4LOBA

Crystal structure of polyprenyl diphosphate synthase a1s_2732 (target efi-509223) from acinetobacter baumannii
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
340
structure length
326
Chain Sequence
HSSGVDLGTENLYFQSMVIDFKQDILAPVATDFAAMDHLINEGISSKVGLVMSVSKHVVEAGGKRMRPIMCLLAARACDLDNMQNAQRLAAIIEMLHTATLVHDDVVDWNNQTAVLVGDFLIARAFDLLVDLNNMTLLKDFSTGTCEIAEGEVLQLQSQHQPDTTEETYLKIIHGKTSRLFELATEGAAILAGQEAYREPLRLFAGHFGNAFQIIDDILDYTSDAETLGKNIGDDLMEGKPTLPLISALAHSTGEEHAIIRRSIATGGVDQLPKVIEIVQKSGALDYCQRRAQEETEAALQALSILPDTPYRQALINLTRLALHRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Polyprenyl synthetase
publication title Crystal structure of polyprenyl diphosphate synthase from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii
total genus 133
structure length 326
sequence length 340
ec nomenclature ec 2.5.1.-:
pdb deposition date 2013-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4lobA00
1HXCA 4LFEA 5HNAA 3KRAB 4NKFA 2F8CF 2DH4A 4MC8A 4XQSF 4RYPA 2E91A 2F92F 5B03A 2ZEUA 3OACA 5DGSF 3MZVA 3ACWA 5B01A 1WY0A 2F9KF 4LZ3A 1N1BA 3KRFA 3NF2A 1WL3A 4RXEA 2ONHA 3AE0A 3WCAA 3ACYA 4OKZA 1UBXA 3PH7A 1FPSA 5CG5A 3P5PA 4P0XA 4NG6A 4F6XA 5B0JA 4XQTF 4P0VA 3WCHA 3TFVA 5DJVF 4MC3A 3NPRA 1YYTA 3ICNA 2Z7HA 3CP6A 5IN8A 4KPJA 5IKHA 2OA6A 2VF6A 4KK2A 4LZCA 3ASXA 5IMNA 4LTVA 4N1ZF 4NFJF 3PKOA 5A0IA 5ILZA 3TFPA 2Z4WA 4MC0A 4E9ZA 3M00A 3M0GA 2E8VA 2E92A 3LG5A 4N9UA 2ZCQA 4NUAA 1V4EA 3PDEA 3WC9A 3B7LA 1VG6A 5IL8A 3DYGA 3N45F 5DGMF 3WSAA 4KWDA 5ERMA 2PS5A 2Q58A 1VG3A 5B02A 5ILHA 3TS7A 3N5JF 5A0JA 1KIZA 4KQ5A 3UCAA 3KRCB 4Q23A 3TFNA 4GA3A 1WKZA 3LVSA 3VJBA 3OABB 2Z50A 2E95A 4KQSA 3AQBB 4KUXA 5DGNF 5EASA 4LLTA 3Q2ZA 3DYHA 3LMDA 1N22A 1YYRA 1HXAA 5EATA 3S9VA 1YYSA 4FP4A 2Q80A 2H8OA 3VJEA 5HN8A 3LEEA 3N0GA 3Q1OA 4K10A 3APZA 3PYAA 2Z4VA 5EROA 4RXCA 2RAHA 4H5EF 4GP1A 3N5HF 5ILYA 1WL1A 3Q30A 5ILDA 5ER8A 3KRPA 3WJKA 3ZCDA 4HD1A 3ACXA 4H5CF 3LGKA 3LJIA 2AZLA 2ZCOA 2Q9ZA 4OMHA 1HXGA 1YQ7A 2F8ZF 3ICZA 1HM7A 4E1EA 4LA5A 3OACB 4NFIF 3G4FA 3M01A 4DXJA 3WCMA 2FTZA 3TC1A 1ZW5A 1V4JA 5C05A 5JV1F 5HN9A 4LFVF 5B0IA 3EZ3A 3RBMA 1YHKA 3DYFA 5DJPF 5H9DA 5CG6A 5IMIA 3EFQA 1RQIA 1YHLA 1WL0A 5IM1A 3P5RA 3M9UA 3SDVA 4UMJA 3LLWA 3P8RA 5JUZF 3WJNA 2F7MF 4QXSF 5JV0F 3LZ9A 4PVXF 2QISA 3N46F 4LZ0A 3RYEA 3WEKA 3N49F 2OPMA 3WEGA 4KQUA 4JXNA 4KVIA 3ZL6A 5B00A 4DWGA 4F62A 3ZMCA 3RMGA 5IK9A 4LXWA 4L2XF 3VJDA 3WEFA 4P0WA 3WCBA 4LIXA 3RYWA 2ZY1A 3NRIA 1YYQA 1VG4A 2Z7IA 1V4KA 3SDUA 3Q2QA 2PS8A 4KPDA 3N0FA 2PS7A 1YV5A 1HM4A 3KRCA 2Z52A 2Z4YA 3WE9A 3ICKA 3N3LF 4DWBA 3PYBA 2OPNA 1DGPA 1UBWA 5AELA 3LGZB 1N1ZA 3G4DA 4KKMA 3WEIA 3IPIA 3WCDA 4LPGF 2AELA 5ILIA 4KVDA 3CKEA 1N21A 1KIYA 3ADZA 4JYXA 2J5CA 2E4OA 5AFXA 1UBYA 3VJ9A 3WEJA 1HX9A 2I19A 3IBAA 3P8LA 3WCJA 2AZJA 3SDTA 4KFAA 1WMWA 3N6KF 3KROA 4RNQA 4LTZA 1N24A 4EA0A 3KRAA 5DW7A 2J1PA 3N1WF 2E8TA 5EAUA 4JVJF 2PS4A 5AYPA 3KRPB 4F6VA 1RQJA 2ZCSA 3AQ0A 2Z4ZA 4LPHF 2F89F 5DZ2A 3WCIA 5IVGA 4KVYA 3KRFB 3ZOUA 4JXYA 3P41A 1WL2A 4JZXA 4LFGA 3AQCB 3WJOA 2OGDA 5I1UA 5B0KA 3ICMA 3WSBA 3LOMA 3N3DA 2FORA 5A0KA 1YHMA 3QKCA 2E94A 3VJAA 4EA2A 3SDRA 3LK5A 3OYRA 3ZMBA 2AETA 4GAXA 2E8UA 4ZQ8A 3WEHA 4DI5A 5DHIA 2ONGA 3SDQA 5ILKA 5E8LA 1V4IA 5KSXF 2F94F 2PS6A 1YJ4A 3EGTA 4OMGA 5ILJA 4EA1A 2E93A 3CC9A 5AHUB 4OGUA 2O1OA 2E90A 3WCEA 1N23A 5IL3A 5B0MA 4KVWA 4RXDA 3KB9A 4WK5A 4LOBA 3LSNA 3S4JA 2ZCRA 3BNXA 1RTRA 4DEMF 3QQVA 3SAEA 3MAVA 5E8HA 5E8KA 4JZBA 4LLSA 4NKEA 3VJ8A 3ID0A 2Z4XA 1JFAA 5IK0A 4RXAA 4DHDA 5IKAA 3V66A 5JV2F 5HN7A 1EZFA 3BNYA 1PS1A 3KBKA 4QPFA 5ERNA 3VJCA 3N1VF 2Q9YA 1N20A 5IK6A 3OABA 3V1VA 2EWGA 4OKMA 5B0LA 3NPKA 2ZEVA 5DJRF 2E8XA 4PVYF 1DI1A 4FJQA 2J1OA 1JFGA 3WCCA 1VG2A 4H5DF 4GP2A 4LA6A 3WCLA 3M02A 5IMPA 1V4HA 5JA0F 2P1CA 1UBVA 5DHKA 3WCGA 3W7FA 1YYUA 2Z78A 4LUUA 2E8WA 4NFKF 2AZKA 4XQRF 5DIQF 3WCFA 3LDWA 3KROB 1VG7A 3V1XA 4E9UA 2AEKA 4DZWA
chains in the Genus database with same CATH superfamily
1HXCA 4LFEA 5HNAA 3KRAB 4NKFA 2F8CF 2DH4A 4MC8A 4XQSF 4RYPA 2E91A 2F92F 5B03A 2ZEUA 3OACA 5DGSF 3MZVA 3ACWA 5B01A 1WY0A 2F9KF 4LZ3A 1N1BA 3KRFA 3NF2A 1WL3A 4RXEA 2ONHA 3AE0A 3WCAA 3ACYA 4OKZA 1UBXA 3PH7A 1FPSA 5CG5A 3P5PA 4P0XA 4NG6A 4F6XA 5B0JA 4XQTF 4P0VA 3WCHA 3TFVA 5DJVF 4MC3A 3NPRA 1YYTA 3ICNA 2Z7HA 3CP6A 5IN8A 4KPJA 5IKHA 2OA6A 2VF6A 4KK2A 4LZCA 3ASXA 5IMNA 4LTVA 4N1ZF 4NFJF 3PKOA 5A0IA 5ILZA 3TFPA 2Z4WA 4MC0A 4E9ZA 3M00A 3M0GA 2E8VA 2E92A 3LG5A 4N9UA 2ZCQA 4NUAA 1V4EA 3PDEA 3WC9A 3B7LA 1VG6A 5IL8A 3DYGA 3N45F 5DGMF 3WSAA 4KWDA 5ERMA 2PS5A 2Q58A 1VG3A 5B02A 5ILHA 3TS7A 3N5JF 5A0JA 1KIZA 4KQ5A 3UCAA 3KRCB 4Q23A 3TFNA 4GA3A 1WKZA 3LVSA 3VJBA 3OABB 2Z50A 2E95A 4KQSA 3AQBB 4KUXA 5DGNF 5EASA 4LLTA 3Q2ZA 3DYHA 3LMDA 1N22A 1YYRA 1HXAA 5EATA 3S9VA 1YYSA 4FP4A 2Q80A 2H8OA 3VJEA 5HN8A 3LEEA 3N0GA 3Q1OA 4K10A 3APZA 3PYAA 2Z4VA 5EROA 4RXCA 2RAHA 4H5EF 4GP1A 3N5HF 5ILYA 1WL1A 3Q30A 5ILDA 5ER8A 3KRPA 3WJKA 3ZCDA 4HD1A 3ACXA 4H5CF 3LGKA 3LJIA 2AZLA 2ZCOA 2Q9ZA 4OMHA 1HXGA 1YQ7A 2F8ZF 3ICZA 1HM7A 4E1EA 4LA5A 3OACB 4NFIF 3G4FA 3M01A 4DXJA 3WCMA 2FTZA 3TC1A 1ZW5A 1V4JA 5C05A 5JV1F 5HN9A 4LFVF 5B0IA 3EZ3A 3RBMA 1YHKA 3DYFA 5DJPF 5H9DA 5CG6A 5IMIA 3EFQA 1RQIA 1YHLA 1WL0A 5IM1A 3P5RA 3M9UA 3SDVA 4UMJA 3LLWA 3P8RA 5JUZF 3WJNA 2F7MF 4QXSF 5JV0F 3LZ9A 4PVXF 2QISA 3N46F 4LZ0A 3RYEA 3WEKA 3N49F 2OPMA 3WEGA 4KQUA 4JXNA 4KVIA 3ZL6A 5B00A 4DWGA 4F62A 3ZMCA 3RMGA 5IK9A 4LXWA 4L2XF 3VJDA 3WEFA 4P0WA 3WCBA 4LIXA 3RYWA 2ZY1A 3NRIA 1YYQA 1VG4A 2Z7IA 1V4KA 3SDUA 3Q2QA 2PS8A 4KPDA 3N0FA 2PS7A 1YV5A 1HM4A 3KRCA 2Z52A 2Z4YA 3WE9A 3ICKA 3N3LF 4DWBA 3PYBA 2OPNA 1DGPA 1UBWA 5AELA 3LGZB 1N1ZA 3G4DA 4KKMA 3WEIA 3IPIA 3WCDA 4LPGF 2AELA 5ILIA 4KVDA 3CKEA 1N21A 1KIYA 3ADZA 4JYXA 2J5CA 2E4OA 5AFXA 1UBYA 3VJ9A 3WEJA 1HX9A 2I19A 3IBAA 3P8LA 3WCJA 2AZJA 3SDTA 4KFAA 1WMWA 3N6KF 3KROA 4RNQA 4LTZA 1N24A 4EA0A 3KRAA 5DW7A 2J1PA 3N1WF 2E8TA 5EAUA 4JVJF 2PS4A 5AYPA 3KRPB 4F6VA 1RQJA 2ZCSA 3AQ0A 2Z4ZA 4LPHF 2F89F 5DZ2A 3WCIA 5IVGA 4KVYA 3KRFB 3ZOUA 4JXYA 3P41A 1WL2A 4JZXA 4LFGA 3AQCB 3WJOA 2OGDA 5I1UA 5B0KA 3ICMA 3WSBA 3LOMA 3N3DA 2FORA 5A0KA 1YHMA 3QKCA 2E94A 3VJAA 4EA2A 3SDRA 3LK5A 3OYRA 3ZMBA 2AETA 4GAXA 2E8UA 4ZQ8A 3WEHA 4DI5A 5DHIA 2ONGA 3SDQA 5ILKA 5E8LA 1V4IA 5KSXF 2F94F 2PS6A 1YJ4A 3EGTA 4OMGA 5ILJA 4EA1A 2E93A 3CC9A 5AHUB 4OGUA 2O1OA 2E90A 3WCEA 1N23A 5IL3A 5B0MA 4KVWA 4RXDA 3KB9A 4WK5A 4LOBA 3LSNA 3S4JA 2ZCRA 3BNXA 1RTRA 4DEMF 3QQVA 3SAEA 3MAVA 5E8HA 5E8KA 4JZBA 4LLSA 4NKEA 3VJ8A 3ID0A 2Z4XA 1JFAA 5IK0A 4RXAA 4DHDA 5IKAA 3V66A 5JV2F 5HN7A 1EZFA 3BNYA 1PS1A 3KBKA 4QPFA 5ERNA 3VJCA 3N1VF 2Q9YA 1N20A 5IK6A 3OABA 3V1VA 2EWGA 4OKMA 5B0LA 3NPKA 2ZEVA 5DJRF 2E8XA 4PVYF 1DI1A 4FJQA 2J1OA 1JFGA 3WCCA 1VG2A 4H5DF 4GP2A 4LA6A 3WCLA 3M02A 5IMPA 1V4HA 5JA0F 2P1CA 1UBVA 5DHKA 3WCGA 3W7FA 1YYUA 2Z78A 4LUUA 2E8WA 4NFKF 2AZKA 4XQRF 5DIQF 3WCFA 3LDWA 3KROB 1VG7A 3V1XA 4E9UA 2AEKA 4DZWA
chains in the Genus database with same CATH topology
1HXCA 4LFEA 5HNAA 3KRAB 4NKFA 2F8CF 2DH4A 4MC8A 4XQSF 4RYPA 2E91A 2F92F 5B03A 2ZEUA 3OACA 5DGSF 3MZVA 3ACWA 5B01A 1WY0A 2F9KF 4LZ3A 1N1BA 3KRFA 3NF2A 1WL3A 4RXEA 2ONHA 3AE0A 3WCAA 3ACYA 4OKZA 1UBXA 3PH7A 1FPSA 5CG5A 3P5PA 4P0XA 4NG6A 4F6XA 5B0JA 4XQTF 4P0VA 3WCHA 3TFVA 5DJVF 4MC3A 3NPRA 1YYTA 3ICNA 2Z7HA 3CP6A 5IN8A 4KPJA 5IKHA 2OA6A 2VF6A 4KK2A 4LZCA 3ASXA 5IMNA 4LTVA 4N1ZF 4NFJF 3PKOA 5A0IA 5ILZA 3TFPA 2Z4WA 4MC0A 4E9ZA 3M00A 3M0GA 2E8VA 2E92A 3LG5A 4N9UA 2ZCQA 4NUAA 1V4EA 3PDEA 3WC9A 3B7LA 1VG6A 5IL8A 3DYGA 3N45F 5DGMF 3WSAA 4KWDA 5ERMA 2PS5A 2Q58A 1VG3A 5B02A 5ILHA 3TS7A 3N5JF 5A0JA 1KIZA 4KQ5A 3UCAA 3KRCB 4Q23A 3TFNA 4GA3A 1WKZA 3LVSA 3VJBA 3OABB 2Z50A 2E95A 4KQSA 3AQBB 4KUXA 5DGNF 5EASA 4LLTA 3Q2ZA 3DYHA 3LMDA 1N22A 1YYRA 1HXAA 5EATA 3S9VA 1YYSA 4FP4A 2Q80A 2H8OA 3VJEA 5HN8A 3LEEA 3N0GA 3Q1OA 4K10A 3APZA 3PYAA 2Z4VA 5EROA 4RXCA 2RAHA 4H5EF 4GP1A 3N5HF 5ILYA 1WL1A 3Q30A 5ILDA 5ER8A 3KRPA 3WJKA 3ZCDA 4HD1A 3ACXA 4H5CF 3LGKA 3LJIA 2AZLA 2ZCOA 2Q9ZA 4OMHA 1HXGA 1YQ7A 2F8ZF 3ICZA 1HM7A 4E1EA 4LA5A 3OACB 4NFIF 3G4FA 3M01A 4DXJA 3WCMA 2FTZA 3TC1A 1ZW5A 1V4JA 5C05A 5JV1F 5HN9A 4LFVF 5B0IA 3EZ3A 3RBMA 1YHKA 3DYFA 5DJPF 5H9DA 5CG6A 5IMIA 3EFQA 1RQIA 1YHLA 1WL0A 5IM1A 3P5RA 3M9UA 3SDVA 4UMJA 3LLWA 3P8RA 5JUZF 3WJNA 2F7MF 4QXSF 5JV0F 3LZ9A 4PVXF 2QISA 3N46F 4LZ0A 3RYEA 3WEKA 3N49F 2OPMA 3WEGA 4KQUA 4JXNA 4KVIA 3ZL6A 5B00A 4DWGA 4F62A 3ZMCA 3RMGA 5IK9A 4LXWA 4L2XF 3VJDA 3WEFA 4P0WA 3WCBA 4LIXA 3RYWA 2ZY1A 3NRIA 1YYQA 1VG4A 2Z7IA 1V4KA 3SDUA 3Q2QA 2PS8A 4KPDA 3N0FA 2PS7A 1YV5A 1HM4A 3KRCA 2Z52A 2Z4YA 3WE9A 3ICKA 3N3LF 4DWBA 3PYBA 2OPNA 1DGPA 1UBWA 5AELA 3LGZB 1N1ZA 3G4DA 4KKMA 3WEIA 3IPIA 3WCDA 4LPGF 2AELA 5ILIA 4KVDA 3CKEA 1N21A 1KIYA 3ADZA 4JYXA 2J5CA 2E4OA 5AFXA 1UBYA 3VJ9A 3WEJA 1HX9A 2I19A 3IBAA 3P8LA 3WCJA 2AZJA 3SDTA 4KFAA 1WMWA 3N6KF 3KROA 4RNQA 4LTZA 1N24A 4EA0A 3KRAA 5DW7A 2J1PA 3N1WF 2E8TA 5EAUA 4JVJF 2PS4A 5AYPA 3KRPB 4F6VA 1RQJA 2ZCSA 3AQ0A 2Z4ZA 4LPHF 2F89F 5DZ2A 3WCIA 5IVGA 4KVYA 3KRFB 3ZOUA 4JXYA 3P41A 1WL2A 4JZXA 4LFGA 3AQCB 3WJOA 2OGDA 5I1UA 5B0KA 3ICMA 3WSBA 3LOMA 3N3DA 2FORA 5A0KA 1YHMA 3QKCA 2E94A 3VJAA 4EA2A 3SDRA 3LK5A 3OYRA 3ZMBA 2AETA 4GAXA 2E8UA 4ZQ8A 3WEHA 4DI5A 5DHIA 2ONGA 3SDQA 5ILKA 5E8LA 1V4IA 5KSXF 2F94F 2PS6A 1YJ4A 3EGTA 4OMGA 5ILJA 4EA1A 2E93A 3CC9A 5AHUB 4OGUA 2O1OA 2E90A 3WCEA 1N23A 5IL3A 5B0MA 4KVWA 4RXDA 3KB9A 4WK5A 4LOBA 3LSNA 3S4JA 2ZCRA 3BNXA 1RTRA 4DEMF 3QQVA 3SAEA 3MAVA 5E8HA 5E8KA 4JZBA 4LLSA 4NKEA 3VJ8A 3ID0A 2Z4XA 1JFAA 5IK0A 4RXAA 4DHDA 5IKAA 3V66A 5JV2F 5HN7A 1EZFA 3BNYA 1PS1A 3KBKA 4QPFA 5ERNA 3VJCA 3N1VF 2Q9YA 1N20A 5IK6A 3OABA 3V1VA 2EWGA 4OKMA 5B0LA 3NPKA 2ZEVA 5DJRF 2E8XA 4PVYF 1DI1A 4FJQA 2J1OA 1JFGA 3WCCA 1VG2A 4H5DF 4GP2A 4LA6A 3WCLA 3M02A 5IMPA 1V4HA 5JA0F 2P1CA 1UBVA 5DHKA 3WCGA 3W7FA 1YYUA 2Z78A 4LUUA 2E8WA 4NFKF 2AZKA 4XQRF 5DIQF 3WCFA 3LDWA 3KROB 1VG7A 3V1XA 4E9UA 2AEKA 4DZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXC A;  4LFE A;  5HNA A;  3KRA B;  4NKF A;  2F8C F;  2DH4 A;  4MC8 A;  4XQS F;  4RYP A;  2E91 A;  2F92 F;  5B03 A;  2ZEU A;  3OAC A;  5DGS F;  3MZV A;  3ACW A;  5B01 A;  1WY0 A;  2F9K F;  4LZ3 A;  1N1B A;  3KRF A;  3NF2 A;  1WL3 A;  4RXE A;  2ONH A;  3AE0 A;  3WCA A;  3ACY A;  4OKZ A;  1UBX A;  3PH7 A;  1FPS A;  5CG5 A;  3P5P A;  4P0X A;  4NG6 A;  4F6X A;  5B0J A;  4XQT F;  4P0V A;  3WCH A;  3TFV A;  5DJV F;  4MC3 A;  3NPR A;  1YYT A;  3ICN A;  2Z7H A;  3CP6 A;  5IN8 A;  4KPJ A;  5IKH A;  2OA6 A;  2VF6 A;  4KK2 A;  4LZC A;  3ASX A;  5IMN A;  4LTV A;  4N1Z F;  4NFJ F;  3PKO A;  5A0I A;  5ILZ A;  3TFP A;  2Z4W A;  4MC0 A;  4E9Z A;  3M00 A;  3M0G A;  2E8V A;  2E92 A;  3LG5 A;  4N9U A;  2ZCQ A;  4NUA A;  1V4E A;  3PDE A;  3WC9 A;  3B7L A;  1VG6 A;  5IL8 A;  3DYG A;  3N45 F;  5DGM F;  3WSA A;  4KWD A;  5ERM A;  2PS5 A;  2Q58 A;  1VG3 A;  5B02 A;  5ILH A;  3TS7 A;  3N5J F;  5A0J A;  1KIZ A;  4KQ5 A;  3UCA A;  3KRC B;  4Q23 A;  3TFN A;  4GA3 A;  1WKZ A;  3LVS A;  3VJB A;  3OAB B;  2Z50 A;  2E95 A;  4KQS A;  3AQB B;  4KUX A;  5DGN F;  5EAS A;  4LLT A;  3Q2Z A;  3DYH A;  3LMD A;  1N22 A;  1YYR A;  1HXA A;  5EAT A;  3S9V A;  1YYS A;  4FP4 A;  2Q80 A;  2H8O A;  3VJE A;  5HN8 A;  3LEE A;  3N0G A;  3Q1O A;  4K10 A;  3APZ A;  3PYA A;  2Z4V A;  5ERO A;  4RXC A;  2RAH A;  4H5E F;  4GP1 A;  3N5H F;  5ILY A;  1WL1 A;  3Q30 A;  5ILD A;  5ER8 A;  3KRP A;  3WJK A;  3ZCD A;  4HD1 A;  3ACX A;  4H5C F;  3LGK A;  3LJI A;  2AZL A;  2ZCO A;  2Q9Z A;  4OMH A;  1HXG A;  1YQ7 A;  2F8Z F;  3ICZ A;  1HM7 A;  4E1E A;  4LA5 A;  3OAC B;  4NFI F;  3G4F A;  3M01 A;  4DXJ A;  3WCM A;  2FTZ A;  3TC1 A;  1ZW5 A;  1V4J A;  5C05 A;  5JV1 F;  5HN9 A;  4LFV F;  5B0I A;  3EZ3 A;  3RBM A;  1YHK A;  3DYF A;  5DJP F;  5H9D A;  5CG6 A;  5IMI A;  3EFQ A;  1RQI A;  1YHL A;  1WL0 A;  5IM1 A;  3P5R A;  3M9U A;  3SDV A;  4UMJ A;  3LLW A;  3P8R A;  5JUZ F;  3WJN A;  2F7M F;  4QXS F;  5JV0 F;  3LZ9 A;  4PVX F;  2QIS A;  3N46 F;  4LZ0 A;  3RYE A;  3WEK A;  3N49 F;  2OPM A;  3WEG A;  4KQU A;  4JXN A;  4KVI A;  3ZL6 A;  5B00 A;  4DWG A;  4F62 A;  3ZMC A;  3RMG A;  5IK9 A;  4LXW A;  4L2X F;  3VJD A;  3WEF A;  4P0W A;  3WCB A;  4LIX A;  3RYW A;  2ZY1 A;  3NRI A;  1YYQ A;  1VG4 A;  2Z7I A;  1V4K A;  3SDU A;  3Q2Q A;  2PS8 A;  4KPD A;  3N0F A;  2PS7 A;  1YV5 A;  1HM4 A;  3KRC A;  2Z52 A;  2Z4Y A;  3WE9 A;  3ICK A;  3N3L F;  4DWB A;  3PYB A;  2OPN A;  1DGP A;  1UBW A;  5AEL A;  3LGZ B;  1N1Z A;  3G4D A;  4KKM A;  3WEI A;  3IPI A;  3WCD A;  4LPG F;  2AEL A;  5ILI A;  4KVD A;  3CKE A;  1N21 A;  1KIY A;  3ADZ A;  4JYX A;  2J5C A;  2E4O A;  5AFX A;  1UBY A;  3VJ9 A;  3WEJ A;  1HX9 A;  2I19 A;  3IBA A;  3P8L A;  3WCJ A;  2AZJ A;  3SDT A;  4KFA A;  1WMW A;  3N6K F;  3KRO A;  4RNQ A;  4LTZ A;  1N24 A;  4EA0 A;  3KRA A;  5DW7 A;  2J1P A;  3N1W F;  2E8T A;  5EAU A;  4JVJ F;  2PS4 A;  5AYP A;  3KRP B;  4F6V A;  1RQJ A;  2ZCS A;  3AQ0 A;  2Z4Z A;  4LPH F;  2F89 F;  5DZ2 A;  3WCI A;  5IVG A;  4KVY A;  3KRF B;  3ZOU A;  4JXY A;  3P41 A;  1WL2 A;  4JZX A;  4LFG A;  3AQC B;  3WJO A;  2OGD A;  5I1U A;  5B0K A;  3ICM A;  3WSB A;  3LOM A;  3N3D A;  2FOR A;  5A0K A;  1YHM A;  3QKC A;  2E94 A;  3VJA A;  4EA2 A;  3SDR A;  3LK5 A;  3OYR A;  3ZMB A;  2AET A;  4GAX A;  2E8U A;  4ZQ8 A;  3WEH A;  4DI5 A;  5DHI A;  2ONG A;  3SDQ A;  5ILK A;  5E8L A;  1V4I A;  5KSX F;  2F94 F;  2PS6 A;  1YJ4 A;  3EGT A;  4OMG A;  5ILJ A;  4EA1 A;  2E93 A;  3CC9 A;  5AHU B;  4OGU A;  2O1O A;  2E90 A;  3WCE A;  1N23 A;  5IL3 A;  5B0M A;  4KVW A;  4RXD A;  3KB9 A;  4WK5 A;  4LOB A;  3LSN A;  3S4J A;  2ZCR A;  3BNX A;  1RTR A;  4DEM F;  3QQV A;  3SAE A;  3MAV A;  5E8H A;  5E8K A;  4JZB A;  4LLS A;  4NKE A;  3VJ8 A;  3ID0 A;  2Z4X A;  1JFA A;  5IK0 A;  4RXA A;  4DHD A;  5IKA A;  3V66 A;  5JV2 F;  5HN7 A;  1EZF A;  3BNY A;  1PS1 A;  3KBK A;  4QPF A;  5ERN A;  3VJC A;  3N1V F;  2Q9Y A;  1N20 A;  5IK6 A;  3OAB A;  3V1V A;  2EWG A;  4OKM A;  5B0L A;  3NPK A;  2ZEV A;  5DJR F;  2E8X A;  4PVY F;  1DI1 A;  4FJQ A;  2J1O A;  1JFG A;  3WCC A;  1VG2 A;  4H5D F;  4GP2 A;  4LA6 A;  3WCL A;  3M02 A;  5IMP A;  1V4H A;  5JA0 F;  2P1C A;  1UBV A;  5DHK A;  3WCG A;  3W7F A;  1YYU A;  2Z78 A;  4LUU A;  2E8W A;  4NFK F;  2AZK A;  4XQR F;  5DIQ F;  3WCF A;  3LDW A;  3KRO B;  1VG7 A;  3V1X A;  4E9U A;  2AEK A;  4DZW A; 
#chains in the Genus database with same CATH topology
 1HXC A;  4LFE A;  5HNA A;  3KRA B;  4NKF A;  2F8C F;  2DH4 A;  4MC8 A;  4XQS F;  4RYP A;  2E91 A;  2F92 F;  5B03 A;  2ZEU A;  3OAC A;  5DGS F;  3MZV A;  3ACW A;  5B01 A;  1WY0 A;  2F9K F;  4LZ3 A;  1N1B A;  3KRF A;  3NF2 A;  1WL3 A;  4RXE A;  2ONH A;  3AE0 A;  3WCA A;  3ACY A;  4OKZ A;  1UBX A;  3PH7 A;  1FPS A;  5CG5 A;  3P5P A;  4P0X A;  4NG6 A;  4F6X A;  5B0J A;  4XQT F;  4P0V A;  3WCH A;  3TFV A;  5DJV F;  4MC3 A;  3NPR A;  1YYT A;  3ICN A;  2Z7H A;  3CP6 A;  5IN8 A;  4KPJ A;  5IKH A;  2OA6 A;  2VF6 A;  4KK2 A;  4LZC A;  3ASX A;  5IMN A;  4LTV A;  4N1Z F;  4NFJ F;  3PKO A;  5A0I A;  5ILZ A;  3TFP A;  2Z4W A;  4MC0 A;  4E9Z A;  3M00 A;  3M0G A;  2E8V A;  2E92 A;  3LG5 A;  4N9U A;  2ZCQ A;  4NUA A;  1V4E A;  3PDE A;  3WC9 A;  3B7L A;  1VG6 A;  5IL8 A;  3DYG A;  3N45 F;  5DGM F;  3WSA A;  4KWD A;  5ERM A;  2PS5 A;  2Q58 A;  1VG3 A;  5B02 A;  5ILH A;  3TS7 A;  3N5J F;  5A0J A;  1KIZ A;  4KQ5 A;  3UCA A;  3KRC B;  4Q23 A;  3TFN A;  4GA3 A;  1WKZ A;  3LVS A;  3VJB A;  3OAB B;  2Z50 A;  2E95 A;  4KQS A;  3AQB B;  4KUX A;  5DGN F;  5EAS A;  4LLT A;  3Q2Z A;  3DYH A;  3LMD A;  1N22 A;  1YYR A;  1HXA A;  5EAT A;  3S9V A;  1YYS A;  4FP4 A;  2Q80 A;  2H8O A;  3VJE A;  5HN8 A;  3LEE A;  3N0G A;  3Q1O A;  4K10 A;  3APZ A;  3PYA A;  2Z4V A;  5ERO A;  4RXC A;  2RAH A;  4H5E F;  4GP1 A;  3N5H F;  5ILY A;  1WL1 A;  3Q30 A;  5ILD A;  5ER8 A;  3KRP A;  3WJK A;  3ZCD A;  4HD1 A;  3ACX A;  4H5C F;  3LGK A;  3LJI A;  2AZL A;  2ZCO A;  2Q9Z A;  4OMH A;  1HXG A;  1YQ7 A;  2F8Z F;  3ICZ A;  1HM7 A;  4E1E A;  4LA5 A;  3OAC B;  4NFI F;  3G4F A;  3M01 A;  4DXJ A;  3WCM A;  2FTZ A;  3TC1 A;  1ZW5 A;  1V4J A;  5C05 A;  5JV1 F;  5HN9 A;  4LFV F;  5B0I A;  3EZ3 A;  3RBM A;  1YHK A;  3DYF A;  5DJP F;  5H9D A;  5CG6 A;  5IMI A;  3EFQ A;  1RQI A;  1YHL A;  1WL0 A;  5IM1 A;  3P5R A;  3M9U A;  3SDV A;  4UMJ A;  3LLW A;  3P8R A;  5JUZ F;  3WJN A;  2F7M F;  4QXS F;  5JV0 F;  3LZ9 A;  4PVX F;  2QIS A;  3N46 F;  4LZ0 A;  3RYE A;  3WEK A;  3N49 F;  2OPM A;  3WEG A;  4KQU A;  4JXN A;  4KVI A;  3ZL6 A;  5B00 A;  4DWG A;  4F62 A;  3ZMC A;  3RMG A;  5IK9 A;  4LXW A;  4L2X F;  3VJD A;  3WEF A;  4P0W A;  3WCB A;  4LIX A;  3RYW A;  2ZY1 A;  3NRI A;  1YYQ A;  1VG4 A;  2Z7I A;  1V4K A;  3SDU A;  3Q2Q A;  2PS8 A;  4KPD A;  3N0F A;  2PS7 A;  1YV5 A;  1HM4 A;  3KRC A;  2Z52 A;  2Z4Y A;  3WE9 A;  3ICK A;  3N3L F;  4DWB A;  3PYB A;  2OPN A;  1DGP A;  1UBW A;  5AEL A;  3LGZ B;  1N1Z A;  3G4D A;  4KKM A;  3WEI A;  3IPI A;  3WCD A;  4LPG F;  2AEL A;  5ILI A;  4KVD A;  3CKE A;  1N21 A;  1KIY A;  3ADZ A;  4JYX A;  2J5C A;  2E4O A;  5AFX A;  1UBY A;  3VJ9 A;  3WEJ A;  1HX9 A;  2I19 A;  3IBA A;  3P8L A;  3WCJ A;  2AZJ A;  3SDT A;  4KFA A;  1WMW A;  3N6K F;  3KRO A;  4RNQ A;  4LTZ A;  1N24 A;  4EA0 A;  3KRA A;  5DW7 A;  2J1P A;  3N1W F;  2E8T A;  5EAU A;  4JVJ F;  2PS4 A;  5AYP A;  3KRP B;  4F6V A;  1RQJ A;  2ZCS A;  3AQ0 A;  2Z4Z A;  4LPH F;  2F89 F;  5DZ2 A;  3WCI A;  5IVG A;  4KVY A;  3KRF B;  3ZOU A;  4JXY A;  3P41 A;  1WL2 A;  4JZX A;  4LFG A;  3AQC B;  3WJO A;  2OGD A;  5I1U A;  5B0K A;  3ICM A;  3WSB A;  3LOM A;  3N3D A;  2FOR A;  5A0K A;  1YHM A;  3QKC A;  2E94 A;  3VJA A;  4EA2 A;  3SDR A;  3LK5 A;  3OYR A;  3ZMB A;  2AET A;  4GAX A;  2E8U A;  4ZQ8 A;  3WEH A;  4DI5 A;  5DHI A;  2ONG A;  3SDQ A;  5ILK A;  5E8L A;  1V4I A;  5KSX F;  2F94 F;  2PS6 A;  1YJ4 A;  3EGT A;  4OMG A;  5ILJ A;  4EA1 A;  2E93 A;  3CC9 A;  5AHU B;  4OGU A;  2O1O A;  2E90 A;  3WCE A;  1N23 A;  5IL3 A;  5B0M A;  4KVW A;  4RXD A;  3KB9 A;  4WK5 A;  4LOB A;  3LSN A;  3S4J A;  2ZCR A;  3BNX A;  1RTR A;  4DEM F;  3QQV A;  3SAE A;  3MAV A;  5E8H A;  5E8K A;  4JZB A;  4LLS A;  4NKE A;  3VJ8 A;  3ID0 A;  2Z4X A;  1JFA A;  5IK0 A;  4RXA A;  4DHD A;  5IKA A;  3V66 A;  5JV2 F;  5HN7 A;  1EZF A;  3BNY A;  1PS1 A;  3KBK A;  4QPF A;  5ERN A;  3VJC A;  3N1V F;  2Q9Y A;  1N20 A;  5IK6 A;  3OAB A;  3V1V A;  2EWG A;  4OKM A;  5B0L A;  3NPK A;  2ZEV A;  5DJR F;  2E8X A;  4PVY F;  1DI1 A;  4FJQ A;  2J1O A;  1JFG A;  3WCC A;  1VG2 A;  4H5D F;  4GP2 A;  4LA6 A;  3WCL A;  3M02 A;  5IMP A;  1V4H A;  5JA0 F;  2P1C A;  1UBV A;  5DHK A;  3WCG A;  3W7F A;  1YYU A;  2Z78 A;  4LUU A;  2E8W A;  4NFK F;  2AZK A;  4XQR F;  5DIQ F;  3WCF A;  3LDW A;  3KRO B;  1VG7 A;  3V1X A;  4E9U A;  2AEK A;  4DZW A; 
#chains in the Genus database with same CATH homology
 1HXC A;  4LFE A;  5HNA A;  3KRA B;  4NKF A;  2F8C F;  2DH4 A;  4MC8 A;  4XQS F;  4RYP A;  2E91 A;  2F92 F;  5B03 A;  2ZEU A;  3OAC A;  5DGS F;  3MZV A;  3ACW A;  5B01 A;  1WY0 A;  2F9K F;  4LZ3 A;  1N1B A;  3KRF A;  3NF2 A;  1WL3 A;  4RXE A;  2ONH A;  3AE0 A;  3WCA A;  3ACY A;  4OKZ A;  1UBX A;  3PH7 A;  1FPS A;  5CG5 A;  3P5P A;  4P0X A;  4NG6 A;  4F6X A;  5B0J A;  4XQT F;  4P0V A;  3WCH A;  3TFV A;  5DJV F;  4MC3 A;  3NPR A;  1YYT A;  3ICN A;  2Z7H A;  3CP6 A;  5IN8 A;  4KPJ A;  5IKH A;  2OA6 A;  2VF6 A;  4KK2 A;  4LZC A;  3ASX A;  5IMN A;  4LTV A;  4N1Z F;  4NFJ F;  3PKO A;  5A0I A;  5ILZ A;  3TFP A;  2Z4W A;  4MC0 A;  4E9Z A;  3M00 A;  3M0G A;  2E8V A;  2E92 A;  3LG5 A;  4N9U A;  2ZCQ A;  4NUA A;  1V4E A;  3PDE A;  3WC9 A;  3B7L A;  1VG6 A;  5IL8 A;  3DYG A;  3N45 F;  5DGM F;  3WSA A;  4KWD A;  5ERM A;  2PS5 A;  2Q58 A;  1VG3 A;  5B02 A;  5ILH A;  3TS7 A;  3N5J F;  5A0J A;  1KIZ A;  4KQ5 A;  3UCA A;  3KRC B;  4Q23 A;  3TFN A;  4GA3 A;  1WKZ A;  3LVS A;  3VJB A;  3OAB B;  2Z50 A;  2E95 A;  4KQS A;  3AQB B;  4KUX A;  5DGN F;  5EAS A;  4LLT A;  3Q2Z A;  3DYH A;  3LMD A;  1N22 A;  1YYR A;  1HXA A;  5EAT A;  3S9V A;  1YYS A;  4FP4 A;  2Q80 A;  2H8O A;  3VJE A;  5HN8 A;  3LEE A;  3N0G A;  3Q1O A;  4K10 A;  3APZ A;  3PYA A;  2Z4V A;  5ERO A;  4RXC A;  2RAH A;  4H5E F;  4GP1 A;  3N5H F;  5ILY A;  1WL1 A;  3Q30 A;  5ILD A;  5ER8 A;  3KRP A;  3WJK A;  3ZCD A;  4HD1 A;  3ACX A;  4H5C F;  3LGK A;  3LJI A;  2AZL A;  2ZCO A;  2Q9Z A;  4OMH A;  1HXG A;  1YQ7 A;  2F8Z F;  3ICZ A;  1HM7 A;  4E1E A;  4LA5 A;  3OAC B;  4NFI F;  3G4F A;  3M01 A;  4DXJ A;  3WCM A;  2FTZ A;  3TC1 A;  1ZW5 A;  1V4J A;  5C05 A;  5JV1 F;  5HN9 A;  4LFV F;  5B0I A;  3EZ3 A;  3RBM A;  1YHK A;  3DYF A;  5DJP F;  5H9D A;  5CG6 A;  5IMI A;  3EFQ A;  1RQI A;  1YHL A;  1WL0 A;  5IM1 A;  3P5R A;  3M9U A;  3SDV A;  4UMJ A;  3LLW A;  3P8R A;  5JUZ F;  3WJN A;  2F7M F;  4QXS F;  5JV0 F;  3LZ9 A;  4PVX F;  2QIS A;  3N46 F;  4LZ0 A;  3RYE A;  3WEK A;  3N49 F;  2OPM A;  3WEG A;  4KQU A;  4JXN A;  4KVI A;  3ZL6 A;  5B00 A;  4DWG A;  4F62 A;  3ZMC A;  3RMG A;  5IK9 A;  4LXW A;  4L2X F;  3VJD A;  3WEF A;  4P0W A;  3WCB A;  4LIX A;  3RYW A;  2ZY1 A;  3NRI A;  1YYQ A;  1VG4 A;  2Z7I A;  1V4K A;  3SDU A;  3Q2Q A;  2PS8 A;  4KPD A;  3N0F A;  2PS7 A;  1YV5 A;  1HM4 A;  3KRC A;  2Z52 A;  2Z4Y A;  3WE9 A;  3ICK A;  3N3L F;  4DWB A;  3PYB A;  2OPN A;  1DGP A;  1UBW A;  5AEL A;  3LGZ B;  1N1Z A;  3G4D A;  4KKM A;  3WEI A;  3IPI A;  3WCD A;  4LPG F;  2AEL A;  5ILI A;  4KVD A;  3CKE A;  1N21 A;  1KIY A;  3ADZ A;  4JYX A;  2J5C A;  2E4O A;  5AFX A;  1UBY A;  3VJ9 A;  3WEJ A;  1HX9 A;  2I19 A;  3IBA A;  3P8L A;  3WCJ A;  2AZJ A;  3SDT A;  4KFA A;  1WMW A;  3N6K F;  3KRO A;  4RNQ A;  4LTZ A;  1N24 A;  4EA0 A;  3KRA A;  5DW7 A;  2J1P A;  3N1W F;  2E8T A;  5EAU A;  4JVJ F;  2PS4 A;  5AYP A;  3KRP B;  4F6V A;  1RQJ A;  2ZCS A;  3AQ0 A;  2Z4Z A;  4LPH F;  2F89 F;  5DZ2 A;  3WCI A;  5IVG A;  4KVY A;  3KRF B;  3ZOU A;  4JXY A;  3P41 A;  1WL2 A;  4JZX A;  4LFG A;  3AQC B;  3WJO A;  2OGD A;  5I1U A;  5B0K A;  3ICM A;  3WSB A;  3LOM A;  3N3D A;  2FOR A;  5A0K A;  1YHM A;  3QKC A;  2E94 A;  3VJA A;  4EA2 A;  3SDR A;  3LK5 A;  3OYR A;  3ZMB A;  2AET A;  4GAX A;  2E8U A;  4ZQ8 A;  3WEH A;  4DI5 A;  5DHI A;  2ONG A;  3SDQ A;  5ILK A;  5E8L A;  1V4I A;  5KSX F;  2F94 F;  2PS6 A;  1YJ4 A;  3EGT A;  4OMG A;  5ILJ A;  4EA1 A;  2E93 A;  3CC9 A;  5AHU B;  4OGU A;  2O1O A;  2E90 A;  3WCE A;  1N23 A;  5IL3 A;  5B0M A;  4KVW A;  4RXD A;  3KB9 A;  4WK5 A;  4LOB A;  3LSN A;  3S4J A;  2ZCR A;  3BNX A;  1RTR A;  4DEM F;  3QQV A;  3SAE A;  3MAV A;  5E8H A;  5E8K A;  4JZB A;  4LLS A;  4NKE A;  3VJ8 A;  3ID0 A;  2Z4X A;  1JFA A;  5IK0 A;  4RXA A;  4DHD A;  5IKA A;  3V66 A;  5JV2 F;  5HN7 A;  1EZF A;  3BNY A;  1PS1 A;  3KBK A;  4QPF A;  5ERN A;  3VJC A;  3N1V F;  2Q9Y A;  1N20 A;  5IK6 A;  3OAB A;  3V1V A;  2EWG A;  4OKM A;  5B0L A;  3NPK A;  2ZEV A;  5DJR F;  2E8X A;  4PVY F;  1DI1 A;  4FJQ A;  2J1O A;  1JFG A;  3WCC A;  1VG2 A;  4H5D F;  4GP2 A;  4LA6 A;  3WCL A;  3M02 A;  5IMP A;  1V4H A;  5JA0 F;  2P1C A;  1UBV A;  5DHK A;  3WCG A;  3W7F A;  1YYU A;  2Z78 A;  4LUU A;  2E8W A;  4NFK F;  2AZK A;  4XQR F;  5DIQ F;  3WCF A;  3LDW A;  3KRO B;  1VG7 A;  3V1X A;  4E9U A;  2AEK A;  4DZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...