4A 4KPJA 4H5EF 3SDRA 3TFNA 2AETA 4GAXA 4KVDA 3ID0A 2Z7IA 3RMGA 5EATA 3WCDA 2J1PA 4NFIF 4NFJF 3LDWA 2PS5A 5ILIA 1N21A 4JXNA 5CG6A 4DXJA 3NPRA 2AZLA 4KWDA 2Z4VA 5HN9A 3QKCA 1V4HA 3WCMA 4DWGA 3WCLA 2FTZA 2Z50A 2Z78A 4ZQ8A 5IM1A 3S9VA 3ASXA 3ZOUA 2E8UA 4XQTF 5B01A 4LPHF 3DYFA 3N3LF 5DZ2A 2OGDA 5ILHA 4LLTA 3P8RA 2ZY1A 4QXSF 1N20A 3N0GA 5B0IA 5AHUB 4GP1A 5DGSF 3WCIA 4LPGF 3LEEA 3LG5A 3VJ8A 3AQCB 5JV2F 3TFPA 3WCEA 3LZ9A 2Z4YA 3DYHA 4E1EA 5A0KA 3ACWA 4EA1A 4P0VA 5IN8A 2F7MF 3SDUA 4MC3A 3KRPB 4LIXA 5IKHA 2Z4WA 5E8HA 1YJ4A 1WL0A 1HXCA 5B0MA 1VG3A 5C05A 3LK5A 3WC9A 3RBMA 5EASA 2ZCOA 2AZKA 3WEGA 3WEIA 4LFVF 3P5RA 3WEJA 4E9UA 5B03A 1UBVA 3G4FA 3KROA 4JVJF 1V4IA 1YHMA 2E8TA 2H8OA 3EFQA 2E94A 3LOMA 3V1VA 4LTZA 5IKAA 3CKEA 4F62A 3WJNA 4JYXA 4NUAA 1V4JA 1DI1A 1V4EA 3WSBA 1WKZA 2ONHA 3KRCA 5EAUA 3ZCDA 2PS8A 5IMIA 5DHKA 2E4OA 4DWBA 3NRIA 4P0WA 4LXWA 3Q2ZA 3SDTA 3P8LA 4HD1A 5HNAA 3VJEA 3WCCA 3OACA 3N6KF 3LSNA 2QISA 2P1CA 3WEFA 4MC0A 3CC9A 5DJRF 1HX9A 3M0GA 4GP2A 4RNQA 2ONGA 4WK5A 4RXDA 5B00A 3IBAA 2F92F 4LZCA 3V66A 2E95A 2PS6A 3B7LA 2FORA 4P0XA 4OKZA 3VJDA 3KROB 3ZL6A 4FP4A 4KFAA 2F94F 3ADZA 3Q1OA 1UBYA 5DIQF 1VG2A 4LOBA 1YYTA 5IMNA 2ZEVA 3WE9A 4F6VA 3MAVA 2J1OA 3NF2A 1YHLA 3KRAA 5IK6A 3N1VF 4XQSF 3N49F 2Q58A 5ERNA 3N46F 4DEMF 3IPIA 4RYPA 3WCBA 5EROA 3LLWA 2Q9YA 2Q80A 3KRFB 3BNXA 1YYRA 4KVYA 2Z4XA 1WMWA 2F9KF 3PYBA 4Q23A 5DGNF 3NPKA 3P41A 4NG6A 3VJBA 5DJVF 1HXGA 3KB9A 4LTVA 4LZ0A 4NFKF 1YYSA 5DW7A 1RQJA 5JA0F 3PH7A 4DHDA 3N0FA 2RAHA 3Q30A 4LZ3A 4RXEA 1N1BA 3LVSA 2ZEUA 5B0KA 3N45F 3ICKA 4LA6A 5AFXA 4EA0A 3KRAB 3ZMBA 2OPMA 3LMDA 1RQIA 4N1ZF 3EZ3A 1N23A 3WCFA 5A0IA 1UBWA 2ZCQA 3OYRA 2E8XA 3P5PA 1JFAA 5ILJA 3N1WF 4KVIA 4DI5A 1HM7A 2AEKA 3RYEA 3LGKA 4OMHA 3KBKA 1HM4A 3ICZA 5A0JA 4LFEA 3PYAA 2I19A 4RXAA 1V4KA 4XQRF 5ERMA 2AELA 5KSXF 4E9ZA 5ILYA 3ACXA 2VF6A 1DGPA 1VG4A 3LJIA 3VJCA 3TC1A 2Z7HA 2OA6A 3WSAA 4KK2A 3WCGA 3SDQA 4H5DF 4EA2A 5E8KA 5HN8A 5ILKA 3UCAA 5IVGA 1WL1A 2E90A 5B02A 1WY0A 3QQVA 5DGMF 5ILDA 3LGZB 4QPFA 1HXAA 3VJ9A 1VG6A 3KRPA 3SAEA 1VG7A 4OMGA 4NKEA 3WJKA 3APZA 2F8ZF 4PVXF 2ZCSA 5DHIA 2PS4A 4KQ5A 3KRCB 3WCAA 1YYUA 4LLSA 3Q2QA 3M00A 3SDVA 3BNYA 1YQ7A 5IK0A 3MZVA 3ZMCA 2F8CF 1YYQA 3M9UA 4DZWA 3OACB 2O1OA 3AQ0A 5H9DA 1YHKA 4FJQA 2J5CA 4PVYF 4OGUA 3OABA 4K10A 2EWGA 4L2XF 1PS1A 4N9UA 3CP6A 3N5HF 5AELA 5IK9A 4KQSA 2E93A 3V1XA 4MC8A 1N1ZA 4H5CF 3AE0A 5JV0F 2E92A 3ACYA 2E8WA 3DYGA 2E8VA 3M02A 4KVWA 5JUZF 1WL3A 4KKMA 4NKFA 3W7FA 4OKMA 4GA3A 1EZFA 1UBXA 4F6XA 2Q9ZA 4JXYA 2Z4ZA 1YV5A 5JV1F 4LUUA 5B0LA 2AZJA 3S4JA 1FPSA 3N3DA 1JFGA 4UMJA 1RTRA 4JZBA 5ER8A 2Z52A 3VJAA 3TFVA 3M01A 3WEHA 5I1UA 3EGTA 3PDEA 3OABB 1KIZA 3WEKA 1WL2A 2ZCRA 5DJPF 3WCJA 4KPDA 3RYWA 2PS7A 3AQBB 5IMPA 2E91A 4KQUA 5B0JA 2F89F 1N22A 3N5JF 2OPNA 5HN7A 5CG5A 5E8LA 3G4DA 3KRFA 4KUXA 5ILZA 3ICNA 5AYPA 1N24A 4LFGA 4RXCA 5IL8A 3ICMA 3TS7A 4LA5A 4JZXA
chains in the Genus database with same CATH superfamily
3WJOA 1KIYA 3PKOA 1ZW5A 3WCHA 5IL3A 2DH4A 4KPJA 4H5EF 3SDRA 3TFNA 2AETA 4GAXA 4KVDA 3ID0A 2Z7IA 3RMGA 5EATA 3WCDA 2J1PA 4NFIF 4NFJF 3LDWA 2PS5A 5ILIA 1N21A 4JXNA 5CG6A 4DXJA 3NPRA 2AZLA 4KWDA 2Z4VA 5HN9A 3QKCA 1V4HA 3WCMA 4DWGA 3WCLA 2FTZA 2Z50A 2Z78A 4ZQ8A 5IM1A 3S9VA 3ASXA 3ZOUA 2E8UA 4XQTF 5B01A 4LPHF 3DYFA 3N3LF 5DZ2A 2OGDA 5ILHA 4LLTA 3P8RA 2ZY1A 4QXSF 1N20A 3N0GA 5B0IA 5AHUB 4GP1A 5DGSF 3WCIA 4LPGF 3LEEA 3LG5A 3VJ8A 3AQCB 5JV2F 3TFPA 3WCEA 3LZ9A 2Z4YA 3DYHA 4E1EA 5A0KA 3ACWA 4EA1A 4P0VA 5IN8A 2F7MF 3SDUA 4MC3A 3KRPB 4LIXA 5IKHA 2Z4WA 5E8HA 1YJ4A 1WL0A 1HXCA 5B0MA 1VG3A 5C05A 3LK5A 3WC9A 3RBMA 5EASA 2ZCOA 2AZKA 3WEGA 3WEIA 4LFVF 3P5RA 3WEJA 4E9UA 5B03A 1UBVA 3G4FA 3KROA 4JVJF 1V4IA 1YHMA 2E8TA 2H8OA 3EFQA 2E94A 3LOMA 3V1VA 4LTZA 5IKAA 3CKEA 4F62A 3WJNA 4JYXA 4NUAA 1V4JA 1DI1A 1V4EA 3WSBA 1WKZA 2ONHA 3KRCA 5EAUA 3ZCDA 2PS8A 5IMIA 5DHKA 2E4OA 4DWBA 3NRIA 4P0WA 4LXWA 3Q2ZA 3SDTA 3P8LA 4HD1A 5HNAA 3VJEA 3WCCA 3OACA 3N6KF 3LSNA 2QISA 2P1CA 3WEFA 4MC0A 3CC9A 5DJRF 1HX9A 3M0GA 4GP2A 4RNQA 2ONGA 4WK5A 4RXDA 5B00A 3IBAA 2F92F 4LZCA 3V66A 2E95A 2PS6A 3B7LA 2FORA 4P0XA 4OKZA 3VJDA 3KROB 3ZL6A 4FP4A 4KFAA 2F94F 3ADZA 3Q1OA 1UBYA 5DIQF 1VG2A 4LOBA 1YYTA 5IMNA 2ZEVA 3WE9A 4F6VA 3MAVA 2J1OA 3NF2A 1YHLA 3KRAA 5IK6A 3N1VF 4XQSF 3N49F 2Q58A 5ERNA 3N46F 4DEMF 3IPIA 4RYPA 3WCBA 5EROA 3LLWA 2Q9YA 2Q80A 3KRFB 3BNXA 1YYRA 4KVYA 2Z4XA 1WMWA 2F9KF 3PYBA 4Q23A 5DGNF 3NPKA 3P41A 4NG6A 3VJBA 5DJVF 1HXGA 3KB9A 4LTVA 4LZ0A 4NFKF 1YYSA 5DW7A 1RQJA 5JA0F 3PH7A 4DHDA 3N0FA 2RAHA 3Q30A 4LZ3A 4RXEA 1N1BA 3LVSA 2ZEUA 5B0KA 3N45F 3ICKA 4LA6A 5AFXA 4EA0A 3KRAB 3ZMBA 2OPMA 3LMDA 1RQIA 4N1ZF 3EZ3A 1N23A 3WCFA 5A0IA 1UBWA 2ZCQA 3OYRA 2E8XA 3P5PA 1JFAA 5ILJA 3N1WF 4KVIA 4DI5A 1HM7A 2AEKA 3RYEA 3LGKA 4OMHA 3KBKA 1HM4A 3ICZA 5A0JA 4LFEA 3PYAA 2I19A 4RXAA 1V4KA 4XQRF 5ERMA 2AELA 5KSXF 4E9ZA 5ILYA 3ACXA 2VF6A 1DGPA 1VG4A 3LJIA 3VJCA 3TC1A 2Z7HA 2OA6A 3WSAA 4KK2A 3WCGA 3SDQA 4H5DF 4EA2A 5E8KA 5HN8A 5ILKA 3UCAA 5IVGA 1WL1A 2E90A 5B02A 1WY0A 3QQVA 5DGMF 5ILDA 3LGZB 4QPFA 1HXAA 3VJ9A 1VG6A 3KRPA 3SAEA 1VG7A 4OMGA 4NKEA 3WJKA 3APZA 2F8ZF 4PVXF 2ZCSA 5DHIA 2PS4A 4KQ5A 3KRCB 3WCAA 1YYUA 4LLSA 3Q2QA 3M00A 3SDVA 3BNYA 1YQ7A 5IK0A 3MZVA 3ZMCA 2F8CF 1YYQA 3M9UA 4DZWA 3OACB 2O1OA 3AQ0A 5H9DA 1YHKA 4FJQA 2J5CA 4PVYF 4OGUA 3OABA 4K10A 2EWGA 4L2XF 1PS1A 4N9UA 3CP6A 3N5HF 5AELA 5IK9A 4KQSA 2E93A 3V1XA 4MC8A 1N1ZA 4H5CF 3AE0A 5JV0F 2E92A 3ACYA 2E8WA 3DYGA 2E8VA 3M02A 4KVWA 5JUZF 1WL3A 4KKMA 4NKFA 3W7FA 4OKMA 4GA3A 1EZFA 1UBXA 4F6XA 2Q9ZA 4JXYA 2Z4ZA 1YV5A 5JV1F 4LUUA 5B0LA 2AZJA 3S4JA 1FPSA 3N3DA 1JFGA 4UMJA 1RTRA 4JZBA 5ER8A 2Z52A 3VJAA 3TFVA 3M01A 3WEHA 5I1UA 3EGTA 3PDEA 3OABB 1KIZA 3WEKA 1WL2A 2ZCRA 5DJPF 3WCJA 4KPDA 3RYWA 2PS7A 3AQBB 5IMPA 2E91A 4KQUA 5B0JA 2F89F 1N22A 3N5JF 2OPNA 5HN7A 5CG5A 5E8LA 3G4DA 3KRFA 4KUXA 5ILZA 3ICNA 5AYPA 1N24A 4LFGA 4RXCA 5IL8A 3ICMA 3TS7A 4LA5A 4JZXA
chains in the Genus database with same CATH topology
3WJOA 1KIYA 3PKOA 1ZW5A 3WCHA 5IL3A 2DH4A 4KPJA 4H5EF 3SDRA 3TFNA 2AETA 4GAXA 4KVDA 3ID0A 2Z7IA 3RMGA 5EATA 3WCDA 2J1PA 4NFIF 4NFJF 3LDWA 2PS5A 5ILIA 1N21A 4JXNA 5CG6A 4DXJA 3NPRA 2AZLA 4KWDA 2Z4VA 5HN9A 3QKCA 1V4HA 3WCMA 4DWGA 3WCLA 2FTZA 2Z50A 2Z78A 4ZQ8A 5IM1A 3S9VA 3ASXA 3ZOUA 2E8UA 4XQTF 5B01A 4LPHF 3DYFA 3N3LF 5DZ2A 2OGDA 5ILHA 4LLTA 3P8RA 2ZY1A 4QXSF 1N20A 3N0GA 5B0IA 5AHUB 4GP1A 5DGSF 3WCIA 4LPGF 3LEEA 3LG5A 3VJ8A 3AQCB 5JV2F 3TFPA 3WCEA 3LZ9A 2Z4YA 3DYHA 4E1EA 5A0KA 3ACWA 4EA1A 4P0VA 5IN8A 2F7MF 3SDUA 4MC3A 3KRPB 4LIXA 5IKHA 2Z4WA 5E8HA 1YJ4A 1WL0A 1HXCA 5B0MA 1VG3A 5C05A 3LK5A 3WC9A 3RBMA 5EASA 2ZCOA 2AZKA 3WEGA 3WEIA 4LFVF 3P5RA 3WEJA 4E9UA 5B03A 1UBVA 3G4FA 3KROA 4JVJF 1V4IA 1YHMA 2E8TA 2H8OA 3EFQA 2E94A 3LOMA 3V1VA 4LTZA 5IKAA 3CKEA 4F62A 3WJNA 4JYXA 4NUAA 1V4JA 1DI1A 1V4EA 3WSBA 1WKZA 2ONHA 3KRCA 5EAUA 3ZCDA 2PS8A 5IMIA 5DHKA 2E4OA 4DWBA 3NRIA 4P0WA 4LXWA 3Q2ZA 3SDTA 3P8LA 4HD1A 5HNAA 3VJEA 3WCCA 3OACA 3N6KF 3LSNA 2QISA 2P1CA 3WEFA 4MC0A 3CC9A 5DJRF 1HX9A 3M0GA 4GP2A 4RNQA 2ONGA 4WK5A 4RXDA 5B00A 3IBAA 2F92F 4LZCA 3V66A 2E95A 2PS6A 3B7LA 2FORA 4P0XA 4OKZA 3VJDA 3KROB 3ZL6A 4FP4A 4KFAA 2F94F 3ADZA 3Q1OA 1UBYA 5DIQF 1VG2A 4LOBA 1YYTA 5IMNA 2ZEVA 3WE9A 4F6VA 3MAVA 2J1OA 3NF2A 1YHLA 3KRAA 5IK6A 3N1VF 4XQSF 3N49F 2Q58A 5ERNA 3N46F 4DEMF 3IPIA 4RYPA 3WCBA 5EROA 3LLWA 2Q9YA 2Q80A 3KRFB 3BNXA 1YYRA 4KVYA 2Z4XA 1WMWA 2F9KF 3PYBA 4Q23A 5DGNF 3NPKA 3P41A 4NG6A 3VJBA 5DJVF 1HXGA 3KB9A 4LTVA 4LZ0A 4NFKF 1YYSA 5DW7A 1RQJA 5JA0F 3PH7A 4DHDA 3N0FA 2RAHA 3Q30A 4LZ3A 4RXEA 1N1BA 3LVSA 2ZEUA 5B0KA 3N45F 3ICKA 4LA6A 5AFXA 4EA0A 3KRAB 3ZMBA 2OPMA 3LMDA 1RQIA 4N1ZF 3EZ3A 1N23A 3WCFA 5A0IA 1UBWA 2ZCQA 3OYRA 2E8XA 3P5PA 1JFAA 5ILJA 3N1WF 4KVIA 4DI5A 1HM7A 2AEKA 3RYEA 3LGKA 4OMHA 3KBKA 1HM4A 3ICZA 5A0JA 4LFEA 3PYAA 2I19A 4RXAA 1V4KA 4XQRF 5ERMA 2AELA 5KSXF 4E9ZA 5ILYA 3ACXA 2VF6A 1DGPA 1VG4A 3LJIA 3VJCA 3TC1A 2Z7HA 2OA6A 3WSAA 4KK2A 3WCGA 3SDQA 4H5DF 4EA2A 5E8KA 5HN8A 5ILKA 3UCAA 5IVGA 1WL1A 2E90A 5B02A 1WY0A 3QQVA 5DGMF 5ILDA 3LGZB 4QPFA 1HXAA 3VJ9A 1VG6A 3KRPA 3SAEA 1VG7A 4OMGA 4NKEA 3WJKA 3APZA 2F8ZF 4PVXF 2ZCSA 5DHIA 2PS4A 4KQ5A 3KRCB 3WCAA 1YYUA 4LLSA 3Q2QA 3M00A 3SDVA 3BNYA 1YQ7A 5IK0A 3MZVA 3ZMCA 2F8CF 1YYQA 3M9UA 4DZWA 3OACB 2O1OA 3AQ0A 5H9DA 1YHKA 4FJQA 2J5CA 4PVYF 4OGUA 3OABA 4K10A 2EWGA 4L2XF 1PS1A 4N9UA 3CP6A 3N5HF 5AELA 5IK9A 4KQSA 2E93A 3V1XA 4MC8A 1N1ZA 4H5CF 3AE0A 5JV0F 2E92A 3ACYA 2E8WA 3DYGA 2E8VA 3M02A 4KVWA 5JUZF 1WL3A 4KKMA 4NKFA 3W7FA 4OKMA 4GA3A 1EZFA 1UBXA 4F6XA 2Q9ZA 4JXYA 2Z4ZA 1YV5A 5JV1F 4LUUA 5B0LA 2AZJA 3S4JA 1FPSA 3N3DA 1JFGA 4UMJA 1RTRA 4JZBA 5ER8A 2Z52A 3VJAA 3TFVA 3M01A 3WEHA 5I1UA 3EGTA 3PDEA 3OABB 1KIZA 3WEKA 1WL2A 2ZCRA 5DJPF 3WCJA 4KPDA 3RYWA 2PS7A 3AQBB 5IMPA 2E91A 4KQUA 5B0JA 2F89F 1N22A 3N5JF 2OPNA 5HN7A 5CG5A 5E8LA 3G4DA 3KRFA 4KUXA 5ILZA 3ICNA 5AYPA 1N24A 4LFGA 4RXCA 5IL8A 3ICMA 3TS7A 4LA5A 4JZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WJO A;  1KIY A;  3PKO A;  1ZW5 A;  3WCH A;  5IL3 A;  2DH4 A;  4KPJ A;  4H5E F;  3SDR A;  3TFN A;  2AET A;  4GAX A;  4KVD A;  3ID0 A;  2Z7I A;  3RMG A;  5EAT A;  3WCD A;  2J1P A;  4NFI F;  4NFJ F;  3LDW A;  2PS5 A;  5ILI A;  1N21 A;  4JXN A;  5CG6 A;  4DXJ A;  3NPR A;  2AZL A;  4KWD A;  2Z4V A;  5HN9 A;  3QKC A;  1V4H A;  3WCM A;  4DWG A;  3WCL A;  2FTZ A;  2Z50 A;  2Z78 A;  4ZQ8 A;  5IM1 A;  3S9V A;  3ASX A;  3ZOU A;  2E8U A;  4XQT F;  5B01 A;  4LPH F;  3DYF A;  3N3L F;  5DZ2 A;  2OGD A;  5ILH A;  4LLT A;  3P8R A;  2ZY1 A;  4QXS F;  1N20 A;  3N0G A;  5B0I A;  5AHU B;  4GP1 A;  5DGS F;  3WCI A;  4LPG F;  3LEE A;  3LG5 A;  3VJ8 A;  3AQC B;  5JV2 F;  3TFP A;  3WCE A;  3LZ9 A;  2Z4Y A;  3DYH A;  4E1E A;  5A0K A;  3ACW A;  4EA1 A;  4P0V A;  5IN8 A;  2F7M F;  3SDU A;  4MC3 A;  3KRP B;  4LIX A;  5IKH A;  2Z4W A;  5E8H A;  1YJ4 A;  1WL0 A;  1HXC A;  5B0M A;  1VG3 A;  5C05 A;  3LK5 A;  3WC9 A;  3RBM A;  5EAS A;  2ZCO A;  2AZK A;  3WEG A;  3WEI A;  4LFV F;  3P5R A;  3WEJ A;  4E9U A;  5B03 A;  1UBV A;  3G4F A;  3KRO A;  4JVJ F;  1V4I A;  1YHM A;  2E8T A;  2H8O A;  3EFQ A;  2E94 A;  3LOM A;  3V1V A;  4LTZ A;  5IKA A;  3CKE A;  4F62 A;  3WJN A;  4JYX A;  4NUA A;  1V4J A;  1DI1 A;  1V4E A;  3WSB A;  1WKZ A;  2ONH A;  3KRC A;  5EAU A;  3ZCD A;  2PS8 A;  5IMI A;  5DHK A;  2E4O A;  4DWB A;  3NRI A;  4P0W A;  4LXW A;  3Q2Z A;  3SDT A;  3P8L A;  4HD1 A;  5HNA A;  3VJE A;  3WCC A;  3OAC A;  3N6K F;  3LSN A;  2QIS A;  2P1C A;  3WEF A;  4MC0 A;  3CC9 A;  5DJR F;  1HX9 A;  3M0G A;  4GP2 A;  4RNQ A;  2ONG A;  4WK5 A;  4RXD A;  5B00 A;  3IBA A;  2F92 F;  4LZC A;  3V66 A;  2E95 A;  2PS6 A;  3B7L A;  2FOR A;  4P0X A;  4OKZ A;  3VJD A;  3KRO B;  3ZL6 A;  4FP4 A;  4KFA A;  2F94 F;  3ADZ A;  3Q1O A;  1UBY A;  5DIQ F;  1VG2 A;  4LOB A;  1YYT A;  5IMN A;  2ZEV A;  3WE9 A;  4F6V A;  3MAV A;  2J1O A;  3NF2 A;  1YHL A;  3KRA A;  5IK6 A;  3N1V F;  4XQS F;  3N49 F;  2Q58 A;  5ERN A;  3N46 F;  4DEM F;  3IPI A;  4RYP A;  3WCB A;  5ERO A;  3LLW A;  2Q9Y A;  2Q80 A;  3KRF B;  3BNX A;  1YYR A;  4KVY A;  2Z4X A;  1WMW A;  2F9K F;  3PYB A;  4Q23 A;  5DGN F;  3NPK A;  3P41 A;  4NG6 A;  3VJB A;  5DJV F;  1HXG A;  3KB9 A;  4LTV A;  4LZ0 A;  4NFK F;  1YYS A;  5DW7 A;  1RQJ A;  5JA0 F;  3PH7 A;  4DHD A;  3N0F A;  2RAH A;  3Q30 A;  4LZ3 A;  4RXE A;  1N1B A;  3LVS A;  2ZEU A;  5B0K A;  3N45 F;  3ICK A;  4LA6 A;  5AFX A;  4EA0 A;  3KRA B;  3ZMB A;  2OPM A;  3LMD A;  1RQI A;  4N1Z F;  3EZ3 A;  1N23 A;  3WCF A;  5A0I A;  1UBW A;  2ZCQ A;  3OYR A;  2E8X A;  3P5P A;  1JFA A;  5ILJ A;  3N1W F;  4KVI A;  4DI5 A;  1HM7 A;  2AEK A;  3RYE A;  3LGK A;  4OMH A;  3KBK A;  1HM4 A;  3ICZ A;  5A0J A;  4LFE A;  3PYA A;  2I19 A;  4RXA A;  1V4K A;  4XQR F;  5ERM A;  2AEL A;  5KSX F;  4E9Z A;  5ILY A;  3ACX A;  2VF6 A;  1DGP A;  1VG4 A;  3LJI A;  3VJC A;  3TC1 A;  2Z7H A;  2OA6 A;  3WSA A;  4KK2 A;  3WCG A;  3SDQ A;  4H5D F;  4EA2 A;  5E8K A;  5HN8 A;  5ILK A;  3UCA A;  5IVG A;  1WL1 A;  2E90 A;  5B02 A;  1WY0 A;  3QQV A;  5DGM F;  5ILD A;  3LGZ B;  4QPF A;  1HXA A;  3VJ9 A;  1VG6 A;  3KRP A;  3SAE A;  1VG7 A;  4OMG A;  4NKE A;  3WJK A;  3APZ A;  2F8Z F;  4PVX F;  2ZCS A;  5DHI A;  2PS4 A;  4KQ5 A;  3KRC B;  3WCA A;  1YYU A;  4LLS A;  3Q2Q A;  3M00 A;  3SDV A;  3BNY A;  1YQ7 A;  5IK0 A;  3MZV A;  3ZMC A;  2F8C F;  1YYQ A;  3M9U A;  4DZW A;  3OAC B;  2O1O A;  3AQ0 A;  5H9D A;  1YHK A;  4FJQ A;  2J5C A;  4PVY F;  4OGU A;  3OAB A;  4K10 A;  2EWG A;  4L2X F;  1PS1 A;  4N9U A;  3CP6 A;  3N5H F;  5AEL A;  5IK9 A;  4KQS A;  2E93 A;  3V1X A;  4MC8 A;  1N1Z A;  4H5C F;  3AE0 A;  5JV0 F;  2E92 A;  3ACY A;  2E8W A;  3DYG A;  2E8V A;  3M02 A;  4KVW A;  5JUZ F;  1WL3 A;  4KKM A;  4NKF A;  3W7F A;  4OKM A;  4GA3 A;  1EZF A;  1UBX A;  4F6X A;  2Q9Z A;  4JXY A;  2Z4Z A;  1YV5 A;  5JV1 F;  4LUU A;  5B0L A;  2AZJ A;  3S4J A;  1FPS A;  3N3D A;  1JFG A;  4UMJ A;  1RTR A;  4JZB A;  5ER8 A;  2Z52 A;  3VJA A;  3TFV A;  3M01 A;  3WEH A;  5I1U A;  3EGT A;  3PDE A;  3OAB B;  1KIZ A;  3WEK A;  1WL2 A;  2ZCR A;  5DJP F;  3WCJ A;  4KPD A;  3RYW A;  2PS7 A;  3AQB B;  5IMP A;  2E91 A;  4KQU A;  5B0J A;  2F89 F;  1N22 A;  3N5J F;  2OPN A;  5HN7 A;  5CG5 A;  5E8L A;  3G4D A;  3KRF A;  4KUX A;  5ILZ A;  3ICN A;  5AYP A;  1N24 A;  4LFG A;  4RXC A;  5IL8 A;  3ICM A;  3TS7 A;  4LA5 A;  4JZX A; 
#chains in the Genus database with same CATH topology
 3WJO A;  1KIY A;  3PKO A;  1ZW5 A;  3WCH A;  5IL3 A;  2DH4 A;  4KPJ A;  4H5E F;  3SDR A;  3TFN A;  2AET A;  4GAX A;  4KVD A;  3ID0 A;  2Z7I A;  3RMG A;  5EAT A;  3WCD A;  2J1P A;  4NFI F;  4NFJ F;  3LDW A;  2PS5 A;  5ILI A;  1N21 A;  4JXN A;  5CG6 A;  4DXJ A;  3NPR A;  2AZL A;  4KWD A;  2Z4V A;  5HN9 A;  3QKC A;  1V4H A;  3WCM A;  4DWG A;  3WCL A;  2FTZ A;  2Z50 A;  2Z78 A;  4ZQ8 A;  5IM1 A;  3S9V A;  3ASX A;  3ZOU A;  2E8U A;  4XQT F;  5B01 A;  4LPH F;  3DYF A;  3N3L F;  5DZ2 A;  2OGD A;  5ILH A;  4LLT A;  3P8R A;  2ZY1 A;  4QXS F;  1N20 A;  3N0G A;  5B0I A;  5AHU B;  4GP1 A;  5DGS F;  3WCI A;  4LPG F;  3LEE A;  3LG5 A;  3VJ8 A;  3AQC B;  5JV2 F;  3TFP A;  3WCE A;  3LZ9 A;  2Z4Y A;  3DYH A;  4E1E A;  5A0K A;  3ACW A;  4EA1 A;  4P0V A;  5IN8 A;  2F7M F;  3SDU A;  4MC3 A;  3KRP B;  4LIX A;  5IKH A;  2Z4W A;  5E8H A;  1YJ4 A;  1WL0 A;  1HXC A;  5B0M A;  1VG3 A;  5C05 A;  3LK5 A;  3WC9 A;  3RBM A;  5EAS A;  2ZCO A;  2AZK A;  3WEG A;  3WEI A;  4LFV F;  3P5R A;  3WEJ A;  4E9U A;  5B03 A;  1UBV A;  3G4F A;  3KRO A;  4JVJ F;  1V4I A;  1YHM A;  2E8T A;  2H8O A;  3EFQ A;  2E94 A;  3LOM A;  3V1V A;  4LTZ A;  5IKA A;  3CKE A;  4F62 A;  3WJN A;  4JYX A;  4NUA A;  1V4J A;  1DI1 A;  1V4E A;  3WSB A;  1WKZ A;  2ONH A;  3KRC A;  5EAU A;  3ZCD A;  2PS8 A;  5IMI A;  5DHK A;  2E4O A;  4DWB A;  3NRI A;  4P0W A;  4LXW A;  3Q2Z A;  3SDT A;  3P8L A;  4HD1 A;  5HNA A;  3VJE A;  3WCC A;  3OAC A;  3N6K F;  3LSN A;  2QIS A;  2P1C A;  3WEF A;  4MC0 A;  3CC9 A;  5DJR F;  1HX9 A;  3M0G A;  4GP2 A;  4RNQ A;  2ONG A;  4WK5 A;  4RXD A;  5B00 A;  3IBA A;  2F92 F;  4LZC A;  3V66 A;  2E95 A;  2PS6 A;  3B7L A;  2FOR A;  4P0X A;  4OKZ A;  3VJD A;  3KRO B;  3ZL6 A;  4FP4 A;  4KFA A;  2F94 F;  3ADZ A;  3Q1O A;  1UBY A;  5DIQ F;  1VG2 A;  4LOB A;  1YYT A;  5IMN A;  2ZEV A;  3WE9 A;  4F6V A;  3MAV A;  2J1O A;  3NF2 A;  1YHL A;  3KRA A;  5IK6 A;  3N1V F;  4XQS F;  3N49 F;  2Q58 A;  5ERN A;  3N46 F;  4DEM F;  3IPI A;  4RYP A;  3WCB A;  5ERO A;  3LLW A;  2Q9Y A;  2Q80 A;  3KRF B;  3BNX A;  1YYR A;  4KVY A;  2Z4X A;  1WMW A;  2F9K F;  3PYB A;  4Q23 A;  5DGN F;  3NPK A;  3P41 A;  4NG6 A;  3VJB A;  5DJV F;  1HXG A;  3KB9 A;  4LTV A;  4LZ0 A;  4NFK F;  1YYS A;  5DW7 A;  1RQJ A;  5JA0 F;  3PH7 A;  4DHD A;  3N0F A;  2RAH A;  3Q30 A;  4LZ3 A;  4RXE A;  1N1B A;  3LVS A;  2ZEU A;  5B0K A;  3N45 F;  3ICK A;  4LA6 A;  5AFX A;  4EA0 A;  3KRA B;  3ZMB A;  2OPM A;  3LMD A;  1RQI A;  4N1Z F;  3EZ3 A;  1N23 A;  3WCF A;  5A0I A;  1UBW A;  2ZCQ A;  3OYR A;  2E8X A;  3P5P A;  1JFA A;  5ILJ A;  3N1W F;  4KVI A;  4DI5 A;  1HM7 A;  2AEK A;  3RYE A;  3LGK A;  4OMH A;  3KBK A;  1HM4 A;  3ICZ A;  5A0J A;  4LFE A;  3PYA A;  2I19 A;  4RXA A;  1V4K A;  4XQR F;  5ERM A;  2AEL A;  5KSX F;  4E9Z A;  5ILY A;  3ACX A;  2VF6 A;  1DGP A;  1VG4 A;  3LJI A;  3VJC A;  3TC1 A;  2Z7H A;  2OA6 A;  3WSA A;  4KK2 A;  3WCG A;  3SDQ A;  4H5D F;  4EA2 A;  5E8K A;  5HN8 A;  5ILK A;  3UCA A;  5IVG A;  1WL1 A;  2E90 A;  5B02 A;  1WY0 A;  3QQV A;  5DGM F;  5ILD A;  3LGZ B;  4QPF A;  1HXA A;  3VJ9 A;  1VG6 A;  3KRP A;  3SAE A;  1VG7 A;  4OMG A;  4NKE A;  3WJK A;  3APZ A;  2F8Z F;  4PVX F;  2ZCS A;  5DHI A;  2PS4 A;  4KQ5 A;  3KRC B;  3WCA A;  1YYU A;  4LLS A;  3Q2Q A;  3M00 A;  3SDV A;  3BNY A;  1YQ7 A;  5IK0 A;  3MZV A;  3ZMC A;  2F8C F;  1YYQ A;  3M9U A;  4DZW A;  3OAC B;  2O1O A;  3AQ0 A;  5H9D A;  1YHK A;  4FJQ A;  2J5C A;  4PVY F;  4OGU A;  3OAB A;  4K10 A;  2EWG A;  4L2X F;  1PS1 A;  4N9U A;  3CP6 A;  3N5H F;  5AEL A;  5IK9 A;  4KQS A;  2E93 A;  3V1X A;  4MC8 A;  1N1Z A;  4H5C F;  3AE0 A;  5JV0 F;  2E92 A;  3ACY A;  2E8W A;  3DYG A;  2E8V A;  3M02 A;  4KVW A;  5JUZ F;  1WL3 A;  4KKM A;  4NKF A;  3W7F A;  4OKM A;  4GA3 A;  1EZF A;  1UBX A;  4F6X A;  2Q9Z A;  4JXY A;  2Z4Z A;  1YV5 A;  5JV1 F;  4LUU A;  5B0L A;  2AZJ A;  3S4J A;  1FPS A;  3N3D A;  1JFG A;  4UMJ A;  1RTR A;  4JZB A;  5ER8 A;  2Z52 A;  3VJA A;  3TFV A;  3M01 A;  3WEH A;  5I1U A;  3EGT A;  3PDE A;  3OAB B;  1KIZ A;  3WEK A;  1WL2 A;  2ZCR A;  5DJP F;  3WCJ A;  4KPD A;  3RYW A;  2PS7 A;  3AQB B;  5IMP A;  2E91 A;  4KQU A;  5B0J A;  2F89 F;  1N22 A;  3N5J F;  2OPN A;  5HN7 A;  5CG5 A;  5E8L A;  3G4D A;  3KRF A;  4KUX A;  5ILZ A;  3ICN A;  5AYP A;  1N24 A;  4LFG A;  4RXC A;  5IL8 A;  3ICM A;  3TS7 A;  4LA5 A;  4JZX A; 
#chains in the Genus database with same CATH homology
 3WJO A;  1KIY A;  3PKO A;  1ZW5 A;  3WCH A;  5IL3 A;  2DH4 A;  4KPJ A;  4H5E F;  3SDR A;  3TFN A;  2AET A;  4GAX A;  4KVD A;  3ID0 A;  2Z7I A;  3RMG A;  5EAT A;  3WCD A;  2J1P A;  4NFI F;  4NFJ F;  3LDW A;  2PS5 A;  5ILI A;  1N21 A;  4JXN A;  5CG6 A;  4DXJ A;  3NPR A;  2AZL A;  4KWD A;  2Z4V A;  5HN9 A;  3QKC A;  1V4H A;  3WCM A;  4DWG A;  3WCL A;  2FTZ A;  2Z50 A;  2Z78 A;  4ZQ8 A;  5IM1 A;  3S9V A;  3ASX A;  3ZOU A;  2E8U A;  4XQT F;  5B01 A;  4LPH F;  3DYF A;  3N3L F;  5DZ2 A;  2OGD A;  5ILH A;  4LLT A;  3P8R A;  2ZY1 A;  4QXS F;  1N20 A;  3N0G A;  5B0I A;  5AHU B;  4GP1 A;  5DGS F;  3WCI A;  4LPG F;  3LEE A;  3LG5 A;  3VJ8 A;  3AQC B;  5JV2 F;  3TFP A;  3WCE A;  3LZ9 A;  2Z4Y A;  3DYH A;  4E1E A;  5A0K A;  3ACW A;  4EA1 A;  4P0V A;  5IN8 A;  2F7M F;  3SDU A;  4MC3 A;  3KRP B;  4LIX A;  5IKH A;  2Z4W A;  5E8H A;  1YJ4 A;  1WL0 A;  1HXC A;  5B0M A;  1VG3 A;  5C05 A;  3LK5 A;  3WC9 A;  3RBM A;  5EAS A;  2ZCO A;  2AZK A;  3WEG A;  3WEI A;  4LFV F;  3P5R A;  3WEJ A;  4E9U A;  5B03 A;  1UBV A;  3G4F A;  3KRO A;  4JVJ F;  1V4I A;  1YHM A;  2E8T A;  2H8O A;  3EFQ A;  2E94 A;  3LOM A;  3V1V A;  4LTZ A;  5IKA A;  3CKE A;  4F62 A;  3WJN A;  4JYX A;  4NUA A;  1V4J A;  1DI1 A;  1V4E A;  3WSB A;  1WKZ A;  2ONH A;  3KRC A;  5EAU A;  3ZCD A;  2PS8 A;  5IMI A;  5DHK A;  2E4O A;  4DWB A;  3NRI A;  4P0W A;  4LXW A;  3Q2Z A;  3SDT A;  3P8L A;  4HD1 A;  5HNA A;  3VJE A;  3WCC A;  3OAC A;  3N6K F;  3LSN A;  2QIS A;  2P1C A;  3WEF A;  4MC0 A;  3CC9 A;  5DJR F;  1HX9 A;  3M0G A;  4GP2 A;  4RNQ A;  2ONG A;  4WK5 A;  4RXD A;  5B00 A;  3IBA A;  2F92 F;  4LZC A;  3V66 A;  2E95 A;  2PS6 A;  3B7L A;  2FOR A;  4P0X A;  4OKZ A;  3VJD A;  3KRO B;  3ZL6 A;  4FP4 A;  4KFA A;  2F94 F;  3ADZ A;  3Q1O A;  1UBY A;  5DIQ F;  1VG2 A;  4LOB A;  1YYT A;  5IMN A;  2ZEV A;  3WE9 A;  4F6V A;  3MAV A;  2J1O A;  3NF2 A;  1YHL A;  3KRA A;  5IK6 A;  3N1V F;  4XQS F;  3N49 F;  2Q58 A;  5ERN A;  3N46 F;  4DEM F;  3IPI A;  4RYP A;  3WCB A;  5ERO A;  3LLW A;  2Q9Y A;  2Q80 A;  3KRF B;  3BNX A;  1YYR A;  4KVY A;  2Z4X A;  1WMW A;  2F9K F;  3PYB A;  4Q23 A;  5DGN F;  3NPK A;  3P41 A;  4NG6 A;  3VJB A;  5DJV F;  1HXG A;  3KB9 A;  4LTV A;  4LZ0 A;  4NFK F;  1YYS A;  5DW7 A;  1RQJ A;  5JA0 F;  3PH7 A;  4DHD A;  3N0F A;  2RAH A;  3Q30 A;  4LZ3 A;  4RXE A;  1N1B A;  3LVS A;  2ZEU A;  5B0K A;  3N45 F;  3ICK A;  4LA6 A;  5AFX A;  4EA0 A;  3KRA B;  3ZMB A;  2OPM A;  3LMD A;  1RQI A;  4N1Z F;  3EZ3 A;  1N23 A;  3WCF A;  5A0I A;  1UBW A;  2ZCQ A;  3OYR A;  2E8X A;  3P5P A;  1JFA A;  5ILJ A;  3N1W F;  4KVI A;  4DI5 A;  1HM7 A;  2AEK A;  3RYE A;  3LGK A;  4OMH A;  3KBK A;  1HM4 A;  3ICZ A;  5A0J A;  4LFE A;  3PYA A;  2I19 A;  4RXA A;  1V4K A;  4XQR F;  5ERM A;  2AEL A;  5KSX F;  4E9Z A;  5ILY A;  3ACX A;  2VF6 A;  1DGP A;  1VG4 A;  3LJI A;  3VJC A;  3TC1 A;  2Z7H A;  2OA6 A;  3WSA A;  4KK2 A;  3WCG A;  3SDQ A;  4H5D F;  4EA2 A;  5E8K A;  5HN8 A;  5ILK A;  3UCA A;  5IVG A;  1WL1 A;  2E90 A;  5B02 A;  1WY0 A;  3QQV A;  5DGM F;  5ILD A;  3LGZ B;  4QPF A;  1HXA A;  3VJ9 A;  1VG6 A;  3KRP A;  3SAE A;  1VG7 A;  4OMG A;  4NKE A;  3WJK A;  3APZ A;  2F8Z F;  4PVX F;  2ZCS A;  5DHI A;  2PS4 A;  4KQ5 A;  3KRC B;  3WCA A;  1YYU A;  4LLS A;  3Q2Q A;  3M00 A;  3SDV A;  3BNY A;  1YQ7 A;  5IK0 A;  3MZV A;  3ZMC A;  2F8C F;  1YYQ A;  3M9U A;  4DZW A;  3OAC B;  2O1O A;  3AQ0 A;  5H9D A;  1YHK A;  4FJQ A;  2J5C A;  4PVY F;  4OGU A;  3OAB A;  4K10 A;  2EWG A;  4L2X F;  1PS1 A;  4N9U A;  3CP6 A;  3N5H F;  5AEL A;  5IK9 A;  4KQS A;  2E93 A;  3V1X A;  4MC8 A;  1N1Z A;  4H5C F;  3AE0 A;  5JV0 F;  2E92 A;  3ACY A;  2E8W A;  3DYG A;  2E8V A;  3M02 A;  4KVW A;  5JUZ F;  1WL3 A;  4KKM A;  4NKF A;  3W7F A;  4OKM A;  4GA3 A;  1EZF A;  1UBX A;  4F6X A;  2Q9Z A;  4JXY A;  2Z4Z A;  1YV5 A;  5JV1 F;  4LUU A;  5B0L A;  2AZJ A;  3S4J A;  1FPS A;  3N3D A;  1JFG A;  4UMJ A;  1RTR A;  4JZB A;  5ER8 A;  2Z52 A;  3VJA A;  3TFV A;  3M01 A;  3WEH A;  5I1U A;  3EGT A;  3PDE A;  3OAB B;  1KIZ A;  3WEK A;  1WL2 A;  2ZCR A;  5DJP F;  3WCJ A;  4KPD A;  3RYW A;  2PS7 A;  3AQB B;  5IMP A;  2E91 A;  4KQU A;  5B0J A;  2F89 F;  1N22 A;  3N5J F;  2OPN A;  5HN7 A;  5CG5 A;  5E8L A;  3G4D A;  3KRF A;  4KUX A;  5ILZ A;  3ICN A;  5AYP A;  1N24 A;  4LFG A;  4RXC A;  5IL8 A;  3ICM A;  3TS7 A;  4LA5 A;  4JZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...