2I19A

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
367
structure length
367
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLSPNNNGEEDDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl pyrophosphate synthase
publication title Solid-state NMR, crystallographic, and computational investigation of bisphosphonates and farnesyl diphosphate synthase-bisphosphonate complexes.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 133
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2006-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2i19A00
4KK2A 3LLWA 2E90A 3KROB 1WKZA 3VJ9A 3WCAA 1HM4A 2Z4XA 5ERMA 1WL3A 1FPSA 4PVYF 2DH4A 1N1ZA 4NKFA 3SAEA 2E4OA 4KVYA 2EWGA 3KB9A 3KRCA 3N1WF 5IKAA 5JV2F 5ILYA 3NPKA 4MC8A 4P0VA 3SDTA 2PS5A 5IM1A 3N45F 1HX9A 1JFGA 4JYXA 4NG6A 4LLSA 2F92F 5EASA 4KUXA 3LSNA 3N1VF 1UBWA 5JUZF 3LDWA 4EA0A 4LUUA 4KPJA 1YYTA 4ZQ8A 3NF2A 3KRCB 4LPGF 1DGPA 3PYBA 4NKEA 4E1EA 3ADZA 4K10A 4KWDA 4H5DF 3WCBA 5ERNA 5ILHA 4DXJA 2E92A 5HN8A 2AZKA 2E93A 3LK5A 3W7FA 1VG6A 4DZWA 3G4DA 4JZBA 5B0IA 5AELA 3G4FA 4XQRF 3PDEA 4JXNA 2Z50A 4LPHF 4JZXA 5DIQF 5ILDA 5E8HA 2F9KF 4N1ZF 4KKMA 5HN9A 5B0KA 3WEKA 2Z7HA 3SDRA 1HXCA 4PVXF 4LIXA 3ACXA 2ZCOA 4H5EF 3N0FA 3WEIA 4DWBA 2Z4VA 4LLTA 3KBKA 1N23A 3S4JA 2OPMA 5I1UA 3WJOA 4LOBA 3N3LF 2PS7A 3ACWA 4WK5A 3WC9A 5IL8A 3IBAA 4DI5A 4LTVA 2F8ZF 1V4JA 1N24A 4KQ5A 5JV1F 3S9VA 1PS1A 3LJIA 4LFGA 5ILIA 1UBYA 1YV5A 3RBMA 2PS6A 3WJNA 4LZ0A 1WL2A 4NFJF 4NUAA 5DHIA 3AE0A 5IK0A 3M9UA 2PS4A 1UBXA 3P41A 3ASXA 3UCAA 1N20A 3CKEA 3NPRA 4GP2A 3VJ8A 3N3DA 1JFAA 2E8XA 2Z4YA 1VG4A 5CG6A 3ZCDA 1EZFA 1WL0A 2Z4ZA 5DZ2A 5EAUA 5AYPA 3Q1OA 3RYEA 2H8OA 2E91A 3ACYA 4RXCA 3TFNA 1UBVA 2P1CA 5DGNF 5JA0F 5C05A 3WCCA 3DYFA 3ICZA 3KRAA 3ZMCA 2Q9YA 4DHDA 2OA6A 3IPIA 2AZJA 3EGTA 3LZ9A 3QQVA 1RQIA 3N5JF 3ICMA 4DEMF 4Q23A 5B03A 3N5HF 3WSBA 3PH7A 3WEFA 3M01A 3N46F 3CP6A 2FTZA 3LOMA 3WE9A 5H9DA 4NFIF 2F94F 3LGZB 1VG7A 3ZMBA 2ZCSA 4H5CF 3N0GA 2Z7IA 1V4HA 5B0JA 5DJPF 3KRPA 3KRAB 3P5RA 4FJQA 3P5PA 1KIZA 4E9ZA 2J1OA 3ID0A 3Q2ZA 4GA3A 4LZCA 3LMDA 2O1OA 1DI1A 1N1BA 3N49F 4UMJA 4E9UA 4F6VA 1HM7A 4XQSF 2F7MF 2QISA 1V4KA 3ICKA 1N22A 3WEGA 5IVGA 2Z78A 3WCEA 2AETA 5IL3A 4GAXA 5E8KA 3ICNA 3WEHA 1WL1A 2E95A 1VG3A 2AEKA 3KRPB 5DHKA 4LA6A 3V1VA 4KVIA 4KQSA 1N21A 2Q80A 4RXEA 4OKMA 1KIYA 4LA5A 5IMPA 1YHKA 5IMNA 2ZEVA 5EROA 3LGKA 1YQ7A 3VJAA 3DYGA 5B00A 2E8WA 3OYRA 4RXDA 4DWGA 3OACA 3CC9A 3Q30A 5DJRF 5KSXF 4MC3A 1YYQA 2PS8A 3KRFA 5A0JA 4HD1A 3P8RA 2RAHA 3BNYA 3APZA 5B02A 3P8LA 5AHUB 2I19A 3WCJA 3RYWA 3M02A 4LFVF 2ZY1A 3MZVA 4LZ3A 1RQJA 4L2XF 4KVDA 2J1PA 3TFPA 3OACB 5IMIA 4LFEA 4P0XA 3ZL6A 4N9UA 5DGSF 3SDVA 3V1XA 3KRFB 2FORA 4EA2A 3AQ0A 4LXWA 1ZW5A 1WY0A 5JV0F 4OMHA 4QXSF 1YYSA 5E8LA 5IKHA 2ONHA 5A0KA 3WEJA 5IK9A 3OABA 5HNAA 4OKZA 2E94A 3Q2QA 2F8CF 1YYRA 1V4EA 2AZLA 2Q58A 1V4IA 3WSAA 3WCHA 4RNQA 5EATA 2VF6A 1RTRA 4F6XA 3NRIA 5IN8A 1HXGA 3B7LA 3WCFA 4OGUA 3TC1A 5DJVF 1YHLA 4XQTF 3PKOA 5ILJA 2Z4WA 3OABB 4OMGA 4JXYA 3RMGA 3QKCA 3VJBA 5DGMF 4FP4A 2OGDA 5HN7A 3N6KF 5DW7A 4KQUA 2Z52A 1YJ4A 4NFKF 2E8VA 3ZOUA 3VJCA 5ILKA 3DYHA 1HXAA 1YYUA 3AQBB 5B01A 5ER8A 3LEEA 3WCIA 3MAVA 3WCLA 1YHMA 4EA1A 4QPFA 3LVSA 4GP1A 5B0MA 3VJEA 4LTZA 3M00A 3BNXA 3PYAA 2OPNA 3VJDA 3EZ3A 3KROA 4KVWA 3V66A 5A0IA 2E8UA 5B0LA 3TFVA 3WCDA 1VG2A 2E8TA 3M0GA 3WCMA 3WCGA 2Q9ZA 2ZCRA 4RXAA 4MC0A 3AQCB 3TS7A 4KFAA 1WMWA 3SDQA 3EFQA 5CG5A 4P0WA 5AFXA 4F62A 2ONGA 2ZCQA 5IK6A 2F89F 2J5CA 2ZEUA 5ILZA 4KPDA 3SDUA 2AELA 3LG5A 4RYPA 3WJKA 4JVJF
chains in the Genus database with same CATH superfamily
4KK2A 3LLWA 2E90A 3KROB 1WKZA 3VJ9A 3WCAA 1HM4A 2Z4XA 5ERMA 1WL3A 1FPSA 4PVYF 2DH4A 1N1ZA 4NKFA 3SAEA 2E4OA 4KVYA 2EWGA 3KB9A 3KRCA 3N1WF 5IKAA 5JV2F 5ILYA 3NPKA 4MC8A 4P0VA 3SDTA 2PS5A 5IM1A 3N45F 1HX9A 1JFGA 4JYXA 4NG6A 4LLSA 2F92F 5EASA 4KUXA 3LSNA 3N1VF 1UBWA 5JUZF 3LDWA 4EA0A 4LUUA 4KPJA 1YYTA 4ZQ8A 3NF2A 3KRCB 4LPGF 1DGPA 3PYBA 4NKEA 4E1EA 3ADZA 4K10A 4KWDA 4H5DF 3WCBA 5ERNA 5ILHA 4DXJA 2E92A 5HN8A 2AZKA 2E93A 3LK5A 3W7FA 1VG6A 4DZWA 3G4DA 4JZBA 5B0IA 5AELA 3G4FA 4XQRF 3PDEA 4JXNA 2Z50A 4LPHF 4JZXA 5DIQF 5ILDA 5E8HA 2F9KF 4N1ZF 4KKMA 5HN9A 5B0KA 3WEKA 2Z7HA 3SDRA 1HXCA 4PVXF 4LIXA 3ACXA 2ZCOA 4H5EF 3N0FA 3WEIA 4DWBA 2Z4VA 4LLTA 3KBKA 1N23A 3S4JA 2OPMA 5I1UA 3WJOA 4LOBA 3N3LF 2PS7A 3ACWA 4WK5A 3WC9A 5IL8A 3IBAA 4DI5A 4LTVA 2F8ZF 1V4JA 1N24A 4KQ5A 5JV1F 3S9VA 1PS1A 3LJIA 4LFGA 5ILIA 1UBYA 1YV5A 3RBMA 2PS6A 3WJNA 4LZ0A 1WL2A 4NFJF 4NUAA 5DHIA 3AE0A 5IK0A 3M9UA 2PS4A 1UBXA 3P41A 3ASXA 3UCAA 1N20A 3CKEA 3NPRA 4GP2A 3VJ8A 3N3DA 1JFAA 2E8XA 2Z4YA 1VG4A 5CG6A 3ZCDA 1EZFA 1WL0A 2Z4ZA 5DZ2A 5EAUA 5AYPA 3Q1OA 3RYEA 2H8OA 2E91A 3ACYA 4RXCA 3TFNA 1UBVA 2P1CA 5DGNF 5JA0F 5C05A 3WCCA 3DYFA 3ICZA 3KRAA 3ZMCA 2Q9YA 4DHDA 2OA6A 3IPIA 2AZJA 3EGTA 3LZ9A 3QQVA 1RQIA 3N5JF 3ICMA 4DEMF 4Q23A 5B03A 3N5HF 3WSBA 3PH7A 3WEFA 3M01A 3N46F 3CP6A 2FTZA 3LOMA 3WE9A 5H9DA 4NFIF 2F94F 3LGZB 1VG7A 3ZMBA 2ZCSA 4H5CF 3N0GA 2Z7IA 1V4HA 5B0JA 5DJPF 3KRPA 3KRAB 3P5RA 4FJQA 3P5PA 1KIZA 4E9ZA 2J1OA 3ID0A 3Q2ZA 4GA3A 4LZCA 3LMDA 2O1OA 1DI1A 1N1BA 3N49F 4UMJA 4E9UA 4F6VA 1HM7A 4XQSF 2F7MF 2QISA 1V4KA 3ICKA 1N22A 3WEGA 5IVGA 2Z78A 3WCEA 2AETA 5IL3A 4GAXA 5E8KA 3ICNA 3WEHA 1WL1A 2E95A 1VG3A 2AEKA 3KRPB 5DHKA 4LA6A 3V1VA 4KVIA 4KQSA 1N21A 2Q80A 4RXEA 4OKMA 1KIYA 4LA5A 5IMPA 1YHKA 5IMNA 2ZEVA 5EROA 3LGKA 1YQ7A 3VJAA 3DYGA 5B00A 2E8WA 3OYRA 4RXDA 4DWGA 3OACA 3CC9A 3Q30A 5DJRF 5KSXF 4MC3A 1YYQA 2PS8A 3KRFA 5A0JA 4HD1A 3P8RA 2RAHA 3BNYA 3APZA 5B02A 3P8LA 5AHUB 2I19A 3WCJA 3RYWA 3M02A 4LFVF 2ZY1A 3MZVA 4LZ3A 1RQJA 4L2XF 4KVDA 2J1PA 3TFPA 3OACB 5IMIA 4LFEA 4P0XA 3ZL6A 4N9UA 5DGSF 3SDVA 3V1XA 3KRFB 2FORA 4EA2A 3AQ0A 4LXWA 1ZW5A 1WY0A 5JV0F 4OMHA 4QXSF 1YYSA 5E8LA 5IKHA 2ONHA 5A0KA 3WEJA 5IK9A 3OABA 5HNAA 4OKZA 2E94A 3Q2QA 2F8CF 1YYRA 1V4EA 2AZLA 2Q58A 1V4IA 3WSAA 3WCHA 4RNQA 5EATA 2VF6A 1RTRA 4F6XA 3NRIA 5IN8A 1HXGA 3B7LA 3WCFA 4OGUA 3TC1A 5DJVF 1YHLA 4XQTF 3PKOA 5ILJA 2Z4WA 3OABB 4OMGA 4JXYA 3RMGA 3QKCA 3VJBA 5DGMF 4FP4A 2OGDA 5HN7A 3N6KF 5DW7A 4KQUA 2Z52A 1YJ4A 4NFKF 2E8VA 3ZOUA 3VJCA 5ILKA 3DYHA 1HXAA 1YYUA 3AQBB 5B01A 5ER8A 3LEEA 3WCIA 3MAVA 3WCLA 1YHMA 4EA1A 4QPFA 3LVSA 4GP1A 5B0MA 3VJEA 4LTZA 3M00A 3BNXA 3PYAA 2OPNA 3VJDA 3EZ3A 3KROA 4KVWA 3V66A 5A0IA 2E8UA 5B0LA 3TFVA 3WCDA 1VG2A 2E8TA 3M0GA 3WCMA 3WCGA 2Q9ZA 2ZCRA 4RXAA 4MC0A 3AQCB 3TS7A 4KFAA 1WMWA 3SDQA 3EFQA 5CG5A 4P0WA 5AFXA 4F62A 2ONGA 2ZCQA 5IK6A 2F89F 2J5CA 2ZEUA 5ILZA 4KPDA 3SDUA 2AELA 3LG5A 4RYPA 3WJKA 4JVJF
chains in the Genus database with same CATH topology
4KK2A 3LLWA 2E90A 3KROB 1WKZA 3VJ9A 3WCAA 1HM4A 2Z4XA 5ERMA 1WL3A 1FPSA 4PVYF 2DH4A 1N1ZA 4NKFA 3SAEA 2E4OA 4KVYA 2EWGA 3KB9A 3KRCA 3N1WF 5IKAA 5JV2F 5ILYA 3NPKA 4MC8A 4P0VA 3SDTA 2PS5A 5IM1A 3N45F 1HX9A 1JFGA 4JYXA 4NG6A 4LLSA 2F92F 5EASA 4KUXA 3LSNA 3N1VF 1UBWA 5JUZF 3LDWA 4EA0A 4LUUA 4KPJA 1YYTA 4ZQ8A 3NF2A 3KRCB 4LPGF 1DGPA 3PYBA 4NKEA 4E1EA 3ADZA 4K10A 4KWDA 4H5DF 3WCBA 5ERNA 5ILHA 4DXJA 2E92A 5HN8A 2AZKA 2E93A 3LK5A 3W7FA 1VG6A 4DZWA 3G4DA 4JZBA 5B0IA 5AELA 3G4FA 4XQRF 3PDEA 4JXNA 2Z50A 4LPHF 4JZXA 5DIQF 5ILDA 5E8HA 2F9KF 4N1ZF 4KKMA 5HN9A 5B0KA 3WEKA 2Z7HA 3SDRA 1HXCA 4PVXF 4LIXA 3ACXA 2ZCOA 4H5EF 3N0FA 3WEIA 4DWBA 2Z4VA 4LLTA 3KBKA 1N23A 3S4JA 2OPMA 5I1UA 3WJOA 4LOBA 3N3LF 2PS7A 3ACWA 4WK5A 3WC9A 5IL8A 3IBAA 4DI5A 4LTVA 2F8ZF 1V4JA 1N24A 4KQ5A 5JV1F 3S9VA 1PS1A 3LJIA 4LFGA 5ILIA 1UBYA 1YV5A 3RBMA 2PS6A 3WJNA 4LZ0A 1WL2A 4NFJF 4NUAA 5DHIA 3AE0A 5IK0A 3M9UA 2PS4A 1UBXA 3P41A 3ASXA 3UCAA 1N20A 3CKEA 3NPRA 4GP2A 3VJ8A 3N3DA 1JFAA 2E8XA 2Z4YA 1VG4A 5CG6A 3ZCDA 1EZFA 1WL0A 2Z4ZA 5DZ2A 5EAUA 5AYPA 3Q1OA 3RYEA 2H8OA 2E91A 3ACYA 4RXCA 3TFNA 1UBVA 2P1CA 5DGNF 5JA0F 5C05A 3WCCA 3DYFA 3ICZA 3KRAA 3ZMCA 2Q9YA 4DHDA 2OA6A 3IPIA 2AZJA 3EGTA 3LZ9A 3QQVA 1RQIA 3N5JF 3ICMA 4DEMF 4Q23A 5B03A 3N5HF 3WSBA 3PH7A 3WEFA 3M01A 3N46F 3CP6A 2FTZA 3LOMA 3WE9A 5H9DA 4NFIF 2F94F 3LGZB 1VG7A 3ZMBA 2ZCSA 4H5CF 3N0GA 2Z7IA 1V4HA 5B0JA 5DJPF 3KRPA 3KRAB 3P5RA 4FJQA 3P5PA 1KIZA 4E9ZA 2J1OA 3ID0A 3Q2ZA 4GA3A 4LZCA 3LMDA 2O1OA 1DI1A 1N1BA 3N49F 4UMJA 4E9UA 4F6VA 1HM7A 4XQSF 2F7MF 2QISA 1V4KA 3ICKA 1N22A 3WEGA 5IVGA 2Z78A 3WCEA 2AETA 5IL3A 4GAXA 5E8KA 3ICNA 3WEHA 1WL1A 2E95A 1VG3A 2AEKA 3KRPB 5DHKA 4LA6A 3V1VA 4KVIA 4KQSA 1N21A 2Q80A 4RXEA 4OKMA 1KIYA 4LA5A 5IMPA 1YHKA 5IMNA 2ZEVA 5EROA 3LGKA 1YQ7A 3VJAA 3DYGA 5B00A 2E8WA 3OYRA 4RXDA 4DWGA 3OACA 3CC9A 3Q30A 5DJRF 5KSXF 4MC3A 1YYQA 2PS8A 3KRFA 5A0JA 4HD1A 3P8RA 2RAHA 3BNYA 3APZA 5B02A 3P8LA 5AHUB 2I19A 3WCJA 3RYWA 3M02A 4LFVF 2ZY1A 3MZVA 4LZ3A 1RQJA 4L2XF 4KVDA 2J1PA 3TFPA 3OACB 5IMIA 4LFEA 4P0XA 3ZL6A 4N9UA 5DGSF 3SDVA 3V1XA 3KRFB 2FORA 4EA2A 3AQ0A 4LXWA 1ZW5A 1WY0A 5JV0F 4OMHA 4QXSF 1YYSA 5E8LA 5IKHA 2ONHA 5A0KA 3WEJA 5IK9A 3OABA 5HNAA 4OKZA 2E94A 3Q2QA 2F8CF 1YYRA 1V4EA 2AZLA 2Q58A 1V4IA 3WSAA 3WCHA 4RNQA 5EATA 2VF6A 1RTRA 4F6XA 3NRIA 5IN8A 1HXGA 3B7LA 3WCFA 4OGUA 3TC1A 5DJVF 1YHLA 4XQTF 3PKOA 5ILJA 2Z4WA 3OABB 4OMGA 4JXYA 3RMGA 3QKCA 3VJBA 5DGMF 4FP4A 2OGDA 5HN7A 3N6KF 5DW7A 4KQUA 2Z52A 1YJ4A 4NFKF 2E8VA 3ZOUA 3VJCA 5ILKA 3DYHA 1HXAA 1YYUA 3AQBB 5B01A 5ER8A 3LEEA 3WCIA 3MAVA 3WCLA 1YHMA 4EA1A 4QPFA 3LVSA 4GP1A 5B0MA 3VJEA 4LTZA 3M00A 3BNXA 3PYAA 2OPNA 3VJDA 3EZ3A 3KROA 4KVWA 3V66A 5A0IA 2E8UA 5B0LA 3TFVA 3WCDA 1VG2A 2E8TA 3M0GA 3WCMA 3WCGA 2Q9ZA 2ZCRA 4RXAA 4MC0A 3AQCB 3TS7A 4KFAA 1WMWA 3SDQA 3EFQA 5CG5A 4P0WA 5AFXA 4F62A 2ONGA 2ZCQA 5IK6A 2F89F 2J5CA 2ZEUA 5ILZA 4KPDA 3SDUA 2AELA 3LG5A 4RYPA 3WJKA 4JVJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KK2 A;  3LLW A;  2E90 A;  3KRO B;  1WKZ A;  3VJ9 A;  3WCA A;  1HM4 A;  2Z4X A;  5ERM A;  1WL3 A;  1FPS A;  4PVY F;  2DH4 A;  1N1Z A;  4NKF A;  3SAE A;  2E4O A;  4KVY A;  2EWG A;  3KB9 A;  3KRC A;  3N1W F;  5IKA A;  5JV2 F;  5ILY A;  3NPK A;  4MC8 A;  4P0V A;  3SDT A;  2PS5 A;  5IM1 A;  3N45 F;  1HX9 A;  1JFG A;  4JYX A;  4NG6 A;  4LLS A;  2F92 F;  5EAS A;  4KUX A;  3LSN A;  3N1V F;  1UBW A;  5JUZ F;  3LDW A;  4EA0 A;  4LUU A;  4KPJ A;  1YYT A;  4ZQ8 A;  3NF2 A;  3KRC B;  4LPG F;  1DGP A;  3PYB A;  4NKE A;  4E1E A;  3ADZ A;  4K10 A;  4KWD A;  4H5D F;  3WCB A;  5ERN A;  5ILH A;  4DXJ A;  2E92 A;  5HN8 A;  2AZK A;  2E93 A;  3LK5 A;  3W7F A;  1VG6 A;  4DZW A;  3G4D A;  4JZB A;  5B0I A;  5AEL A;  3G4F A;  4XQR F;  3PDE A;  4JXN A;  2Z50 A;  4LPH F;  4JZX A;  5DIQ F;  5ILD A;  5E8H A;  2F9K F;  4N1Z F;  4KKM A;  5HN9 A;  5B0K A;  3WEK A;  2Z7H A;  3SDR A;  1HXC A;  4PVX F;  4LIX A;  3ACX A;  2ZCO A;  4H5E F;  3N0F A;  3WEI A;  4DWB A;  2Z4V A;  4LLT A;  3KBK A;  1N23 A;  3S4J A;  2OPM A;  5I1U A;  3WJO A;  4LOB A;  3N3L F;  2PS7 A;  3ACW A;  4WK5 A;  3WC9 A;  5IL8 A;  3IBA A;  4DI5 A;  4LTV A;  2F8Z F;  1V4J A;  1N24 A;  4KQ5 A;  5JV1 F;  3S9V A;  1PS1 A;  3LJI A;  4LFG A;  5ILI A;  1UBY A;  1YV5 A;  3RBM A;  2PS6 A;  3WJN A;  4LZ0 A;  1WL2 A;  4NFJ F;  4NUA A;  5DHI A;  3AE0 A;  5IK0 A;  3M9U A;  2PS4 A;  1UBX A;  3P41 A;  3ASX A;  3UCA A;  1N20 A;  3CKE A;  3NPR A;  4GP2 A;  3VJ8 A;  3N3D A;  1JFA A;  2E8X A;  2Z4Y A;  1VG4 A;  5CG6 A;  3ZCD A;  1EZF A;  1WL0 A;  2Z4Z A;  5DZ2 A;  5EAU A;  5AYP A;  3Q1O A;  3RYE A;  2H8O A;  2E91 A;  3ACY A;  4RXC A;  3TFN A;  1UBV A;  2P1C A;  5DGN F;  5JA0 F;  5C05 A;  3WCC A;  3DYF A;  3ICZ A;  3KRA A;  3ZMC A;  2Q9Y A;  4DHD A;  2OA6 A;  3IPI A;  2AZJ A;  3EGT A;  3LZ9 A;  3QQV A;  1RQI A;  3N5J F;  3ICM A;  4DEM F;  4Q23 A;  5B03 A;  3N5H F;  3WSB A;  3PH7 A;  3WEF A;  3M01 A;  3N46 F;  3CP6 A;  2FTZ A;  3LOM A;  3WE9 A;  5H9D A;  4NFI F;  2F94 F;  3LGZ B;  1VG7 A;  3ZMB A;  2ZCS A;  4H5C F;  3N0G A;  2Z7I A;  1V4H A;  5B0J A;  5DJP F;  3KRP A;  3KRA B;  3P5R A;  4FJQ A;  3P5P A;  1KIZ A;  4E9Z A;  2J1O A;  3ID0 A;  3Q2Z A;  4GA3 A;  4LZC A;  3LMD A;  2O1O A;  1DI1 A;  1N1B A;  3N49 F;  4UMJ A;  4E9U A;  4F6V A;  1HM7 A;  4XQS F;  2F7M F;  2QIS A;  1V4K A;  3ICK A;  1N22 A;  3WEG A;  5IVG A;  2Z78 A;  3WCE A;  2AET A;  5IL3 A;  4GAX A;  5E8K A;  3ICN A;  3WEH A;  1WL1 A;  2E95 A;  1VG3 A;  2AEK A;  3KRP B;  5DHK A;  4LA6 A;  3V1V A;  4KVI A;  4KQS A;  1N21 A;  2Q80 A;  4RXE A;  4OKM A;  1KIY A;  4LA5 A;  5IMP A;  1YHK A;  5IMN A;  2ZEV A;  5ERO A;  3LGK A;  1YQ7 A;  3VJA A;  3DYG A;  5B00 A;  2E8W A;  3OYR A;  4RXD A;  4DWG A;  3OAC A;  3CC9 A;  3Q30 A;  5DJR F;  5KSX F;  4MC3 A;  1YYQ A;  2PS8 A;  3KRF A;  5A0J A;  4HD1 A;  3P8R A;  2RAH A;  3BNY A;  3APZ A;  5B02 A;  3P8L A;  5AHU B;  2I19 A;  3WCJ A;  3RYW A;  3M02 A;  4LFV F;  2ZY1 A;  3MZV A;  4LZ3 A;  1RQJ A;  4L2X F;  4KVD A;  2J1P A;  3TFP A;  3OAC B;  5IMI A;  4LFE A;  4P0X A;  3ZL6 A;  4N9U A;  5DGS F;  3SDV A;  3V1X A;  3KRF B;  2FOR A;  4EA2 A;  3AQ0 A;  4LXW A;  1ZW5 A;  1WY0 A;  5JV0 F;  4OMH A;  4QXS F;  1YYS A;  5E8L A;  5IKH A;  2ONH A;  5A0K A;  3WEJ A;  5IK9 A;  3OAB A;  5HNA A;  4OKZ A;  2E94 A;  3Q2Q A;  2F8C F;  1YYR A;  1V4E A;  2AZL A;  2Q58 A;  1V4I A;  3WSA A;  3WCH A;  4RNQ A;  5EAT A;  2VF6 A;  1RTR A;  4F6X A;  3NRI A;  5IN8 A;  1HXG A;  3B7L A;  3WCF A;  4OGU A;  3TC1 A;  5DJV F;  1YHL A;  4XQT F;  3PKO A;  5ILJ A;  2Z4W A;  3OAB B;  4OMG A;  4JXY A;  3RMG A;  3QKC A;  3VJB A;  5DGM F;  4FP4 A;  2OGD A;  5HN7 A;  3N6K F;  5DW7 A;  4KQU A;  2Z52 A;  1YJ4 A;  4NFK F;  2E8V A;  3ZOU A;  3VJC A;  5ILK A;  3DYH A;  1HXA A;  1YYU A;  3AQB B;  5B01 A;  5ER8 A;  3LEE A;  3WCI A;  3MAV A;  3WCL A;  1YHM A;  4EA1 A;  4QPF A;  3LVS A;  4GP1 A;  5B0M A;  3VJE A;  4LTZ A;  3M00 A;  3BNX A;  3PYA A;  2OPN A;  3VJD A;  3EZ3 A;  3KRO A;  4KVW A;  3V66 A;  5A0I A;  2E8U A;  5B0L A;  3TFV A;  3WCD A;  1VG2 A;  2E8T A;  3M0G A;  3WCM A;  3WCG A;  2Q9Z A;  2ZCR A;  4RXA A;  4MC0 A;  3AQC B;  3TS7 A;  4KFA A;  1WMW A;  3SDQ A;  3EFQ A;  5CG5 A;  4P0W A;  5AFX A;  4F62 A;  2ONG A;  2ZCQ A;  5IK6 A;  2F89 F;  2J5C A;  2ZEU A;  5ILZ A;  4KPD A;  3SDU A;  2AEL A;  3LG5 A;  4RYP A;  3WJK A;  4JVJ F; 
#chains in the Genus database with same CATH topology
 4KK2 A;  3LLW A;  2E90 A;  3KRO B;  1WKZ A;  3VJ9 A;  3WCA A;  1HM4 A;  2Z4X A;  5ERM A;  1WL3 A;  1FPS A;  4PVY F;  2DH4 A;  1N1Z A;  4NKF A;  3SAE A;  2E4O A;  4KVY A;  2EWG A;  3KB9 A;  3KRC A;  3N1W F;  5IKA A;  5JV2 F;  5ILY A;  3NPK A;  4MC8 A;  4P0V A;  3SDT A;  2PS5 A;  5IM1 A;  3N45 F;  1HX9 A;  1JFG A;  4JYX A;  4NG6 A;  4LLS A;  2F92 F;  5EAS A;  4KUX A;  3LSN A;  3N1V F;  1UBW A;  5JUZ F;  3LDW A;  4EA0 A;  4LUU A;  4KPJ A;  1YYT A;  4ZQ8 A;  3NF2 A;  3KRC B;  4LPG F;  1DGP A;  3PYB A;  4NKE A;  4E1E A;  3ADZ A;  4K10 A;  4KWD A;  4H5D F;  3WCB A;  5ERN A;  5ILH A;  4DXJ A;  2E92 A;  5HN8 A;  2AZK A;  2E93 A;  3LK5 A;  3W7F A;  1VG6 A;  4DZW A;  3G4D A;  4JZB A;  5B0I A;  5AEL A;  3G4F A;  4XQR F;  3PDE A;  4JXN A;  2Z50 A;  4LPH F;  4JZX A;  5DIQ F;  5ILD A;  5E8H A;  2F9K F;  4N1Z F;  4KKM A;  5HN9 A;  5B0K A;  3WEK A;  2Z7H A;  3SDR A;  1HXC A;  4PVX F;  4LIX A;  3ACX A;  2ZCO A;  4H5E F;  3N0F A;  3WEI A;  4DWB A;  2Z4V A;  4LLT A;  3KBK A;  1N23 A;  3S4J A;  2OPM A;  5I1U A;  3WJO A;  4LOB A;  3N3L F;  2PS7 A;  3ACW A;  4WK5 A;  3WC9 A;  5IL8 A;  3IBA A;  4DI5 A;  4LTV A;  2F8Z F;  1V4J A;  1N24 A;  4KQ5 A;  5JV1 F;  3S9V A;  1PS1 A;  3LJI A;  4LFG A;  5ILI A;  1UBY A;  1YV5 A;  3RBM A;  2PS6 A;  3WJN A;  4LZ0 A;  1WL2 A;  4NFJ F;  4NUA A;  5DHI A;  3AE0 A;  5IK0 A;  3M9U A;  2PS4 A;  1UBX A;  3P41 A;  3ASX A;  3UCA A;  1N20 A;  3CKE A;  3NPR A;  4GP2 A;  3VJ8 A;  3N3D A;  1JFA A;  2E8X A;  2Z4Y A;  1VG4 A;  5CG6 A;  3ZCD A;  1EZF A;  1WL0 A;  2Z4Z A;  5DZ2 A;  5EAU A;  5AYP A;  3Q1O A;  3RYE A;  2H8O A;  2E91 A;  3ACY A;  4RXC A;  3TFN A;  1UBV A;  2P1C A;  5DGN F;  5JA0 F;  5C05 A;  3WCC A;  3DYF A;  3ICZ A;  3KRA A;  3ZMC A;  2Q9Y A;  4DHD A;  2OA6 A;  3IPI A;  2AZJ A;  3EGT A;  3LZ9 A;  3QQV A;  1RQI A;  3N5J F;  3ICM A;  4DEM F;  4Q23 A;  5B03 A;  3N5H F;  3WSB A;  3PH7 A;  3WEF A;  3M01 A;  3N46 F;  3CP6 A;  2FTZ A;  3LOM A;  3WE9 A;  5H9D A;  4NFI F;  2F94 F;  3LGZ B;  1VG7 A;  3ZMB A;  2ZCS A;  4H5C F;  3N0G A;  2Z7I A;  1V4H A;  5B0J A;  5DJP F;  3KRP A;  3KRA B;  3P5R A;  4FJQ A;  3P5P A;  1KIZ A;  4E9Z A;  2J1O A;  3ID0 A;  3Q2Z A;  4GA3 A;  4LZC A;  3LMD A;  2O1O A;  1DI1 A;  1N1B A;  3N49 F;  4UMJ A;  4E9U A;  4F6V A;  1HM7 A;  4XQS F;  2F7M F;  2QIS A;  1V4K A;  3ICK A;  1N22 A;  3WEG A;  5IVG A;  2Z78 A;  3WCE A;  2AET A;  5IL3 A;  4GAX A;  5E8K A;  3ICN A;  3WEH A;  1WL1 A;  2E95 A;  1VG3 A;  2AEK A;  3KRP B;  5DHK A;  4LA6 A;  3V1V A;  4KVI A;  4KQS A;  1N21 A;  2Q80 A;  4RXE A;  4OKM A;  1KIY A;  4LA5 A;  5IMP A;  1YHK A;  5IMN A;  2ZEV A;  5ERO A;  3LGK A;  1YQ7 A;  3VJA A;  3DYG A;  5B00 A;  2E8W A;  3OYR A;  4RXD A;  4DWG A;  3OAC A;  3CC9 A;  3Q30 A;  5DJR F;  5KSX F;  4MC3 A;  1YYQ A;  2PS8 A;  3KRF A;  5A0J A;  4HD1 A;  3P8R A;  2RAH A;  3BNY A;  3APZ A;  5B02 A;  3P8L A;  5AHU B;  2I19 A;  3WCJ A;  3RYW A;  3M02 A;  4LFV F;  2ZY1 A;  3MZV A;  4LZ3 A;  1RQJ A;  4L2X F;  4KVD A;  2J1P A;  3TFP A;  3OAC B;  5IMI A;  4LFE A;  4P0X A;  3ZL6 A;  4N9U A;  5DGS F;  3SDV A;  3V1X A;  3KRF B;  2FOR A;  4EA2 A;  3AQ0 A;  4LXW A;  1ZW5 A;  1WY0 A;  5JV0 F;  4OMH A;  4QXS F;  1YYS A;  5E8L A;  5IKH A;  2ONH A;  5A0K A;  3WEJ A;  5IK9 A;  3OAB A;  5HNA A;  4OKZ A;  2E94 A;  3Q2Q A;  2F8C F;  1YYR A;  1V4E A;  2AZL A;  2Q58 A;  1V4I A;  3WSA A;  3WCH A;  4RNQ A;  5EAT A;  2VF6 A;  1RTR A;  4F6X A;  3NRI A;  5IN8 A;  1HXG A;  3B7L A;  3WCF A;  4OGU A;  3TC1 A;  5DJV F;  1YHL A;  4XQT F;  3PKO A;  5ILJ A;  2Z4W A;  3OAB B;  4OMG A;  4JXY A;  3RMG A;  3QKC A;  3VJB A;  5DGM F;  4FP4 A;  2OGD A;  5HN7 A;  3N6K F;  5DW7 A;  4KQU A;  2Z52 A;  1YJ4 A;  4NFK F;  2E8V A;  3ZOU A;  3VJC A;  5ILK A;  3DYH A;  1HXA A;  1YYU A;  3AQB B;  5B01 A;  5ER8 A;  3LEE A;  3WCI A;  3MAV A;  3WCL A;  1YHM A;  4EA1 A;  4QPF A;  3LVS A;  4GP1 A;  5B0M A;  3VJE A;  4LTZ A;  3M00 A;  3BNX A;  3PYA A;  2OPN A;  3VJD A;  3EZ3 A;  3KRO A;  4KVW A;  3V66 A;  5A0I A;  2E8U A;  5B0L A;  3TFV A;  3WCD A;  1VG2 A;  2E8T A;  3M0G A;  3WCM A;  3WCG A;  2Q9Z A;  2ZCR A;  4RXA A;  4MC0 A;  3AQC B;  3TS7 A;  4KFA A;  1WMW A;  3SDQ A;  3EFQ A;  5CG5 A;  4P0W A;  5AFX A;  4F62 A;  2ONG A;  2ZCQ A;  5IK6 A;  2F89 F;  2J5C A;  2ZEU A;  5ILZ A;  4KPD A;  3SDU A;  2AEL A;  3LG5 A;  4RYP A;  3WJK A;  4JVJ F; 
#chains in the Genus database with same CATH homology
 4KK2 A;  3LLW A;  2E90 A;  3KRO B;  1WKZ A;  3VJ9 A;  3WCA A;  1HM4 A;  2Z4X A;  5ERM A;  1WL3 A;  1FPS A;  4PVY F;  2DH4 A;  1N1Z A;  4NKF A;  3SAE A;  2E4O A;  4KVY A;  2EWG A;  3KB9 A;  3KRC A;  3N1W F;  5IKA A;  5JV2 F;  5ILY A;  3NPK A;  4MC8 A;  4P0V A;  3SDT A;  2PS5 A;  5IM1 A;  3N45 F;  1HX9 A;  1JFG A;  4JYX A;  4NG6 A;  4LLS A;  2F92 F;  5EAS A;  4KUX A;  3LSN A;  3N1V F;  1UBW A;  5JUZ F;  3LDW A;  4EA0 A;  4LUU A;  4KPJ A;  1YYT A;  4ZQ8 A;  3NF2 A;  3KRC B;  4LPG F;  1DGP A;  3PYB A;  4NKE A;  4E1E A;  3ADZ A;  4K10 A;  4KWD A;  4H5D F;  3WCB A;  5ERN A;  5ILH A;  4DXJ A;  2E92 A;  5HN8 A;  2AZK A;  2E93 A;  3LK5 A;  3W7F A;  1VG6 A;  4DZW A;  3G4D A;  4JZB A;  5B0I A;  5AEL A;  3G4F A;  4XQR F;  3PDE A;  4JXN A;  2Z50 A;  4LPH F;  4JZX A;  5DIQ F;  5ILD A;  5E8H A;  2F9K F;  4N1Z F;  4KKM A;  5HN9 A;  5B0K A;  3WEK A;  2Z7H A;  3SDR A;  1HXC A;  4PVX F;  4LIX A;  3ACX A;  2ZCO A;  4H5E F;  3N0F A;  3WEI A;  4DWB A;  2Z4V A;  4LLT A;  3KBK A;  1N23 A;  3S4J A;  2OPM A;  5I1U A;  3WJO A;  4LOB A;  3N3L F;  2PS7 A;  3ACW A;  4WK5 A;  3WC9 A;  5IL8 A;  3IBA A;  4DI5 A;  4LTV A;  2F8Z F;  1V4J A;  1N24 A;  4KQ5 A;  5JV1 F;  3S9V A;  1PS1 A;  3LJI A;  4LFG A;  5ILI A;  1UBY A;  1YV5 A;  3RBM A;  2PS6 A;  3WJN A;  4LZ0 A;  1WL2 A;  4NFJ F;  4NUA A;  5DHI A;  3AE0 A;  5IK0 A;  3M9U A;  2PS4 A;  1UBX A;  3P41 A;  3ASX A;  3UCA A;  1N20 A;  3CKE A;  3NPR A;  4GP2 A;  3VJ8 A;  3N3D A;  1JFA A;  2E8X A;  2Z4Y A;  1VG4 A;  5CG6 A;  3ZCD A;  1EZF A;  1WL0 A;  2Z4Z A;  5DZ2 A;  5EAU A;  5AYP A;  3Q1O A;  3RYE A;  2H8O A;  2E91 A;  3ACY A;  4RXC A;  3TFN A;  1UBV A;  2P1C A;  5DGN F;  5JA0 F;  5C05 A;  3WCC A;  3DYF A;  3ICZ A;  3KRA A;  3ZMC A;  2Q9Y A;  4DHD A;  2OA6 A;  3IPI A;  2AZJ A;  3EGT A;  3LZ9 A;  3QQV A;  1RQI A;  3N5J F;  3ICM A;  4DEM F;  4Q23 A;  5B03 A;  3N5H F;  3WSB A;  3PH7 A;  3WEF A;  3M01 A;  3N46 F;  3CP6 A;  2FTZ A;  3LOM A;  3WE9 A;  5H9D A;  4NFI F;  2F94 F;  3LGZ B;  1VG7 A;  3ZMB A;  2ZCS A;  4H5C F;  3N0G A;  2Z7I A;  1V4H A;  5B0J A;  5DJP F;  3KRP A;  3KRA B;  3P5R A;  4FJQ A;  3P5P A;  1KIZ A;  4E9Z A;  2J1O A;  3ID0 A;  3Q2Z A;  4GA3 A;  4LZC A;  3LMD A;  2O1O A;  1DI1 A;  1N1B A;  3N49 F;  4UMJ A;  4E9U A;  4F6V A;  1HM7 A;  4XQS F;  2F7M F;  2QIS A;  1V4K A;  3ICK A;  1N22 A;  3WEG A;  5IVG A;  2Z78 A;  3WCE A;  2AET A;  5IL3 A;  4GAX A;  5E8K A;  3ICN A;  3WEH A;  1WL1 A;  2E95 A;  1VG3 A;  2AEK A;  3KRP B;  5DHK A;  4LA6 A;  3V1V A;  4KVI A;  4KQS A;  1N21 A;  2Q80 A;  4RXE A;  4OKM A;  1KIY A;  4LA5 A;  5IMP A;  1YHK A;  5IMN A;  2ZEV A;  5ERO A;  3LGK A;  1YQ7 A;  3VJA A;  3DYG A;  5B00 A;  2E8W A;  3OYR A;  4RXD A;  4DWG A;  3OAC A;  3CC9 A;  3Q30 A;  5DJR F;  5KSX F;  4MC3 A;  1YYQ A;  2PS8 A;  3KRF A;  5A0J A;  4HD1 A;  3P8R A;  2RAH A;  3BNY A;  3APZ A;  5B02 A;  3P8L A;  5AHU B;  2I19 A;  3WCJ A;  3RYW A;  3M02 A;  4LFV F;  2ZY1 A;  3MZV A;  4LZ3 A;  1RQJ A;  4L2X F;  4KVD A;  2J1P A;  3TFP A;  3OAC B;  5IMI A;  4LFE A;  4P0X A;  3ZL6 A;  4N9U A;  5DGS F;  3SDV A;  3V1X A;  3KRF B;  2FOR A;  4EA2 A;  3AQ0 A;  4LXW A;  1ZW5 A;  1WY0 A;  5JV0 F;  4OMH A;  4QXS F;  1YYS A;  5E8L A;  5IKH A;  2ONH A;  5A0K A;  3WEJ A;  5IK9 A;  3OAB A;  5HNA A;  4OKZ A;  2E94 A;  3Q2Q A;  2F8C F;  1YYR A;  1V4E A;  2AZL A;  2Q58 A;  1V4I A;  3WSA A;  3WCH A;  4RNQ A;  5EAT A;  2VF6 A;  1RTR A;  4F6X A;  3NRI A;  5IN8 A;  1HXG A;  3B7L A;  3WCF A;  4OGU A;  3TC1 A;  5DJV F;  1YHL A;  4XQT F;  3PKO A;  5ILJ A;  2Z4W A;  3OAB B;  4OMG A;  4JXY A;  3RMG A;  3QKC A;  3VJB A;  5DGM F;  4FP4 A;  2OGD A;  5HN7 A;  3N6K F;  5DW7 A;  4KQU A;  2Z52 A;  1YJ4 A;  4NFK F;  2E8V A;  3ZOU A;  3VJC A;  5ILK A;  3DYH A;  1HXA A;  1YYU A;  3AQB B;  5B01 A;  5ER8 A;  3LEE A;  3WCI A;  3MAV A;  3WCL A;  1YHM A;  4EA1 A;  4QPF A;  3LVS A;  4GP1 A;  5B0M A;  3VJE A;  4LTZ A;  3M00 A;  3BNX A;  3PYA A;  2OPN A;  3VJD A;  3EZ3 A;  3KRO A;  4KVW A;  3V66 A;  5A0I A;  2E8U A;  5B0L A;  3TFV A;  3WCD A;  1VG2 A;  2E8T A;  3M0G A;  3WCM A;  3WCG A;  2Q9Z A;  2ZCR A;  4RXA A;  4MC0 A;  3AQC B;  3TS7 A;  4KFA A;  1WMW A;  3SDQ A;  3EFQ A;  5CG5 A;  4P0W A;  5AFX A;  4F62 A;  2ONG A;  2ZCQ A;  5IK6 A;  2F89 F;  2J5C A;  2ZEU A;  5ILZ A;  4KPD A;  3SDU A;  2AEL A;  3LG5 A;  4RYP A;  3WJK A;  4JVJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...