2I19A

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
367
structure length
367
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLSPNNNGEEDDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyl pyrophosphate synthase
publication title Solid-state NMR, crystallographic, and computational investigation of bisphosphonates and farnesyl diphosphate synthase-bisphosphonate complexes.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 133
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2006-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2i19A00
3RYWA 3LK5A 3M01A 4RXAA 4JZBA 5B00A 3V1VA 4GA3A 3PYBA 4XQRF 3TFNA 3N46F 4DXJA 4JXYA 5JUZF 2PS7A 4WK5A 1N22A 4LLSA 1HM7A 4FP4A 3B7LA 1YYRA 3ZCDA 5DGNF 2E8TA 2PS5A 3KBKA 3QKCA 2E95A 3SDVA 4DWBA 5DZ2A 2J1OA 3S4JA 2F8CF 2ONGA 3IBAA 2Z78A 4LXWA 1WL1A 5EASA 4OMHA 4RNQA 3WCIA 3ACWA 5IK9A 3VJDA 2EWGA 3TS7A 3WCHA 5ILZA 5B0LA 4GP1A 4NKEA 1HXAA 3WC9A 2AELA 3IPIA 3WJNA 3OACA 4KPDA 5H9DA 4L2XF 1UBWA 1HXGA 2E92A 3VJ9A 2Z7HA 4LLTA 3WSBA 3KRCB 5I1UA 3EFQA 4KKMA 3Q2QA 4XQSF 5ERNA 3PH7A 3SDQA 5ILJA 1PS1A 4MC3A 3QQVA 1YJ4A 3N3DA 4K10A 3RBMA 5IL8A 3LMDA 2Z4ZA 3TFVA 2AZJA 3WCJA 2F92F 2PS6A 5B03A 3KRPA 4E9ZA 1YHLA 2QISA 3ZL6A 1HM4A 4H5CF 3WEGA 1YYTA 3MAVA 5HN7A 2AETA 3WCAA 3LLWA 3NF2A 3KRFA 5ILYA 3WCGA 3ID0A 4FJQA 3RMGA 4LZ0A 5ER8A 2E8WA 4P0XA 3LGKA 5IMNA 2AZKA 3NRIA 3EGTA 2E91A 2AEKA 5AHUB 3P5PA 4RXCA 3ZMCA 1DGPA 1YYQA 3N3LF 4H5DF 2F89F 4QPFA 3LEEA 4LZCA 2Q9ZA 4JXNA 4LA6A 5DHIA 2Z52A 3P41A 5A0KA 2PS8A 1YHMA 5A0IA 5JV2F 2F7MF 4JVJF 5JV0F 4KQUA 4KK2A 3APZA 3VJ8A 5DW7A 2Z4YA 4JZXA 2ZEUA 2E90A 4LPGF 1N23A 1V4IA 3LZ9A 3P8RA 3P8LA 5DIQF 4RXDA 2Q9YA 4LIXA 4DEMF 3VJCA 2OPNA 3AQCB 4GP2A 3WCBA 4LZ3A 1UBVA 2P1CA 2Z4VA 3N49F 5DGSF 2F94F 3DYGA 4PVXF 3BNXA 3ICNA 1ZW5A 3TFPA 2F9KF 1RTRA 3WSAA 5CG6A 3OYRA 5EROA 2J1PA 4NFJF 3CP6A 3G4FA 2PS4A 3LOMA 3W7FA 4GAXA 1WL2A 1N21A 1HX9A 5DJPF 2RAHA 4KVYA 3N45F 3N1WF 4MC0A 4ZQ8A 2ZCSA 4RYPA 1N1BA 3LGZB 4UMJA 3KRAB 5ILDA 2OA6A 4LFEA 4H5EF 5ERMA 5B0IA 2VF6A 3N1VF 3N6KF 5ILHA 5DJRF 4EA2A 1KIZA 2Z50A 5IL3A 3NPKA 5EATA 5IMPA 2Z4XA 3LG5A 3N0FA 2ZCRA 3WCCA 5E8LA 3V66A 5AFXA 4NUAA 3OACB 3BNYA 5E8KA 4KVDA 1YQ7A 3WJKA 2AZLA 3WCFA 5IMIA 5IN8A 3WEHA 3OABA 3VJAA 3ASXA 4LTVA 1FPSA 1V4KA 1VG6A 3ACXA 1V4EA 4OKZA 4KPJA 3DYHA 5IK6A 3WEFA 3SAEA 3LDWA 4OKMA 3KRPB 1VG4A 3M02A 2E4OA 3N5HF 2E8XA 5B0KA 3RYEA 1WKZA 3PKOA 2ZCOA 3UCAA 3SDRA 5DGMF 2I19A 1N1ZA 1N24A 1JFGA 1V4HA 1V4JA 4P0WA 4LPHF 5DHKA 5EAUA 3KB9A 3ICKA 3KRFB 4OMGA 3N5JF 4KUXA 3ACYA 4KVIA 3AQ0A 1WMWA 3ADZA 3WCMA 2J5CA 4LTZA 3KROB 5JA0F 3LVSA 1YYSA 3VJBA 3DYFA 5ILKA 3ICMA 5KSXF 4F62A 3PDEA 4N1ZF 2FTZA 3CC9A 5B0MA 5IVGA 2ZY1A 4NFKF 2Q58A 3WCEA 4NFIF 3WEIA 4HD1A 3SDUA 1HXCA 3KRCA 4XQTF 2E93A 1KIYA 5B0JA 3G4DA 3Q30A 5AYPA 2O1OA 1UBYA 5A0JA 3KRAA 1UBXA 5IKHA 4OGUA 5C05A 4LFGA 2E94A 4P0VA 3Q1OA 2H8OA 4KWDA 1EZFA 4DI5A 3WEKA 3VJEA 4LFVF 4LA5A 1WY0A 5DJVF 2FORA 3V1XA 3ZMBA 2OPMA 1YHKA 3ICZA 5JV1F 4KQSA 5E8HA 2ONHA 4E9UA 3TC1A 3Q2ZA 3LSNA 4NG6A 3AQBB 4RXEA 3WJOA 3P5RA 3M9UA 5IKAA 4PVYF 3ZOUA 1VG7A 4N9UA 2DH4A 1N20A 1WL0A 1DI1A 5IK0A 4KFAA 3AE0A 3NPRA 4F6XA 5HNAA 5B02A 4QXSF 3S9VA 3LJIA 1WL3A 4DZWA 5IM1A 3WCDA 5HN8A 2E8VA 4EA0A 5B01A 3PYAA 4F6VA 4MC8A 4JYXA 4LUUA 4KQ5A 1VG2A 1RQJA 3N0GA 4E1EA 3MZVA 3EZ3A 2F8ZF 1RQIA 3KROA 2OGDA 4EA1A 5CG5A 4NKFA 3WCLA 3CKEA 1JFAA 1VG3A 5HN9A 3SDTA 2Z4WA 2Q80A 4LOBA 2ZEVA 3M00A 5AELA 3M0GA 3WE9A 2Z7IA 4Q23A 5ILIA 1YYUA 1YV5A 2E8UA 3OABB 3WEJA 4KVWA 2ZCQA 4DWGA 4DHDA
chains in the Genus database with same CATH superfamily
3RYWA 3LK5A 3M01A 4RXAA 4JZBA 5B00A 3V1VA 4GA3A 3PYBA 4XQRF 3TFNA 3N46F 4DXJA 4JXYA 5JUZF 2PS7A 4WK5A 1N22A 4LLSA 1HM7A 4FP4A 3B7LA 1YYRA 3ZCDA 5DGNF 2E8TA 2PS5A 3KBKA 3QKCA 2E95A 3SDVA 4DWBA 5DZ2A 2J1OA 3S4JA 2F8CF 2ONGA 3IBAA 2Z78A 4LXWA 1WL1A 5EASA 4OMHA 4RNQA 3WCIA 3ACWA 5IK9A 3VJDA 2EWGA 3TS7A 3WCHA 5ILZA 5B0LA 4GP1A 4NKEA 1HXAA 3WC9A 2AELA 3IPIA 3WJNA 3OACA 4KPDA 5H9DA 4L2XF 1UBWA 1HXGA 2E92A 3VJ9A 2Z7HA 4LLTA 3WSBA 3KRCB 5I1UA 3EFQA 4KKMA 3Q2QA 4XQSF 5ERNA 3PH7A 3SDQA 5ILJA 1PS1A 4MC3A 3QQVA 1YJ4A 3N3DA 4K10A 3RBMA 5IL8A 3LMDA 2Z4ZA 3TFVA 2AZJA 3WCJA 2F92F 2PS6A 5B03A 3KRPA 4E9ZA 1YHLA 2QISA 3ZL6A 1HM4A 4H5CF 3WEGA 1YYTA 3MAVA 5HN7A 2AETA 3WCAA 3LLWA 3NF2A 3KRFA 5ILYA 3WCGA 3ID0A 4FJQA 3RMGA 4LZ0A 5ER8A 2E8WA 4P0XA 3LGKA 5IMNA 2AZKA 3NRIA 3EGTA 2E91A 2AEKA 5AHUB 3P5PA 4RXCA 3ZMCA 1DGPA 1YYQA 3N3LF 4H5DF 2F89F 4QPFA 3LEEA 4LZCA 2Q9ZA 4JXNA 4LA6A 5DHIA 2Z52A 3P41A 5A0KA 2PS8A 1YHMA 5A0IA 5JV2F 2F7MF 4JVJF 5JV0F 4KQUA 4KK2A 3APZA 3VJ8A 5DW7A 2Z4YA 4JZXA 2ZEUA 2E90A 4LPGF 1N23A 1V4IA 3LZ9A 3P8RA 3P8LA 5DIQF 4RXDA 2Q9YA 4LIXA 4DEMF 3VJCA 2OPNA 3AQCB 4GP2A 3WCBA 4LZ3A 1UBVA 2P1CA 2Z4VA 3N49F 5DGSF 2F94F 3DYGA 4PVXF 3BNXA 3ICNA 1ZW5A 3TFPA 2F9KF 1RTRA 3WSAA 5CG6A 3OYRA 5EROA 2J1PA 4NFJF 3CP6A 3G4FA 2PS4A 3LOMA 3W7FA 4GAXA 1WL2A 1N21A 1HX9A 5DJPF 2RAHA 4KVYA 3N45F 3N1WF 4MC0A 4ZQ8A 2ZCSA 4RYPA 1N1BA 3LGZB 4UMJA 3KRAB 5ILDA 2OA6A 4LFEA 4H5EF 5ERMA 5B0IA 2VF6A 3N1VF 3N6KF 5ILHA 5DJRF 4EA2A 1KIZA 2Z50A 5IL3A 3NPKA 5EATA 5IMPA 2Z4XA 3LG5A 3N0FA 2ZCRA 3WCCA 5E8LA 3V66A 5AFXA 4NUAA 3OACB 3BNYA 5E8KA 4KVDA 1YQ7A 3WJKA 2AZLA 3WCFA 5IMIA 5IN8A 3WEHA 3OABA 3VJAA 3ASXA 4LTVA 1FPSA 1V4KA 1VG6A 3ACXA 1V4EA 4OKZA 4KPJA 3DYHA 5IK6A 3WEFA 3SAEA 3LDWA 4OKMA 3KRPB 1VG4A 3M02A 2E4OA 3N5HF 2E8XA 5B0KA 3RYEA 1WKZA 3PKOA 2ZCOA 3UCAA 3SDRA 5DGMF 2I19A 1N1ZA 1N24A 1JFGA 1V4HA 1V4JA 4P0WA 4LPHF 5DHKA 5EAUA 3KB9A 3ICKA 3KRFB 4OMGA 3N5JF 4KUXA 3ACYA 4KVIA 3AQ0A 1WMWA 3ADZA 3WCMA 2J5CA 4LTZA 3KROB 5JA0F 3LVSA 1YYSA 3VJBA 3DYFA 5ILKA 3ICMA 5KSXF 4F62A 3PDEA 4N1ZF 2FTZA 3CC9A 5B0MA 5IVGA 2ZY1A 4NFKF 2Q58A 3WCEA 4NFIF 3WEIA 4HD1A 3SDUA 1HXCA 3KRCA 4XQTF 2E93A 1KIYA 5B0JA 3G4DA 3Q30A 5AYPA 2O1OA 1UBYA 5A0JA 3KRAA 1UBXA 5IKHA 4OGUA 5C05A 4LFGA 2E94A 4P0VA 3Q1OA 2H8OA 4KWDA 1EZFA 4DI5A 3WEKA 3VJEA 4LFVF 4LA5A 1WY0A 5DJVF 2FORA 3V1XA 3ZMBA 2OPMA 1YHKA 3ICZA 5JV1F 4KQSA 5E8HA 2ONHA 4E9UA 3TC1A 3Q2ZA 3LSNA 4NG6A 3AQBB 4RXEA 3WJOA 3P5RA 3M9UA 5IKAA 4PVYF 3ZOUA 1VG7A 4N9UA 2DH4A 1N20A 1WL0A 1DI1A 5IK0A 4KFAA 3AE0A 3NPRA 4F6XA 5HNAA 5B02A 4QXSF 3S9VA 3LJIA 1WL3A 4DZWA 5IM1A 3WCDA 5HN8A 2E8VA 4EA0A 5B01A 3PYAA 4F6VA 4MC8A 4JYXA 4LUUA 4KQ5A 1VG2A 1RQJA 3N0GA 4E1EA 3MZVA 3EZ3A 2F8ZF 1RQIA 3KROA 2OGDA 4EA1A 5CG5A 4NKFA 3WCLA 3CKEA 1JFAA 1VG3A 5HN9A 3SDTA 2Z4WA 2Q80A 4LOBA 2ZEVA 3M00A 5AELA 3M0GA 3WE9A 2Z7IA 4Q23A 5ILIA 1YYUA 1YV5A 2E8UA 3OABB 3WEJA 4KVWA 2ZCQA 4DWGA 4DHDA
chains in the Genus database with same CATH topology
3RYWA 3LK5A 3M01A 4RXAA 4JZBA 5B00A 3V1VA 4GA3A 3PYBA 4XQRF 3TFNA 3N46F 4DXJA 4JXYA 5JUZF 2PS7A 4WK5A 1N22A 4LLSA 1HM7A 4FP4A 3B7LA 1YYRA 3ZCDA 5DGNF 2E8TA 2PS5A 3KBKA 3QKCA 2E95A 3SDVA 4DWBA 5DZ2A 2J1OA 3S4JA 2F8CF 2ONGA 3IBAA 2Z78A 4LXWA 1WL1A 5EASA 4OMHA 4RNQA 3WCIA 3ACWA 5IK9A 3VJDA 2EWGA 3TS7A 3WCHA 5ILZA 5B0LA 4GP1A 4NKEA 1HXAA 3WC9A 2AELA 3IPIA 3WJNA 3OACA 4KPDA 5H9DA 4L2XF 1UBWA 1HXGA 2E92A 3VJ9A 2Z7HA 4LLTA 3WSBA 3KRCB 5I1UA 3EFQA 4KKMA 3Q2QA 4XQSF 5ERNA 3PH7A 3SDQA 5ILJA 1PS1A 4MC3A 3QQVA 1YJ4A 3N3DA 4K10A 3RBMA 5IL8A 3LMDA 2Z4ZA 3TFVA 2AZJA 3WCJA 2F92F 2PS6A 5B03A 3KRPA 4E9ZA 1YHLA 2QISA 3ZL6A 1HM4A 4H5CF 3WEGA 1YYTA 3MAVA 5HN7A 2AETA 3WCAA 3LLWA 3NF2A 3KRFA 5ILYA 3WCGA 3ID0A 4FJQA 3RMGA 4LZ0A 5ER8A 2E8WA 4P0XA 3LGKA 5IMNA 2AZKA 3NRIA 3EGTA 2E91A 2AEKA 5AHUB 3P5PA 4RXCA 3ZMCA 1DGPA 1YYQA 3N3LF 4H5DF 2F89F 4QPFA 3LEEA 4LZCA 2Q9ZA 4JXNA 4LA6A 5DHIA 2Z52A 3P41A 5A0KA 2PS8A 1YHMA 5A0IA 5JV2F 2F7MF 4JVJF 5JV0F 4KQUA 4KK2A 3APZA 3VJ8A 5DW7A 2Z4YA 4JZXA 2ZEUA 2E90A 4LPGF 1N23A 1V4IA 3LZ9A 3P8RA 3P8LA 5DIQF 4RXDA 2Q9YA 4LIXA 4DEMF 3VJCA 2OPNA 3AQCB 4GP2A 3WCBA 4LZ3A 1UBVA 2P1CA 2Z4VA 3N49F 5DGSF 2F94F 3DYGA 4PVXF 3BNXA 3ICNA 1ZW5A 3TFPA 2F9KF 1RTRA 3WSAA 5CG6A 3OYRA 5EROA 2J1PA 4NFJF 3CP6A 3G4FA 2PS4A 3LOMA 3W7FA 4GAXA 1WL2A 1N21A 1HX9A 5DJPF 2RAHA 4KVYA 3N45F 3N1WF 4MC0A 4ZQ8A 2ZCSA 4RYPA 1N1BA 3LGZB 4UMJA 3KRAB 5ILDA 2OA6A 4LFEA 4H5EF 5ERMA 5B0IA 2VF6A 3N1VF 3N6KF 5ILHA 5DJRF 4EA2A 1KIZA 2Z50A 5IL3A 3NPKA 5EATA 5IMPA 2Z4XA 3LG5A 3N0FA 2ZCRA 3WCCA 5E8LA 3V66A 5AFXA 4NUAA 3OACB 3BNYA 5E8KA 4KVDA 1YQ7A 3WJKA 2AZLA 3WCFA 5IMIA 5IN8A 3WEHA 3OABA 3VJAA 3ASXA 4LTVA 1FPSA 1V4KA 1VG6A 3ACXA 1V4EA 4OKZA 4KPJA 3DYHA 5IK6A 3WEFA 3SAEA 3LDWA 4OKMA 3KRPB 1VG4A 3M02A 2E4OA 3N5HF 2E8XA 5B0KA 3RYEA 1WKZA 3PKOA 2ZCOA 3UCAA 3SDRA 5DGMF 2I19A 1N1ZA 1N24A 1JFGA 1V4HA 1V4JA 4P0WA 4LPHF 5DHKA 5EAUA 3KB9A 3ICKA 3KRFB 4OMGA 3N5JF 4KUXA 3ACYA 4KVIA 3AQ0A 1WMWA 3ADZA 3WCMA 2J5CA 4LTZA 3KROB 5JA0F 3LVSA 1YYSA 3VJBA 3DYFA 5ILKA 3ICMA 5KSXF 4F62A 3PDEA 4N1ZF 2FTZA 3CC9A 5B0MA 5IVGA 2ZY1A 4NFKF 2Q58A 3WCEA 4NFIF 3WEIA 4HD1A 3SDUA 1HXCA 3KRCA 4XQTF 2E93A 1KIYA 5B0JA 3G4DA 3Q30A 5AYPA 2O1OA 1UBYA 5A0JA 3KRAA 1UBXA 5IKHA 4OGUA 5C05A 4LFGA 2E94A 4P0VA 3Q1OA 2H8OA 4KWDA 1EZFA 4DI5A 3WEKA 3VJEA 4LFVF 4LA5A 1WY0A 5DJVF 2FORA 3V1XA 3ZMBA 2OPMA 1YHKA 3ICZA 5JV1F 4KQSA 5E8HA 2ONHA 4E9UA 3TC1A 3Q2ZA 3LSNA 4NG6A 3AQBB 4RXEA 3WJOA 3P5RA 3M9UA 5IKAA 4PVYF 3ZOUA 1VG7A 4N9UA 2DH4A 1N20A 1WL0A 1DI1A 5IK0A 4KFAA 3AE0A 3NPRA 4F6XA 5HNAA 5B02A 4QXSF 3S9VA 3LJIA 1WL3A 4DZWA 5IM1A 3WCDA 5HN8A 2E8VA 4EA0A 5B01A 3PYAA 4F6VA 4MC8A 4JYXA 4LUUA 4KQ5A 1VG2A 1RQJA 3N0GA 4E1EA 3MZVA 3EZ3A 2F8ZF 1RQIA 3KROA 2OGDA 4EA1A 5CG5A 4NKFA 3WCLA 3CKEA 1JFAA 1VG3A 5HN9A 3SDTA 2Z4WA 2Q80A 4LOBA 2ZEVA 3M00A 5AELA 3M0GA 3WE9A 2Z7IA 4Q23A 5ILIA 1YYUA 1YV5A 2E8UA 3OABB 3WEJA 4KVWA 2ZCQA 4DWGA 4DHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RYW A;  3LK5 A;  3M01 A;  4RXA A;  4JZB A;  5B00 A;  3V1V A;  4GA3 A;  3PYB A;  4XQR F;  3TFN A;  3N46 F;  4DXJ A;  4JXY A;  5JUZ F;  2PS7 A;  4WK5 A;  1N22 A;  4LLS A;  1HM7 A;  4FP4 A;  3B7L A;  1YYR A;  3ZCD A;  5DGN F;  2E8T A;  2PS5 A;  3KBK A;  3QKC A;  2E95 A;  3SDV A;  4DWB A;  5DZ2 A;  2J1O A;  3S4J A;  2F8C F;  2ONG A;  3IBA A;  2Z78 A;  4LXW A;  1WL1 A;  5EAS A;  4OMH A;  4RNQ A;  3WCI A;  3ACW A;  5IK9 A;  3VJD A;  2EWG A;  3TS7 A;  3WCH A;  5ILZ A;  5B0L A;  4GP1 A;  4NKE A;  1HXA A;  3WC9 A;  2AEL A;  3IPI A;  3WJN A;  3OAC A;  4KPD A;  5H9D A;  4L2X F;  1UBW A;  1HXG A;  2E92 A;  3VJ9 A;  2Z7H A;  4LLT A;  3WSB A;  3KRC B;  5I1U A;  3EFQ A;  4KKM A;  3Q2Q A;  4XQS F;  5ERN A;  3PH7 A;  3SDQ A;  5ILJ A;  1PS1 A;  4MC3 A;  3QQV A;  1YJ4 A;  3N3D A;  4K10 A;  3RBM A;  5IL8 A;  3LMD A;  2Z4Z A;  3TFV A;  2AZJ A;  3WCJ A;  2F92 F;  2PS6 A;  5B03 A;  3KRP A;  4E9Z A;  1YHL A;  2QIS A;  3ZL6 A;  1HM4 A;  4H5C F;  3WEG A;  1YYT A;  3MAV A;  5HN7 A;  2AET A;  3WCA A;  3LLW A;  3NF2 A;  3KRF A;  5ILY A;  3WCG A;  3ID0 A;  4FJQ A;  3RMG A;  4LZ0 A;  5ER8 A;  2E8W A;  4P0X A;  3LGK A;  5IMN A;  2AZK A;  3NRI A;  3EGT A;  2E91 A;  2AEK A;  5AHU B;  3P5P A;  4RXC A;  3ZMC A;  1DGP A;  1YYQ A;  3N3L F;  4H5D F;  2F89 F;  4QPF A;  3LEE A;  4LZC A;  2Q9Z A;  4JXN A;  4LA6 A;  5DHI A;  2Z52 A;  3P41 A;  5A0K A;  2PS8 A;  1YHM A;  5A0I A;  5JV2 F;  2F7M F;  4JVJ F;  5JV0 F;  4KQU A;  4KK2 A;  3APZ A;  3VJ8 A;  5DW7 A;  2Z4Y A;  4JZX A;  2ZEU A;  2E90 A;  4LPG F;  1N23 A;  1V4I A;  3LZ9 A;  3P8R A;  3P8L A;  5DIQ F;  4RXD A;  2Q9Y A;  4LIX A;  4DEM F;  3VJC A;  2OPN A;  3AQC B;  4GP2 A;  3WCB A;  4LZ3 A;  1UBV A;  2P1C A;  2Z4V A;  3N49 F;  5DGS F;  2F94 F;  3DYG A;  4PVX F;  3BNX A;  3ICN A;  1ZW5 A;  3TFP A;  2F9K F;  1RTR A;  3WSA A;  5CG6 A;  3OYR A;  5ERO A;  2J1P A;  4NFJ F;  3CP6 A;  3G4F A;  2PS4 A;  3LOM A;  3W7F A;  4GAX A;  1WL2 A;  1N21 A;  1HX9 A;  5DJP F;  2RAH A;  4KVY A;  3N45 F;  3N1W F;  4MC0 A;  4ZQ8 A;  2ZCS A;  4RYP A;  1N1B A;  3LGZ B;  4UMJ A;  3KRA B;  5ILD A;  2OA6 A;  4LFE A;  4H5E F;  5ERM A;  5B0I A;  2VF6 A;  3N1V F;  3N6K F;  5ILH A;  5DJR F;  4EA2 A;  1KIZ A;  2Z50 A;  5IL3 A;  3NPK A;  5EAT A;  5IMP A;  2Z4X A;  3LG5 A;  3N0F A;  2ZCR A;  3WCC A;  5E8L A;  3V66 A;  5AFX A;  4NUA A;  3OAC B;  3BNY A;  5E8K A;  4KVD A;  1YQ7 A;  3WJK A;  2AZL A;  3WCF A;  5IMI A;  5IN8 A;  3WEH A;  3OAB A;  3VJA A;  3ASX A;  4LTV A;  1FPS A;  1V4K A;  1VG6 A;  3ACX A;  1V4E A;  4OKZ A;  4KPJ A;  3DYH A;  5IK6 A;  3WEF A;  3SAE A;  3LDW A;  4OKM A;  3KRP B;  1VG4 A;  3M02 A;  2E4O A;  3N5H F;  2E8X A;  5B0K A;  3RYE A;  1WKZ A;  3PKO A;  2ZCO A;  3UCA A;  3SDR A;  5DGM F;  2I19 A;  1N1Z A;  1N24 A;  1JFG A;  1V4H A;  1V4J A;  4P0W A;  4LPH F;  5DHK A;  5EAU A;  3KB9 A;  3ICK A;  3KRF B;  4OMG A;  3N5J F;  4KUX A;  3ACY A;  4KVI A;  3AQ0 A;  1WMW A;  3ADZ A;  3WCM A;  2J5C A;  4LTZ A;  3KRO B;  5JA0 F;  3LVS A;  1YYS A;  3VJB A;  3DYF A;  5ILK A;  3ICM A;  5KSX F;  4F62 A;  3PDE A;  4N1Z F;  2FTZ A;  3CC9 A;  5B0M A;  5IVG A;  2ZY1 A;  4NFK F;  2Q58 A;  3WCE A;  4NFI F;  3WEI A;  4HD1 A;  3SDU A;  1HXC A;  3KRC A;  4XQT F;  2E93 A;  1KIY A;  5B0J A;  3G4D A;  3Q30 A;  5AYP A;  2O1O A;  1UBY A;  5A0J A;  3KRA A;  1UBX A;  5IKH A;  4OGU A;  5C05 A;  4LFG A;  2E94 A;  4P0V A;  3Q1O A;  2H8O A;  4KWD A;  1EZF A;  4DI5 A;  3WEK A;  3VJE A;  4LFV F;  4LA5 A;  1WY0 A;  5DJV F;  2FOR A;  3V1X A;  3ZMB A;  2OPM A;  1YHK A;  3ICZ A;  5JV1 F;  4KQS A;  5E8H A;  2ONH A;  4E9U A;  3TC1 A;  3Q2Z A;  3LSN A;  4NG6 A;  3AQB B;  4RXE A;  3WJO A;  3P5R A;  3M9U A;  5IKA A;  4PVY F;  3ZOU A;  1VG7 A;  4N9U A;  2DH4 A;  1N20 A;  1WL0 A;  1DI1 A;  5IK0 A;  4KFA A;  3AE0 A;  3NPR A;  4F6X A;  5HNA A;  5B02 A;  4QXS F;  3S9V A;  3LJI A;  1WL3 A;  4DZW A;  5IM1 A;  3WCD A;  5HN8 A;  2E8V A;  4EA0 A;  5B01 A;  3PYA A;  4F6V A;  4MC8 A;  4JYX A;  4LUU A;  4KQ5 A;  1VG2 A;  1RQJ A;  3N0G A;  4E1E A;  3MZV A;  3EZ3 A;  2F8Z F;  1RQI A;  3KRO A;  2OGD A;  4EA1 A;  5CG5 A;  4NKF A;  3WCL A;  3CKE A;  1JFA A;  1VG3 A;  5HN9 A;  3SDT A;  2Z4W A;  2Q80 A;  4LOB A;  2ZEV A;  3M00 A;  5AEL A;  3M0G A;  3WE9 A;  2Z7I A;  4Q23 A;  5ILI A;  1YYU A;  1YV5 A;  2E8U A;  3OAB B;  3WEJ A;  4KVW A;  2ZCQ A;  4DWG A;  4DHD A; 
#chains in the Genus database with same CATH topology
 3RYW A;  3LK5 A;  3M01 A;  4RXA A;  4JZB A;  5B00 A;  3V1V A;  4GA3 A;  3PYB A;  4XQR F;  3TFN A;  3N46 F;  4DXJ A;  4JXY A;  5JUZ F;  2PS7 A;  4WK5 A;  1N22 A;  4LLS A;  1HM7 A;  4FP4 A;  3B7L A;  1YYR A;  3ZCD A;  5DGN F;  2E8T A;  2PS5 A;  3KBK A;  3QKC A;  2E95 A;  3SDV A;  4DWB A;  5DZ2 A;  2J1O A;  3S4J A;  2F8C F;  2ONG A;  3IBA A;  2Z78 A;  4LXW A;  1WL1 A;  5EAS A;  4OMH A;  4RNQ A;  3WCI A;  3ACW A;  5IK9 A;  3VJD A;  2EWG A;  3TS7 A;  3WCH A;  5ILZ A;  5B0L A;  4GP1 A;  4NKE A;  1HXA A;  3WC9 A;  2AEL A;  3IPI A;  3WJN A;  3OAC A;  4KPD A;  5H9D A;  4L2X F;  1UBW A;  1HXG A;  2E92 A;  3VJ9 A;  2Z7H A;  4LLT A;  3WSB A;  3KRC B;  5I1U A;  3EFQ A;  4KKM A;  3Q2Q A;  4XQS F;  5ERN A;  3PH7 A;  3SDQ A;  5ILJ A;  1PS1 A;  4MC3 A;  3QQV A;  1YJ4 A;  3N3D A;  4K10 A;  3RBM A;  5IL8 A;  3LMD A;  2Z4Z A;  3TFV A;  2AZJ A;  3WCJ A;  2F92 F;  2PS6 A;  5B03 A;  3KRP A;  4E9Z A;  1YHL A;  2QIS A;  3ZL6 A;  1HM4 A;  4H5C F;  3WEG A;  1YYT A;  3MAV A;  5HN7 A;  2AET A;  3WCA A;  3LLW A;  3NF2 A;  3KRF A;  5ILY A;  3WCG A;  3ID0 A;  4FJQ A;  3RMG A;  4LZ0 A;  5ER8 A;  2E8W A;  4P0X A;  3LGK A;  5IMN A;  2AZK A;  3NRI A;  3EGT A;  2E91 A;  2AEK A;  5AHU B;  3P5P A;  4RXC A;  3ZMC A;  1DGP A;  1YYQ A;  3N3L F;  4H5D F;  2F89 F;  4QPF A;  3LEE A;  4LZC A;  2Q9Z A;  4JXN A;  4LA6 A;  5DHI A;  2Z52 A;  3P41 A;  5A0K A;  2PS8 A;  1YHM A;  5A0I A;  5JV2 F;  2F7M F;  4JVJ F;  5JV0 F;  4KQU A;  4KK2 A;  3APZ A;  3VJ8 A;  5DW7 A;  2Z4Y A;  4JZX A;  2ZEU A;  2E90 A;  4LPG F;  1N23 A;  1V4I A;  3LZ9 A;  3P8R A;  3P8L A;  5DIQ F;  4RXD A;  2Q9Y A;  4LIX A;  4DEM F;  3VJC A;  2OPN A;  3AQC B;  4GP2 A;  3WCB A;  4LZ3 A;  1UBV A;  2P1C A;  2Z4V A;  3N49 F;  5DGS F;  2F94 F;  3DYG A;  4PVX F;  3BNX A;  3ICN A;  1ZW5 A;  3TFP A;  2F9K F;  1RTR A;  3WSA A;  5CG6 A;  3OYR A;  5ERO A;  2J1P A;  4NFJ F;  3CP6 A;  3G4F A;  2PS4 A;  3LOM A;  3W7F A;  4GAX A;  1WL2 A;  1N21 A;  1HX9 A;  5DJP F;  2RAH A;  4KVY A;  3N45 F;  3N1W F;  4MC0 A;  4ZQ8 A;  2ZCS A;  4RYP A;  1N1B A;  3LGZ B;  4UMJ A;  3KRA B;  5ILD A;  2OA6 A;  4LFE A;  4H5E F;  5ERM A;  5B0I A;  2VF6 A;  3N1V F;  3N6K F;  5ILH A;  5DJR F;  4EA2 A;  1KIZ A;  2Z50 A;  5IL3 A;  3NPK A;  5EAT A;  5IMP A;  2Z4X A;  3LG5 A;  3N0F A;  2ZCR A;  3WCC A;  5E8L A;  3V66 A;  5AFX A;  4NUA A;  3OAC B;  3BNY A;  5E8K A;  4KVD A;  1YQ7 A;  3WJK A;  2AZL A;  3WCF A;  5IMI A;  5IN8 A;  3WEH A;  3OAB A;  3VJA A;  3ASX A;  4LTV A;  1FPS A;  1V4K A;  1VG6 A;  3ACX A;  1V4E A;  4OKZ A;  4KPJ A;  3DYH A;  5IK6 A;  3WEF A;  3SAE A;  3LDW A;  4OKM A;  3KRP B;  1VG4 A;  3M02 A;  2E4O A;  3N5H F;  2E8X A;  5B0K A;  3RYE A;  1WKZ A;  3PKO A;  2ZCO A;  3UCA A;  3SDR A;  5DGM F;  2I19 A;  1N1Z A;  1N24 A;  1JFG A;  1V4H A;  1V4J A;  4P0W A;  4LPH F;  5DHK A;  5EAU A;  3KB9 A;  3ICK A;  3KRF B;  4OMG A;  3N5J F;  4KUX A;  3ACY A;  4KVI A;  3AQ0 A;  1WMW A;  3ADZ A;  3WCM A;  2J5C A;  4LTZ A;  3KRO B;  5JA0 F;  3LVS A;  1YYS A;  3VJB A;  3DYF A;  5ILK A;  3ICM A;  5KSX F;  4F62 A;  3PDE A;  4N1Z F;  2FTZ A;  3CC9 A;  5B0M A;  5IVG A;  2ZY1 A;  4NFK F;  2Q58 A;  3WCE A;  4NFI F;  3WEI A;  4HD1 A;  3SDU A;  1HXC A;  3KRC A;  4XQT F;  2E93 A;  1KIY A;  5B0J A;  3G4D A;  3Q30 A;  5AYP A;  2O1O A;  1UBY A;  5A0J A;  3KRA A;  1UBX A;  5IKH A;  4OGU A;  5C05 A;  4LFG A;  2E94 A;  4P0V A;  3Q1O A;  2H8O A;  4KWD A;  1EZF A;  4DI5 A;  3WEK A;  3VJE A;  4LFV F;  4LA5 A;  1WY0 A;  5DJV F;  2FOR A;  3V1X A;  3ZMB A;  2OPM A;  1YHK A;  3ICZ A;  5JV1 F;  4KQS A;  5E8H A;  2ONH A;  4E9U A;  3TC1 A;  3Q2Z A;  3LSN A;  4NG6 A;  3AQB B;  4RXE A;  3WJO A;  3P5R A;  3M9U A;  5IKA A;  4PVY F;  3ZOU A;  1VG7 A;  4N9U A;  2DH4 A;  1N20 A;  1WL0 A;  1DI1 A;  5IK0 A;  4KFA A;  3AE0 A;  3NPR A;  4F6X A;  5HNA A;  5B02 A;  4QXS F;  3S9V A;  3LJI A;  1WL3 A;  4DZW A;  5IM1 A;  3WCD A;  5HN8 A;  2E8V A;  4EA0 A;  5B01 A;  3PYA A;  4F6V A;  4MC8 A;  4JYX A;  4LUU A;  4KQ5 A;  1VG2 A;  1RQJ A;  3N0G A;  4E1E A;  3MZV A;  3EZ3 A;  2F8Z F;  1RQI A;  3KRO A;  2OGD A;  4EA1 A;  5CG5 A;  4NKF A;  3WCL A;  3CKE A;  1JFA A;  1VG3 A;  5HN9 A;  3SDT A;  2Z4W A;  2Q80 A;  4LOB A;  2ZEV A;  3M00 A;  5AEL A;  3M0G A;  3WE9 A;  2Z7I A;  4Q23 A;  5ILI A;  1YYU A;  1YV5 A;  2E8U A;  3OAB B;  3WEJ A;  4KVW A;  2ZCQ A;  4DWG A;  4DHD A; 
#chains in the Genus database with same CATH homology
 3RYW A;  3LK5 A;  3M01 A;  4RXA A;  4JZB A;  5B00 A;  3V1V A;  4GA3 A;  3PYB A;  4XQR F;  3TFN A;  3N46 F;  4DXJ A;  4JXY A;  5JUZ F;  2PS7 A;  4WK5 A;  1N22 A;  4LLS A;  1HM7 A;  4FP4 A;  3B7L A;  1YYR A;  3ZCD A;  5DGN F;  2E8T A;  2PS5 A;  3KBK A;  3QKC A;  2E95 A;  3SDV A;  4DWB A;  5DZ2 A;  2J1O A;  3S4J A;  2F8C F;  2ONG A;  3IBA A;  2Z78 A;  4LXW A;  1WL1 A;  5EAS A;  4OMH A;  4RNQ A;  3WCI A;  3ACW A;  5IK9 A;  3VJD A;  2EWG A;  3TS7 A;  3WCH A;  5ILZ A;  5B0L A;  4GP1 A;  4NKE A;  1HXA A;  3WC9 A;  2AEL A;  3IPI A;  3WJN A;  3OAC A;  4KPD A;  5H9D A;  4L2X F;  1UBW A;  1HXG A;  2E92 A;  3VJ9 A;  2Z7H A;  4LLT A;  3WSB A;  3KRC B;  5I1U A;  3EFQ A;  4KKM A;  3Q2Q A;  4XQS F;  5ERN A;  3PH7 A;  3SDQ A;  5ILJ A;  1PS1 A;  4MC3 A;  3QQV A;  1YJ4 A;  3N3D A;  4K10 A;  3RBM A;  5IL8 A;  3LMD A;  2Z4Z A;  3TFV A;  2AZJ A;  3WCJ A;  2F92 F;  2PS6 A;  5B03 A;  3KRP A;  4E9Z A;  1YHL A;  2QIS A;  3ZL6 A;  1HM4 A;  4H5C F;  3WEG A;  1YYT A;  3MAV A;  5HN7 A;  2AET A;  3WCA A;  3LLW A;  3NF2 A;  3KRF A;  5ILY A;  3WCG A;  3ID0 A;  4FJQ A;  3RMG A;  4LZ0 A;  5ER8 A;  2E8W A;  4P0X A;  3LGK A;  5IMN A;  2AZK A;  3NRI A;  3EGT A;  2E91 A;  2AEK A;  5AHU B;  3P5P A;  4RXC A;  3ZMC A;  1DGP A;  1YYQ A;  3N3L F;  4H5D F;  2F89 F;  4QPF A;  3LEE A;  4LZC A;  2Q9Z A;  4JXN A;  4LA6 A;  5DHI A;  2Z52 A;  3P41 A;  5A0K A;  2PS8 A;  1YHM A;  5A0I A;  5JV2 F;  2F7M F;  4JVJ F;  5JV0 F;  4KQU A;  4KK2 A;  3APZ A;  3VJ8 A;  5DW7 A;  2Z4Y A;  4JZX A;  2ZEU A;  2E90 A;  4LPG F;  1N23 A;  1V4I A;  3LZ9 A;  3P8R A;  3P8L A;  5DIQ F;  4RXD A;  2Q9Y A;  4LIX A;  4DEM F;  3VJC A;  2OPN A;  3AQC B;  4GP2 A;  3WCB A;  4LZ3 A;  1UBV A;  2P1C A;  2Z4V A;  3N49 F;  5DGS F;  2F94 F;  3DYG A;  4PVX F;  3BNX A;  3ICN A;  1ZW5 A;  3TFP A;  2F9K F;  1RTR A;  3WSA A;  5CG6 A;  3OYR A;  5ERO A;  2J1P A;  4NFJ F;  3CP6 A;  3G4F A;  2PS4 A;  3LOM A;  3W7F A;  4GAX A;  1WL2 A;  1N21 A;  1HX9 A;  5DJP F;  2RAH A;  4KVY A;  3N45 F;  3N1W F;  4MC0 A;  4ZQ8 A;  2ZCS A;  4RYP A;  1N1B A;  3LGZ B;  4UMJ A;  3KRA B;  5ILD A;  2OA6 A;  4LFE A;  4H5E F;  5ERM A;  5B0I A;  2VF6 A;  3N1V F;  3N6K F;  5ILH A;  5DJR F;  4EA2 A;  1KIZ A;  2Z50 A;  5IL3 A;  3NPK A;  5EAT A;  5IMP A;  2Z4X A;  3LG5 A;  3N0F A;  2ZCR A;  3WCC A;  5E8L A;  3V66 A;  5AFX A;  4NUA A;  3OAC B;  3BNY A;  5E8K A;  4KVD A;  1YQ7 A;  3WJK A;  2AZL A;  3WCF A;  5IMI A;  5IN8 A;  3WEH A;  3OAB A;  3VJA A;  3ASX A;  4LTV A;  1FPS A;  1V4K A;  1VG6 A;  3ACX A;  1V4E A;  4OKZ A;  4KPJ A;  3DYH A;  5IK6 A;  3WEF A;  3SAE A;  3LDW A;  4OKM A;  3KRP B;  1VG4 A;  3M02 A;  2E4O A;  3N5H F;  2E8X A;  5B0K A;  3RYE A;  1WKZ A;  3PKO A;  2ZCO A;  3UCA A;  3SDR A;  5DGM F;  2I19 A;  1N1Z A;  1N24 A;  1JFG A;  1V4H A;  1V4J A;  4P0W A;  4LPH F;  5DHK A;  5EAU A;  3KB9 A;  3ICK A;  3KRF B;  4OMG A;  3N5J F;  4KUX A;  3ACY A;  4KVI A;  3AQ0 A;  1WMW A;  3ADZ A;  3WCM A;  2J5C A;  4LTZ A;  3KRO B;  5JA0 F;  3LVS A;  1YYS A;  3VJB A;  3DYF A;  5ILK A;  3ICM A;  5KSX F;  4F62 A;  3PDE A;  4N1Z F;  2FTZ A;  3CC9 A;  5B0M A;  5IVG A;  2ZY1 A;  4NFK F;  2Q58 A;  3WCE A;  4NFI F;  3WEI A;  4HD1 A;  3SDU A;  1HXC A;  3KRC A;  4XQT F;  2E93 A;  1KIY A;  5B0J A;  3G4D A;  3Q30 A;  5AYP A;  2O1O A;  1UBY A;  5A0J A;  3KRA A;  1UBX A;  5IKH A;  4OGU A;  5C05 A;  4LFG A;  2E94 A;  4P0V A;  3Q1O A;  2H8O A;  4KWD A;  1EZF A;  4DI5 A;  3WEK A;  3VJE A;  4LFV F;  4LA5 A;  1WY0 A;  5DJV F;  2FOR A;  3V1X A;  3ZMB A;  2OPM A;  1YHK A;  3ICZ A;  5JV1 F;  4KQS A;  5E8H A;  2ONH A;  4E9U A;  3TC1 A;  3Q2Z A;  3LSN A;  4NG6 A;  3AQB B;  4RXE A;  3WJO A;  3P5R A;  3M9U A;  5IKA A;  4PVY F;  3ZOU A;  1VG7 A;  4N9U A;  2DH4 A;  1N20 A;  1WL0 A;  1DI1 A;  5IK0 A;  4KFA A;  3AE0 A;  3NPR A;  4F6X A;  5HNA A;  5B02 A;  4QXS F;  3S9V A;  3LJI A;  1WL3 A;  4DZW A;  5IM1 A;  3WCD A;  5HN8 A;  2E8V A;  4EA0 A;  5B01 A;  3PYA A;  4F6V A;  4MC8 A;  4JYX A;  4LUU A;  4KQ5 A;  1VG2 A;  1RQJ A;  3N0G A;  4E1E A;  3MZV A;  3EZ3 A;  2F8Z F;  1RQI A;  3KRO A;  2OGD A;  4EA1 A;  5CG5 A;  4NKF A;  3WCL A;  3CKE A;  1JFA A;  1VG3 A;  5HN9 A;  3SDT A;  2Z4W A;  2Q80 A;  4LOB A;  2ZEV A;  3M00 A;  5AEL A;  3M0G A;  3WE9 A;  2Z7I A;  4Q23 A;  5ILI A;  1YYU A;  1YV5 A;  2E8U A;  3OAB B;  3WEJ A;  4KVW A;  2ZCQ A;  4DWG A;  4DHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...