3KBKA

Epi-isozizaene synthase complexed with hg
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
323
structure length
305
Chain Sequence
VPPSLRLPVIEAAFPRQLHPYWPKLQETTRTWLLEKRLMPADKVEEYADGLCYTDLMAGYYLGAPDEVLQAIADYSAWFFVWDDRHDRDIVHGRAGAWRRLRGLLHTALDSPGDHLHHEDTLVAGFADSVRRLYAFLPATWNARFARHFHTVIEAYDREFHNRTRGIVPGEEYLELRRLTFAHWIWTDLLEPSSGCELPDAVRKHPAYRRAALLSQEFAAWYNDLCSLPKEIATLEEAIGEVRRRVEECITEFLAVERDALRFADELADGTVRGKELSGAVRANVGNMRNWFSSVYWFHHESGRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Epi-isozizaene synthase
publication title Structure of Epi-Isozizaene Synthase from Streptomyces coelicolor A3(2), a Platform for New Terpenoid Cyclization Templates
pubmed doi rcsb
source organism Streptomyces coelicolor
total genus 139
structure length 305
sequence length 323
ec nomenclature ec 4.2.3.37: Epi-isozizaene synthase.
pdb deposition date 2009-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3kbkA00
3WSAA 3ZMBA 4JVJF 4NKFA 5DJVF 4KVDA 5IL3A 2F7MF 2J5CA 2J1OA 4KQ5A 3N5HF 2E92A 4LZ3A 4MC3A 4PVXF 5B0MA 5E8HA 2ZCSA 2AELA 1UBVA 4LOBA 4E1EA 2VF6A 2OGDA 3OABA 5HN8A 2F89F 3P8RA 2Q58A 5CG6A 4DI5A 1V4JA 3BNYA 3WCLA 3KRCB 2ZY1A 5IK9A 3N1WF 1YHMA 3AQBB 3P5RA 3KRFB 4F6VA 3LSNA 3AQ0A 5ER8A 1FPSA 5DGSF 3WCIA 3LLWA 4GP1A 3NPKA 3N0FA 4JZXA 4DWBA 3WCCA 3M0GA 4NUAA 4P0WA 3M02A 3WJNA 1YJ4A 2Z4YA 2O1OA 3IBAA 4KQUA 5E8KA 3ACWA 3LZ9A 1VG7A 5C05A 1N22A 4MC0A 1V4IA 5IVGA 5AELA 2E4OA 3Q2ZA 4DXJA 3SDTA 2ZCOA 1YYSA 2Z50A 3TFPA 3MZVA 5IN8A 3TFNA 1YYRA 4NKEA 4N9UA 3SDVA 3QQVA 4JYXA 3WSBA 3WCMA 1HXGA 5KSXF 4LFGA 1WMWA 5ILYA 1RTRA 3LOMA 3WE9A 2Z52A 4JZBA 2RAHA 1VG4A 3KRCA 1N24A 4JXNA 3KRFA 3W7FA 3WCJA 3WJOA 5DGMF 3LVSA 5ILDA 5IMPA 5JUZF 5B0LA 4DEMF 1YQ7A 4KFAA 3OACB 3PYBA 2E8VA 5A0KA 3M9UA 4KVIA 3QKCA 2Q9YA 3PYAA 4MC8A 3LG5A 3WEJA 1WKZA 5DHKA 5CG5A 1WL2A 5H9DA 1N21A 3N1VF 4KPJA 4LUUA 3Q30A 3VJCA 2P1CA 4HD1A 2E95A 3MAVA 3CC9A 3P5PA 5B03A 4LXWA 4LPHF 4NG6A 3ICKA 4NFJF 5JA0F 2F92F 1YYUA 3UCAA 1N23A 4OMGA 5DJRF 4LIXA 5IMNA 3TC1A 5I1UA 5AYPA 5B00A 2OA6A 4KWDA 1YV5A 4FJQA 2FORA 4XQRF 1RQJA 4FP4A 4DWGA 3RYWA 5HN7A 4LFVF 2E8UA 1VG6A 2ONHA 3N3DA 2AZKA 4PVYF 5DIQF 3P8LA 2AZLA 4RXAA 4NFIF 3WC9A 2QISA 5JV2F 3IPIA 3WEHA 5B0JA 4WK5A 3KBKA 3VJBA 1DGPA 3OACA 3RYEA 4KKMA 3DYGA 2I19A 5DJPF 3S4JA 3NF2A 4DZWA 3ASXA 1UBXA 4LLTA 5IMIA 1KIYA 3LMDA 4RNQA 3DYHA 1WY0A 1V4HA 5IK0A 3ICNA 5IKAA 1VG3A 2Z4WA 2PS7A 5DGNF 2E8TA 4LTVA 4XQSF 4H5DF 1DI1A 3WCHA 3KROB 4KUXA 3KRPB 3VJ9A 1N20A 5DW7A 3WCGA 4L2XF 3LDWA 3ID0A 4KVYA 1YYTA 2ZEUA 5ILIA 3APZA 3B7LA 3LGKA 3N6KF 4JXYA 1JFGA 5B0IA 2F94F 3ZL6A 3LK5A 3OYRA 3N45F 4LA6A 3LEEA 4KQSA 2Q80A 4E9ZA 5IM1A 3M01A 1JFAA 2ONGA 5IKHA 3WCDA 2PS8A 2J1PA 5ERNA 3TS7A 3TFVA 4H5EF 3NPRA 3SDQA 4LZCA 3AQCB 5B0KA 1YHLA 1HM4A 4LA5A 4GP2A 3NRIA 5JV0F 2FTZA 3ZMCA 4GA3A 3WCAA 4DHDA 4N1ZF 5AFXA 4KPDA 5A0IA 3EFQA 2E93A 1WL0A 1EZFA 4LFEA 1N1ZA 3ZCDA 3KROA 3VJEA 5EASA 3KRPA 5B01A 5AHUB 3V66A 1YYQA 3P41A 2PS5A 2AZJA 4LTZA 3WEGA 3CKEA 3VJ8A 2F8CF 2Z4ZA 2E8WA 3N49F 4QPFA 1PS1A 2Z7IA 1UBYA 2Q9ZA 3PDEA 2OPNA 3WEFA 3G4DA 3KRAB 3LJIA 2E8XA 3ACYA 2EWGA 4RYPA 4NFKF 4EA1A 3VJDA 3V1VA 2F8ZF 5HN9A 3ICMA 4KK2A 4EA0A 3RBMA 4ZQ8A 3PH7A 3VJAA 4E9UA 4LPGF 4RXCA 4RXDA 3N46F 5E8LA 3WCFA 4OKZA 2E91A 5IK6A 1UBWA 1HXCA 5EATA 3AE0A 4QXSF 3WEKA 3N3LF 5EAUA 4UMJA 4K10A 4RXEA 4P0VA 4OKMA 3RMGA 3ACXA 2F9KF 2AETA 4F6XA 2Z7HA 1ZW5A 1RQIA 3KB9A 3WCEA 4F62A 4EA2A 5DHIA 5EROA 5ILJA 3ADZA 5B02A 3WEIA 3ZOUA 1HXAA 1VG2A 4H5CF 4LZ0A 1HX9A 3SDUA 2PS6A 3G4FA 5DZ2A 5ILHA 4LLSA 3ICZA 5A0JA 3KRAA 3OABB 3V1XA 4OMHA 1WL3A 3EZ3A 5ILKA 3WJKA 2Z78A 5JV1F 5HNAA 3EGTA 3WCBA 1YHKA 4OGUA 2ZEVA 3N5JF 1V4KA 2DH4A 1N1BA 3BNXA 4XQTF 3PKOA 2H8OA 3N0GA 4KVWA 3DYFA 1KIZA 2PS4A 3Q2QA 3SAEA 3Q1OA 2ZCRA 2OPMA 2E94A 4P0XA 4Q23A 1WL1A 2E90A 4GAXA 5IL8A 2Z4XA 3SDRA 2Z4VA 3M00A 5ERMA 3CP6A 3S9VA 1HM7A 2AEKA 2ZCQA 1V4EA 3LGZB 5ILZA
chains in the Genus database with same CATH superfamily
3WSAA 3ZMBA 4JVJF 4NKFA 5DJVF 4KVDA 5IL3A 2F7MF 2J5CA 2J1OA 4KQ5A 3N5HF 2E92A 4LZ3A 4MC3A 4PVXF 5B0MA 5E8HA 2ZCSA 2AELA 1UBVA 4LOBA 4E1EA 2VF6A 2OGDA 3OABA 5HN8A 2F89F 3P8RA 2Q58A 5CG6A 4DI5A 1V4JA 3BNYA 3WCLA 3KRCB 2ZY1A 5IK9A 3N1WF 1YHMA 3AQBB 3P5RA 3KRFB 4F6VA 3LSNA 3AQ0A 5ER8A 1FPSA 5DGSF 3WCIA 3LLWA 4GP1A 3NPKA 3N0FA 4JZXA 4DWBA 3WCCA 3M0GA 4NUAA 4P0WA 3M02A 3WJNA 1YJ4A 2Z4YA 2O1OA 3IBAA 4KQUA 5E8KA 3ACWA 3LZ9A 1VG7A 5C05A 1N22A 4MC0A 1V4IA 5IVGA 5AELA 2E4OA 3Q2ZA 4DXJA 3SDTA 2ZCOA 1YYSA 2Z50A 3TFPA 3MZVA 5IN8A 3TFNA 1YYRA 4NKEA 4N9UA 3SDVA 3QQVA 4JYXA 3WSBA 3WCMA 1HXGA 5KSXF 4LFGA 1WMWA 5ILYA 1RTRA 3LOMA 3WE9A 2Z52A 4JZBA 2RAHA 1VG4A 3KRCA 1N24A 4JXNA 3KRFA 3W7FA 3WCJA 3WJOA 5DGMF 3LVSA 5ILDA 5IMPA 5JUZF 5B0LA 4DEMF 1YQ7A 4KFAA 3OACB 3PYBA 2E8VA 5A0KA 3M9UA 4KVIA 3QKCA 2Q9YA 3PYAA 4MC8A 3LG5A 3WEJA 1WKZA 5DHKA 5CG5A 1WL2A 5H9DA 1N21A 3N1VF 4KPJA 4LUUA 3Q30A 3VJCA 2P1CA 4HD1A 2E95A 3MAVA 3CC9A 3P5PA 5B03A 4LXWA 4LPHF 4NG6A 3ICKA 4NFJF 5JA0F 2F92F 1YYUA 3UCAA 1N23A 4OMGA 5DJRF 4LIXA 5IMNA 3TC1A 5I1UA 5AYPA 5B00A 2OA6A 4KWDA 1YV5A 4FJQA 2FORA 4XQRF 1RQJA 4FP4A 4DWGA 3RYWA 5HN7A 4LFVF 2E8UA 1VG6A 2ONHA 3N3DA 2AZKA 4PVYF 5DIQF 3P8LA 2AZLA 4RXAA 4NFIF 3WC9A 2QISA 5JV2F 3IPIA 3WEHA 5B0JA 4WK5A 3KBKA 3VJBA 1DGPA 3OACA 3RYEA 4KKMA 3DYGA 2I19A 5DJPF 3S4JA 3NF2A 4DZWA 3ASXA 1UBXA 4LLTA 5IMIA 1KIYA 3LMDA 4RNQA 3DYHA 1WY0A 1V4HA 5IK0A 3ICNA 5IKAA 1VG3A 2Z4WA 2PS7A 5DGNF 2E8TA 4LTVA 4XQSF 4H5DF 1DI1A 3WCHA 3KROB 4KUXA 3KRPB 3VJ9A 1N20A 5DW7A 3WCGA 4L2XF 3LDWA 3ID0A 4KVYA 1YYTA 2ZEUA 5ILIA 3APZA 3B7LA 3LGKA 3N6KF 4JXYA 1JFGA 5B0IA 2F94F 3ZL6A 3LK5A 3OYRA 3N45F 4LA6A 3LEEA 4KQSA 2Q80A 4E9ZA 5IM1A 3M01A 1JFAA 2ONGA 5IKHA 3WCDA 2PS8A 2J1PA 5ERNA 3TS7A 3TFVA 4H5EF 3NPRA 3SDQA 4LZCA 3AQCB 5B0KA 1YHLA 1HM4A 4LA5A 4GP2A 3NRIA 5JV0F 2FTZA 3ZMCA 4GA3A 3WCAA 4DHDA 4N1ZF 5AFXA 4KPDA 5A0IA 3EFQA 2E93A 1WL0A 1EZFA 4LFEA 1N1ZA 3ZCDA 3KROA 3VJEA 5EASA 3KRPA 5B01A 5AHUB 3V66A 1YYQA 3P41A 2PS5A 2AZJA 4LTZA 3WEGA 3CKEA 3VJ8A 2F8CF 2Z4ZA 2E8WA 3N49F 4QPFA 1PS1A 2Z7IA 1UBYA 2Q9ZA 3PDEA 2OPNA 3WEFA 3G4DA 3KRAB 3LJIA 2E8XA 3ACYA 2EWGA 4RYPA 4NFKF 4EA1A 3VJDA 3V1VA 2F8ZF 5HN9A 3ICMA 4KK2A 4EA0A 3RBMA 4ZQ8A 3PH7A 3VJAA 4E9UA 4LPGF 4RXCA 4RXDA 3N46F 5E8LA 3WCFA 4OKZA 2E91A 5IK6A 1UBWA 1HXCA 5EATA 3AE0A 4QXSF 3WEKA 3N3LF 5EAUA 4UMJA 4K10A 4RXEA 4P0VA 4OKMA 3RMGA 3ACXA 2F9KF 2AETA 4F6XA 2Z7HA 1ZW5A 1RQIA 3KB9A 3WCEA 4F62A 4EA2A 5DHIA 5EROA 5ILJA 3ADZA 5B02A 3WEIA 3ZOUA 1HXAA 1VG2A 4H5CF 4LZ0A 1HX9A 3SDUA 2PS6A 3G4FA 5DZ2A 5ILHA 4LLSA 3ICZA 5A0JA 3KRAA 3OABB 3V1XA 4OMHA 1WL3A 3EZ3A 5ILKA 3WJKA 2Z78A 5JV1F 5HNAA 3EGTA 3WCBA 1YHKA 4OGUA 2ZEVA 3N5JF 1V4KA 2DH4A 1N1BA 3BNXA 4XQTF 3PKOA 2H8OA 3N0GA 4KVWA 3DYFA 1KIZA 2PS4A 3Q2QA 3SAEA 3Q1OA 2ZCRA 2OPMA 2E94A 4P0XA 4Q23A 1WL1A 2E90A 4GAXA 5IL8A 2Z4XA 3SDRA 2Z4VA 3M00A 5ERMA 3CP6A 3S9VA 1HM7A 2AEKA 2ZCQA 1V4EA 3LGZB 5ILZA
chains in the Genus database with same CATH topology
3WSAA 3ZMBA 4JVJF 4NKFA 5DJVF 4KVDA 5IL3A 2F7MF 2J5CA 2J1OA 4KQ5A 3N5HF 2E92A 4LZ3A 4MC3A 4PVXF 5B0MA 5E8HA 2ZCSA 2AELA 1UBVA 4LOBA 4E1EA 2VF6A 2OGDA 3OABA 5HN8A 2F89F 3P8RA 2Q58A 5CG6A 4DI5A 1V4JA 3BNYA 3WCLA 3KRCB 2ZY1A 5IK9A 3N1WF 1YHMA 3AQBB 3P5RA 3KRFB 4F6VA 3LSNA 3AQ0A 5ER8A 1FPSA 5DGSF 3WCIA 3LLWA 4GP1A 3NPKA 3N0FA 4JZXA 4DWBA 3WCCA 3M0GA 4NUAA 4P0WA 3M02A 3WJNA 1YJ4A 2Z4YA 2O1OA 3IBAA 4KQUA 5E8KA 3ACWA 3LZ9A 1VG7A 5C05A 1N22A 4MC0A 1V4IA 5IVGA 5AELA 2E4OA 3Q2ZA 4DXJA 3SDTA 2ZCOA 1YYSA 2Z50A 3TFPA 3MZVA 5IN8A 3TFNA 1YYRA 4NKEA 4N9UA 3SDVA 3QQVA 4JYXA 3WSBA 3WCMA 1HXGA 5KSXF 4LFGA 1WMWA 5ILYA 1RTRA 3LOMA 3WE9A 2Z52A 4JZBA 2RAHA 1VG4A 3KRCA 1N24A 4JXNA 3KRFA 3W7FA 3WCJA 3WJOA 5DGMF 3LVSA 5ILDA 5IMPA 5JUZF 5B0LA 4DEMF 1YQ7A 4KFAA 3OACB 3PYBA 2E8VA 5A0KA 3M9UA 4KVIA 3QKCA 2Q9YA 3PYAA 4MC8A 3LG5A 3WEJA 1WKZA 5DHKA 5CG5A 1WL2A 5H9DA 1N21A 3N1VF 4KPJA 4LUUA 3Q30A 3VJCA 2P1CA 4HD1A 2E95A 3MAVA 3CC9A 3P5PA 5B03A 4LXWA 4LPHF 4NG6A 3ICKA 4NFJF 5JA0F 2F92F 1YYUA 3UCAA 1N23A 4OMGA 5DJRF 4LIXA 5IMNA 3TC1A 5I1UA 5AYPA 5B00A 2OA6A 4KWDA 1YV5A 4FJQA 2FORA 4XQRF 1RQJA 4FP4A 4DWGA 3RYWA 5HN7A 4LFVF 2E8UA 1VG6A 2ONHA 3N3DA 2AZKA 4PVYF 5DIQF 3P8LA 2AZLA 4RXAA 4NFIF 3WC9A 2QISA 5JV2F 3IPIA 3WEHA 5B0JA 4WK5A 3KBKA 3VJBA 1DGPA 3OACA 3RYEA 4KKMA 3DYGA 2I19A 5DJPF 3S4JA 3NF2A 4DZWA 3ASXA 1UBXA 4LLTA 5IMIA 1KIYA 3LMDA 4RNQA 3DYHA 1WY0A 1V4HA 5IK0A 3ICNA 5IKAA 1VG3A 2Z4WA 2PS7A 5DGNF 2E8TA 4LTVA 4XQSF 4H5DF 1DI1A 3WCHA 3KROB 4KUXA 3KRPB 3VJ9A 1N20A 5DW7A 3WCGA 4L2XF 3LDWA 3ID0A 4KVYA 1YYTA 2ZEUA 5ILIA 3APZA 3B7LA 3LGKA 3N6KF 4JXYA 1JFGA 5B0IA 2F94F 3ZL6A 3LK5A 3OYRA 3N45F 4LA6A 3LEEA 4KQSA 2Q80A 4E9ZA 5IM1A 3M01A 1JFAA 2ONGA 5IKHA 3WCDA 2PS8A 2J1PA 5ERNA 3TS7A 3TFVA 4H5EF 3NPRA 3SDQA 4LZCA 3AQCB 5B0KA 1YHLA 1HM4A 4LA5A 4GP2A 3NRIA 5JV0F 2FTZA 3ZMCA 4GA3A 3WCAA 4DHDA 4N1ZF 5AFXA 4KPDA 5A0IA 3EFQA 2E93A 1WL0A 1EZFA 4LFEA 1N1ZA 3ZCDA 3KROA 3VJEA 5EASA 3KRPA 5B01A 5AHUB 3V66A 1YYQA 3P41A 2PS5A 2AZJA 4LTZA 3WEGA 3CKEA 3VJ8A 2F8CF 2Z4ZA 2E8WA 3N49F 4QPFA 1PS1A 2Z7IA 1UBYA 2Q9ZA 3PDEA 2OPNA 3WEFA 3G4DA 3KRAB 3LJIA 2E8XA 3ACYA 2EWGA 4RYPA 4NFKF 4EA1A 3VJDA 3V1VA 2F8ZF 5HN9A 3ICMA 4KK2A 4EA0A 3RBMA 4ZQ8A 3PH7A 3VJAA 4E9UA 4LPGF 4RXCA 4RXDA 3N46F 5E8LA 3WCFA 4OKZA 2E91A 5IK6A 1UBWA 1HXCA 5EATA 3AE0A 4QXSF 3WEKA 3N3LF 5EAUA 4UMJA 4K10A 4RXEA 4P0VA 4OKMA 3RMGA 3ACXA 2F9KF 2AETA 4F6XA 2Z7HA 1ZW5A 1RQIA 3KB9A 3WCEA 4F62A 4EA2A 5DHIA 5EROA 5ILJA 3ADZA 5B02A 3WEIA 3ZOUA 1HXAA 1VG2A 4H5CF 4LZ0A 1HX9A 3SDUA 2PS6A 3G4FA 5DZ2A 5ILHA 4LLSA 3ICZA 5A0JA 3KRAA 3OABB 3V1XA 4OMHA 1WL3A 3EZ3A 5ILKA 3WJKA 2Z78A 5JV1F 5HNAA 3EGTA 3WCBA 1YHKA 4OGUA 2ZEVA 3N5JF 1V4KA 2DH4A 1N1BA 3BNXA 4XQTF 3PKOA 2H8OA 3N0GA 4KVWA 3DYFA 1KIZA 2PS4A 3Q2QA 3SAEA 3Q1OA 2ZCRA 2OPMA 2E94A 4P0XA 4Q23A 1WL1A 2E90A 4GAXA 5IL8A 2Z4XA 3SDRA 2Z4VA 3M00A 5ERMA 3CP6A 3S9VA 1HM7A 2AEKA 2ZCQA 1V4EA 3LGZB 5ILZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WSA A;  3ZMB A;  4JVJ F;  4NKF A;  5DJV F;  4KVD A;  5IL3 A;  2F7M F;  2J5C A;  2J1O A;  4KQ5 A;  3N5H F;  2E92 A;  4LZ3 A;  4MC3 A;  4PVX F;  5B0M A;  5E8H A;  2ZCS A;  2AEL A;  1UBV A;  4LOB A;  4E1E A;  2VF6 A;  2OGD A;  3OAB A;  5HN8 A;  2F89 F;  3P8R A;  2Q58 A;  5CG6 A;  4DI5 A;  1V4J A;  3BNY A;  3WCL A;  3KRC B;  2ZY1 A;  5IK9 A;  3N1W F;  1YHM A;  3AQB B;  3P5R A;  3KRF B;  4F6V A;  3LSN A;  3AQ0 A;  5ER8 A;  1FPS A;  5DGS F;  3WCI A;  3LLW A;  4GP1 A;  3NPK A;  3N0F A;  4JZX A;  4DWB A;  3WCC A;  3M0G A;  4NUA A;  4P0W A;  3M02 A;  3WJN A;  1YJ4 A;  2Z4Y A;  2O1O A;  3IBA A;  4KQU A;  5E8K A;  3ACW A;  3LZ9 A;  1VG7 A;  5C05 A;  1N22 A;  4MC0 A;  1V4I A;  5IVG A;  5AEL A;  2E4O A;  3Q2Z A;  4DXJ A;  3SDT A;  2ZCO A;  1YYS A;  2Z50 A;  3TFP A;  3MZV A;  5IN8 A;  3TFN A;  1YYR A;  4NKE A;  4N9U A;  3SDV A;  3QQV A;  4JYX A;  3WSB A;  3WCM A;  1HXG A;  5KSX F;  4LFG A;  1WMW A;  5ILY A;  1RTR A;  3LOM A;  3WE9 A;  2Z52 A;  4JZB A;  2RAH A;  1VG4 A;  3KRC A;  1N24 A;  4JXN A;  3KRF A;  3W7F A;  3WCJ A;  3WJO A;  5DGM F;  3LVS A;  5ILD A;  5IMP A;  5JUZ F;  5B0L A;  4DEM F;  1YQ7 A;  4KFA A;  3OAC B;  3PYB A;  2E8V A;  5A0K A;  3M9U A;  4KVI A;  3QKC A;  2Q9Y A;  3PYA A;  4MC8 A;  3LG5 A;  3WEJ A;  1WKZ A;  5DHK A;  5CG5 A;  1WL2 A;  5H9D A;  1N21 A;  3N1V F;  4KPJ A;  4LUU A;  3Q30 A;  3VJC A;  2P1C A;  4HD1 A;  2E95 A;  3MAV A;  3CC9 A;  3P5P A;  5B03 A;  4LXW A;  4LPH F;  4NG6 A;  3ICK A;  4NFJ F;  5JA0 F;  2F92 F;  1YYU A;  3UCA A;  1N23 A;  4OMG A;  5DJR F;  4LIX A;  5IMN A;  3TC1 A;  5I1U A;  5AYP A;  5B00 A;  2OA6 A;  4KWD A;  1YV5 A;  4FJQ A;  2FOR A;  4XQR F;  1RQJ A;  4FP4 A;  4DWG A;  3RYW A;  5HN7 A;  4LFV F;  2E8U A;  1VG6 A;  2ONH A;  3N3D A;  2AZK A;  4PVY F;  5DIQ F;  3P8L A;  2AZL A;  4RXA A;  4NFI F;  3WC9 A;  2QIS A;  5JV2 F;  3IPI A;  3WEH A;  5B0J A;  4WK5 A;  3KBK A;  3VJB A;  1DGP A;  3OAC A;  3RYE A;  4KKM A;  3DYG A;  2I19 A;  5DJP F;  3S4J A;  3NF2 A;  4DZW A;  3ASX A;  1UBX A;  4LLT A;  5IMI A;  1KIY A;  3LMD A;  4RNQ A;  3DYH A;  1WY0 A;  1V4H A;  5IK0 A;  3ICN A;  5IKA A;  1VG3 A;  2Z4W A;  2PS7 A;  5DGN F;  2E8T A;  4LTV A;  4XQS F;  4H5D F;  1DI1 A;  3WCH A;  3KRO B;  4KUX A;  3KRP B;  3VJ9 A;  1N20 A;  5DW7 A;  3WCG A;  4L2X F;  3LDW A;  3ID0 A;  4KVY A;  1YYT A;  2ZEU A;  5ILI A;  3APZ A;  3B7L A;  3LGK A;  3N6K F;  4JXY A;  1JFG A;  5B0I A;  2F94 F;  3ZL6 A;  3LK5 A;  3OYR A;  3N45 F;  4LA6 A;  3LEE A;  4KQS A;  2Q80 A;  4E9Z A;  5IM1 A;  3M01 A;  1JFA A;  2ONG A;  5IKH A;  3WCD A;  2PS8 A;  2J1P A;  5ERN A;  3TS7 A;  3TFV A;  4H5E F;  3NPR A;  3SDQ A;  4LZC A;  3AQC B;  5B0K A;  1YHL A;  1HM4 A;  4LA5 A;  4GP2 A;  3NRI A;  5JV0 F;  2FTZ A;  3ZMC A;  4GA3 A;  3WCA A;  4DHD A;  4N1Z F;  5AFX A;  4KPD A;  5A0I A;  3EFQ A;  2E93 A;  1WL0 A;  1EZF A;  4LFE A;  1N1Z A;  3ZCD A;  3KRO A;  3VJE A;  5EAS A;  3KRP A;  5B01 A;  5AHU B;  3V66 A;  1YYQ A;  3P41 A;  2PS5 A;  2AZJ A;  4LTZ A;  3WEG A;  3CKE A;  3VJ8 A;  2F8C F;  2Z4Z A;  2E8W A;  3N49 F;  4QPF A;  1PS1 A;  2Z7I A;  1UBY A;  2Q9Z A;  3PDE A;  2OPN A;  3WEF A;  3G4D A;  3KRA B;  3LJI A;  2E8X A;  3ACY A;  2EWG A;  4RYP A;  4NFK F;  4EA1 A;  3VJD A;  3V1V A;  2F8Z F;  5HN9 A;  3ICM A;  4KK2 A;  4EA0 A;  3RBM A;  4ZQ8 A;  3PH7 A;  3VJA A;  4E9U A;  4LPG F;  4RXC A;  4RXD A;  3N46 F;  5E8L A;  3WCF A;  4OKZ A;  2E91 A;  5IK6 A;  1UBW A;  1HXC A;  5EAT A;  3AE0 A;  4QXS F;  3WEK A;  3N3L F;  5EAU A;  4UMJ A;  4K10 A;  4RXE A;  4P0V A;  4OKM A;  3RMG A;  3ACX A;  2F9K F;  2AET A;  4F6X A;  2Z7H A;  1ZW5 A;  1RQI A;  3KB9 A;  3WCE A;  4F62 A;  4EA2 A;  5DHI A;  5ERO A;  5ILJ A;  3ADZ A;  5B02 A;  3WEI A;  3ZOU A;  1HXA A;  1VG2 A;  4H5C F;  4LZ0 A;  1HX9 A;  3SDU A;  2PS6 A;  3G4F A;  5DZ2 A;  5ILH A;  4LLS A;  3ICZ A;  5A0J A;  3KRA A;  3OAB B;  3V1X A;  4OMH A;  1WL3 A;  3EZ3 A;  5ILK A;  3WJK A;  2Z78 A;  5JV1 F;  5HNA A;  3EGT A;  3WCB A;  1YHK A;  4OGU A;  2ZEV A;  3N5J F;  1V4K A;  2DH4 A;  1N1B A;  3BNX A;  4XQT F;  3PKO A;  2H8O A;  3N0G A;  4KVW A;  3DYF A;  1KIZ A;  2PS4 A;  3Q2Q A;  3SAE A;  3Q1O A;  2ZCR A;  2OPM A;  2E94 A;  4P0X A;  4Q23 A;  1WL1 A;  2E90 A;  4GAX A;  5IL8 A;  2Z4X A;  3SDR A;  2Z4V A;  3M00 A;  5ERM A;  3CP6 A;  3S9V A;  1HM7 A;  2AEK A;  2ZCQ A;  1V4E A;  3LGZ B;  5ILZ A; 
#chains in the Genus database with same CATH topology
 3WSA A;  3ZMB A;  4JVJ F;  4NKF A;  5DJV F;  4KVD A;  5IL3 A;  2F7M F;  2J5C A;  2J1O A;  4KQ5 A;  3N5H F;  2E92 A;  4LZ3 A;  4MC3 A;  4PVX F;  5B0M A;  5E8H A;  2ZCS A;  2AEL A;  1UBV A;  4LOB A;  4E1E A;  2VF6 A;  2OGD A;  3OAB A;  5HN8 A;  2F89 F;  3P8R A;  2Q58 A;  5CG6 A;  4DI5 A;  1V4J A;  3BNY A;  3WCL A;  3KRC B;  2ZY1 A;  5IK9 A;  3N1W F;  1YHM A;  3AQB B;  3P5R A;  3KRF B;  4F6V A;  3LSN A;  3AQ0 A;  5ER8 A;  1FPS A;  5DGS F;  3WCI A;  3LLW A;  4GP1 A;  3NPK A;  3N0F A;  4JZX A;  4DWB A;  3WCC A;  3M0G A;  4NUA A;  4P0W A;  3M02 A;  3WJN A;  1YJ4 A;  2Z4Y A;  2O1O A;  3IBA A;  4KQU A;  5E8K A;  3ACW A;  3LZ9 A;  1VG7 A;  5C05 A;  1N22 A;  4MC0 A;  1V4I A;  5IVG A;  5AEL A;  2E4O A;  3Q2Z A;  4DXJ A;  3SDT A;  2ZCO A;  1YYS A;  2Z50 A;  3TFP A;  3MZV A;  5IN8 A;  3TFN A;  1YYR A;  4NKE A;  4N9U A;  3SDV A;  3QQV A;  4JYX A;  3WSB A;  3WCM A;  1HXG A;  5KSX F;  4LFG A;  1WMW A;  5ILY A;  1RTR A;  3LOM A;  3WE9 A;  2Z52 A;  4JZB A;  2RAH A;  1VG4 A;  3KRC A;  1N24 A;  4JXN A;  3KRF A;  3W7F A;  3WCJ A;  3WJO A;  5DGM F;  3LVS A;  5ILD A;  5IMP A;  5JUZ F;  5B0L A;  4DEM F;  1YQ7 A;  4KFA A;  3OAC B;  3PYB A;  2E8V A;  5A0K A;  3M9U A;  4KVI A;  3QKC A;  2Q9Y A;  3PYA A;  4MC8 A;  3LG5 A;  3WEJ A;  1WKZ A;  5DHK A;  5CG5 A;  1WL2 A;  5H9D A;  1N21 A;  3N1V F;  4KPJ A;  4LUU A;  3Q30 A;  3VJC A;  2P1C A;  4HD1 A;  2E95 A;  3MAV A;  3CC9 A;  3P5P A;  5B03 A;  4LXW A;  4LPH F;  4NG6 A;  3ICK A;  4NFJ F;  5JA0 F;  2F92 F;  1YYU A;  3UCA A;  1N23 A;  4OMG A;  5DJR F;  4LIX A;  5IMN A;  3TC1 A;  5I1U A;  5AYP A;  5B00 A;  2OA6 A;  4KWD A;  1YV5 A;  4FJQ A;  2FOR A;  4XQR F;  1RQJ A;  4FP4 A;  4DWG A;  3RYW A;  5HN7 A;  4LFV F;  2E8U A;  1VG6 A;  2ONH A;  3N3D A;  2AZK A;  4PVY F;  5DIQ F;  3P8L A;  2AZL A;  4RXA A;  4NFI F;  3WC9 A;  2QIS A;  5JV2 F;  3IPI A;  3WEH A;  5B0J A;  4WK5 A;  3KBK A;  3VJB A;  1DGP A;  3OAC A;  3RYE A;  4KKM A;  3DYG A;  2I19 A;  5DJP F;  3S4J A;  3NF2 A;  4DZW A;  3ASX A;  1UBX A;  4LLT A;  5IMI A;  1KIY A;  3LMD A;  4RNQ A;  3DYH A;  1WY0 A;  1V4H A;  5IK0 A;  3ICN A;  5IKA A;  1VG3 A;  2Z4W A;  2PS7 A;  5DGN F;  2E8T A;  4LTV A;  4XQS F;  4H5D F;  1DI1 A;  3WCH A;  3KRO B;  4KUX A;  3KRP B;  3VJ9 A;  1N20 A;  5DW7 A;  3WCG A;  4L2X F;  3LDW A;  3ID0 A;  4KVY A;  1YYT A;  2ZEU A;  5ILI A;  3APZ A;  3B7L A;  3LGK A;  3N6K F;  4JXY A;  1JFG A;  5B0I A;  2F94 F;  3ZL6 A;  3LK5 A;  3OYR A;  3N45 F;  4LA6 A;  3LEE A;  4KQS A;  2Q80 A;  4E9Z A;  5IM1 A;  3M01 A;  1JFA A;  2ONG A;  5IKH A;  3WCD A;  2PS8 A;  2J1P A;  5ERN A;  3TS7 A;  3TFV A;  4H5E F;  3NPR A;  3SDQ A;  4LZC A;  3AQC B;  5B0K A;  1YHL A;  1HM4 A;  4LA5 A;  4GP2 A;  3NRI A;  5JV0 F;  2FTZ A;  3ZMC A;  4GA3 A;  3WCA A;  4DHD A;  4N1Z F;  5AFX A;  4KPD A;  5A0I A;  3EFQ A;  2E93 A;  1WL0 A;  1EZF A;  4LFE A;  1N1Z A;  3ZCD A;  3KRO A;  3VJE A;  5EAS A;  3KRP A;  5B01 A;  5AHU B;  3V66 A;  1YYQ A;  3P41 A;  2PS5 A;  2AZJ A;  4LTZ A;  3WEG A;  3CKE A;  3VJ8 A;  2F8C F;  2Z4Z A;  2E8W A;  3N49 F;  4QPF A;  1PS1 A;  2Z7I A;  1UBY A;  2Q9Z A;  3PDE A;  2OPN A;  3WEF A;  3G4D A;  3KRA B;  3LJI A;  2E8X A;  3ACY A;  2EWG A;  4RYP A;  4NFK F;  4EA1 A;  3VJD A;  3V1V A;  2F8Z F;  5HN9 A;  3ICM A;  4KK2 A;  4EA0 A;  3RBM A;  4ZQ8 A;  3PH7 A;  3VJA A;  4E9U A;  4LPG F;  4RXC A;  4RXD A;  3N46 F;  5E8L A;  3WCF A;  4OKZ A;  2E91 A;  5IK6 A;  1UBW A;  1HXC A;  5EAT A;  3AE0 A;  4QXS F;  3WEK A;  3N3L F;  5EAU A;  4UMJ A;  4K10 A;  4RXE A;  4P0V A;  4OKM A;  3RMG A;  3ACX A;  2F9K F;  2AET A;  4F6X A;  2Z7H A;  1ZW5 A;  1RQI A;  3KB9 A;  3WCE A;  4F62 A;  4EA2 A;  5DHI A;  5ERO A;  5ILJ A;  3ADZ A;  5B02 A;  3WEI A;  3ZOU A;  1HXA A;  1VG2 A;  4H5C F;  4LZ0 A;  1HX9 A;  3SDU A;  2PS6 A;  3G4F A;  5DZ2 A;  5ILH A;  4LLS A;  3ICZ A;  5A0J A;  3KRA A;  3OAB B;  3V1X A;  4OMH A;  1WL3 A;  3EZ3 A;  5ILK A;  3WJK A;  2Z78 A;  5JV1 F;  5HNA A;  3EGT A;  3WCB A;  1YHK A;  4OGU A;  2ZEV A;  3N5J F;  1V4K A;  2DH4 A;  1N1B A;  3BNX A;  4XQT F;  3PKO A;  2H8O A;  3N0G A;  4KVW A;  3DYF A;  1KIZ A;  2PS4 A;  3Q2Q A;  3SAE A;  3Q1O A;  2ZCR A;  2OPM A;  2E94 A;  4P0X A;  4Q23 A;  1WL1 A;  2E90 A;  4GAX A;  5IL8 A;  2Z4X A;  3SDR A;  2Z4V A;  3M00 A;  5ERM A;  3CP6 A;  3S9V A;  1HM7 A;  2AEK A;  2ZCQ A;  1V4E A;  3LGZ B;  5ILZ A; 
#chains in the Genus database with same CATH homology
 3WSA A;  3ZMB A;  4JVJ F;  4NKF A;  5DJV F;  4KVD A;  5IL3 A;  2F7M F;  2J5C A;  2J1O A;  4KQ5 A;  3N5H F;  2E92 A;  4LZ3 A;  4MC3 A;  4PVX F;  5B0M A;  5E8H A;  2ZCS A;  2AEL A;  1UBV A;  4LOB A;  4E1E A;  2VF6 A;  2OGD A;  3OAB A;  5HN8 A;  2F89 F;  3P8R A;  2Q58 A;  5CG6 A;  4DI5 A;  1V4J A;  3BNY A;  3WCL A;  3KRC B;  2ZY1 A;  5IK9 A;  3N1W F;  1YHM A;  3AQB B;  3P5R A;  3KRF B;  4F6V A;  3LSN A;  3AQ0 A;  5ER8 A;  1FPS A;  5DGS F;  3WCI A;  3LLW A;  4GP1 A;  3NPK A;  3N0F A;  4JZX A;  4DWB A;  3WCC A;  3M0G A;  4NUA A;  4P0W A;  3M02 A;  3WJN A;  1YJ4 A;  2Z4Y A;  2O1O A;  3IBA A;  4KQU A;  5E8K A;  3ACW A;  3LZ9 A;  1VG7 A;  5C05 A;  1N22 A;  4MC0 A;  1V4I A;  5IVG A;  5AEL A;  2E4O A;  3Q2Z A;  4DXJ A;  3SDT A;  2ZCO A;  1YYS A;  2Z50 A;  3TFP A;  3MZV A;  5IN8 A;  3TFN A;  1YYR A;  4NKE A;  4N9U A;  3SDV A;  3QQV A;  4JYX A;  3WSB A;  3WCM A;  1HXG A;  5KSX F;  4LFG A;  1WMW A;  5ILY A;  1RTR A;  3LOM A;  3WE9 A;  2Z52 A;  4JZB A;  2RAH A;  1VG4 A;  3KRC A;  1N24 A;  4JXN A;  3KRF A;  3W7F A;  3WCJ A;  3WJO A;  5DGM F;  3LVS A;  5ILD A;  5IMP A;  5JUZ F;  5B0L A;  4DEM F;  1YQ7 A;  4KFA A;  3OAC B;  3PYB A;  2E8V A;  5A0K A;  3M9U A;  4KVI A;  3QKC A;  2Q9Y A;  3PYA A;  4MC8 A;  3LG5 A;  3WEJ A;  1WKZ A;  5DHK A;  5CG5 A;  1WL2 A;  5H9D A;  1N21 A;  3N1V F;  4KPJ A;  4LUU A;  3Q30 A;  3VJC A;  2P1C A;  4HD1 A;  2E95 A;  3MAV A;  3CC9 A;  3P5P A;  5B03 A;  4LXW A;  4LPH F;  4NG6 A;  3ICK A;  4NFJ F;  5JA0 F;  2F92 F;  1YYU A;  3UCA A;  1N23 A;  4OMG A;  5DJR F;  4LIX A;  5IMN A;  3TC1 A;  5I1U A;  5AYP A;  5B00 A;  2OA6 A;  4KWD A;  1YV5 A;  4FJQ A;  2FOR A;  4XQR F;  1RQJ A;  4FP4 A;  4DWG A;  3RYW A;  5HN7 A;  4LFV F;  2E8U A;  1VG6 A;  2ONH A;  3N3D A;  2AZK A;  4PVY F;  5DIQ F;  3P8L A;  2AZL A;  4RXA A;  4NFI F;  3WC9 A;  2QIS A;  5JV2 F;  3IPI A;  3WEH A;  5B0J A;  4WK5 A;  3KBK A;  3VJB A;  1DGP A;  3OAC A;  3RYE A;  4KKM A;  3DYG A;  2I19 A;  5DJP F;  3S4J A;  3NF2 A;  4DZW A;  3ASX A;  1UBX A;  4LLT A;  5IMI A;  1KIY A;  3LMD A;  4RNQ A;  3DYH A;  1WY0 A;  1V4H A;  5IK0 A;  3ICN A;  5IKA A;  1VG3 A;  2Z4W A;  2PS7 A;  5DGN F;  2E8T A;  4LTV A;  4XQS F;  4H5D F;  1DI1 A;  3WCH A;  3KRO B;  4KUX A;  3KRP B;  3VJ9 A;  1N20 A;  5DW7 A;  3WCG A;  4L2X F;  3LDW A;  3ID0 A;  4KVY A;  1YYT A;  2ZEU A;  5ILI A;  3APZ A;  3B7L A;  3LGK A;  3N6K F;  4JXY A;  1JFG A;  5B0I A;  2F94 F;  3ZL6 A;  3LK5 A;  3OYR A;  3N45 F;  4LA6 A;  3LEE A;  4KQS A;  2Q80 A;  4E9Z A;  5IM1 A;  3M01 A;  1JFA A;  2ONG A;  5IKH A;  3WCD A;  2PS8 A;  2J1P A;  5ERN A;  3TS7 A;  3TFV A;  4H5E F;  3NPR A;  3SDQ A;  4LZC A;  3AQC B;  5B0K A;  1YHL A;  1HM4 A;  4LA5 A;  4GP2 A;  3NRI A;  5JV0 F;  2FTZ A;  3ZMC A;  4GA3 A;  3WCA A;  4DHD A;  4N1Z F;  5AFX A;  4KPD A;  5A0I A;  3EFQ A;  2E93 A;  1WL0 A;  1EZF A;  4LFE A;  1N1Z A;  3ZCD A;  3KRO A;  3VJE A;  5EAS A;  3KRP A;  5B01 A;  5AHU B;  3V66 A;  1YYQ A;  3P41 A;  2PS5 A;  2AZJ A;  4LTZ A;  3WEG A;  3CKE A;  3VJ8 A;  2F8C F;  2Z4Z A;  2E8W A;  3N49 F;  4QPF A;  1PS1 A;  2Z7I A;  1UBY A;  2Q9Z A;  3PDE A;  2OPN A;  3WEF A;  3G4D A;  3KRA B;  3LJI A;  2E8X A;  3ACY A;  2EWG A;  4RYP A;  4NFK F;  4EA1 A;  3VJD A;  3V1V A;  2F8Z F;  5HN9 A;  3ICM A;  4KK2 A;  4EA0 A;  3RBM A;  4ZQ8 A;  3PH7 A;  3VJA A;  4E9U A;  4LPG F;  4RXC A;  4RXD A;  3N46 F;  5E8L A;  3WCF A;  4OKZ A;  2E91 A;  5IK6 A;  1UBW A;  1HXC A;  5EAT A;  3AE0 A;  4QXS F;  3WEK A;  3N3L F;  5EAU A;  4UMJ A;  4K10 A;  4RXE A;  4P0V A;  4OKM A;  3RMG A;  3ACX A;  2F9K F;  2AET A;  4F6X A;  2Z7H A;  1ZW5 A;  1RQI A;  3KB9 A;  3WCE A;  4F62 A;  4EA2 A;  5DHI A;  5ERO A;  5ILJ A;  3ADZ A;  5B02 A;  3WEI A;  3ZOU A;  1HXA A;  1VG2 A;  4H5C F;  4LZ0 A;  1HX9 A;  3SDU A;  2PS6 A;  3G4F A;  5DZ2 A;  5ILH A;  4LLS A;  3ICZ A;  5A0J A;  3KRA A;  3OAB B;  3V1X A;  4OMH A;  1WL3 A;  3EZ3 A;  5ILK A;  3WJK A;  2Z78 A;  5JV1 F;  5HNA A;  3EGT A;  3WCB A;  1YHK A;  4OGU A;  2ZEV A;  3N5J F;  1V4K A;  2DH4 A;  1N1B A;  3BNX A;  4XQT F;  3PKO A;  2H8O A;  3N0G A;  4KVW A;  3DYF A;  1KIZ A;  2PS4 A;  3Q2Q A;  3SAE A;  3Q1O A;  2ZCR A;  2OPM A;  2E94 A;  4P0X A;  4Q23 A;  1WL1 A;  2E90 A;  4GAX A;  5IL8 A;  2Z4X A;  3SDR A;  2Z4V A;  3M00 A;  5ERM A;  3CP6 A;  3S9V A;  1HM7 A;  2AEK A;  2ZCQ A;  1V4E A;  3LGZ B;  5ILZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...