4WK5A

Crystal structure of a isoprenoid synthase family member from thermotoga neapolitana dsm 4359, target efi-509458
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
269
structure length
256
Chain Sequence
SMKKETIERRIEELVKPHFNLLTESAMQYSVTAGGKRIRPLLVLTVGEDIGVEEERLVDVAVAVELFHTASLVHDDLPPIDNADFRRGKPSCHRAYGEGIALLAGDGLFFLAFSQIAKVREPKLFEEFSETAYKLLLGEAMDVEFERQEKEISVEMVEKMYSFKTGALFAFCFSAPFLLKGLDHTFVKKLGEKFGVAFQIYDDLKDVLGSKVTLVKKMGVQKAKQLADKYYEEVLEALESEGLHRTFDFLRNLKKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Crystal structure of a Isoprenoid Synthase family member from Thermotoga neapolitana DSM 4359, target EFI-509458
rcsb
source organism Thermotoga neapolitana
total genus 109
structure length 256
sequence length 269
ec nomenclature
pdb deposition date 2014-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4wk5A00
3ICNA 4OGUA 3V1XA 1JFGA 3NRIA 5DW7A 3CKEA 2ONHA 2P1CA 5ILHA 2E8TA 3TFVA 3TS7A 4DXJA 4EA2A 1HX9A 1RTRA 4F6VA 3NF2A 3BNXA 1V4EA 4MC8A 3LGKA 5HN8A 4LLTA 2ZEUA 3WEGA 1N23A 5JUZF 3TFPA 5C05A 3KRFA 2AELA 5H9DA 4LZ0A 3ID0A 3EGTA 3VJ8A 3WJOA 3ZMBA 2Q58A 2AZLA 5ERNA 4ZQ8A 2E95A 2E4OA 2EWGA 4H5EF 1UBWA 5DIQF 2Z78A 5DGMF 3S9VA 3KRCA 2PS5A 3P8LA 2DH4A 5B0IA 3VJEA 2ZCQA 3N6KF 3WCHA 1N1BA 4XQSF 5DJVF 3WEFA 4RYPA 1UBVA 3QQVA 4LA5A 4GAXA 1HM4A 1V4IA 5A0JA 5IM1A 3WCFA 5DHIA 3MAVA 3AQ0A 4EA1A 3N1WF 2ZEVA 2Z50A 2AZJA 2F9KF 4KQSA 4KVWA 4P0VA 1WL2A 3ZL6A 3LVSA 5KSXF 3NPRA 4NKFA 1RQJA 5EASA 4LLSA 2ONGA 5IK0A 5A0IA 5ILJA 3PH7A 4NUAA 3KB9A 2Z7IA 4OKZA 5IL8A 3KRFB 3N3DA 3LSNA 4JVJF 4DHDA 4LTVA 5EAUA 5B0MA 4LZ3A 4QXSF 2E93A 1YYQA 1N21A 3N46F 4L2XF 5IKHA 4KVDA 3ACXA 3AQCB 1WY0A 5AYPA 4GP1A 4E9ZA 3EFQA 3CP6A 2OPNA 2F92F 1YYSA 3RYWA 2E8UA 2Q9YA 3RMGA 5JV1F 1UBYA 3G4DA 1DGPA 4OMGA 3VJCA 2ZCRA 3OYRA 3KROB 3WEJA 2FORA 4WK5A 2J1OA 1N24A 5ILDA 2Z4ZA 4JXYA 4LFEA 4MC0A 4DI5A 4NFJF 1YYRA 3P5PA 4H5CF 5A0KA 3ACWA 5IN8A 5DGNF 3M02A 1DI1A 3APZA 3ZOUA 4KWDA 4P0XA 4XQRF 3ACYA 3P41A 5ILZA 3KBKA 2OPMA 5JA0F 1WKZA 4NFKF 5DJRF 3OACA 4JZBA 4LUUA 5ILKA 5E8KA 3LK5A 3N3LF 5IK6A 3SDRA 3WCDA 3S4JA 3AQBB 2F89F 5ILYA 4KQ5A 1N22A 4P0WA 1WMWA 1VG3A 1V4HA 5DGSF 3B7LA 3PDEA 2Z4WA 3WEKA 5IMNA 4GA3A 3KROA 4QPFA 5IVGA 3SDTA 1N1ZA 1FPSA 3ICMA 2ZY1A 4PVXF 3BNYA 5IMPA 3WJNA 4RXAA 1WL3A 2PS6A 2Z4YA 2PS7A 1WL0A 4NKEA 3ADZA 1YHMA 4KVIA 5IKAA 3LG5A 2O1OA 3WCEA 3IPIA 3VJ9A 3VJAA 4RXDA 4PVYF 3WEHA 2AEKA 3WE9A 3SDQA 3CC9A 3DYGA 2E8XA 3SDUA 4N9UA 1JFAA 1N20A 2PS4A 3M0GA 5B0JA 2E8WA 3V66A 3PYBA 4KUXA 1WL1A 3WSAA 5AHUB 3N45F 5IK9A 4DEMF 3WEIA 3KRPB 3OACB 3Q2QA 3TC1A 4NFIF 4LA6A 5CG5A 4HD1A 4OKMA 2Z7HA 1YJ4A 2OA6A 3LMDA 3N0FA 1YHKA 2F8CF 2ZCSA 3P5RA 3RYEA 1VG4A 3OABA 4UMJA 2VF6A 3N0GA 3N49F 4LPHF 1HXGA 3NPKA 4H5DF 1VG6A 3VJDA 2I19A 3IBAA 1V4KA 4KK2A 2F94F 5IL3A 4E1EA 4LIXA 2E8VA 4NG6A 2OGDA 3LOMA 3W7FA 3AE0A 3N5JF 1ZW5A 3WCJA 3WJKA 1YYUA 3MZVA 1EZFA 1YYTA 4F6XA 2E94A 2QISA 2J5CA 3KRAB 4KPJA 1V4JA 2F7MF 3QKCA 3WCLA 4DZWA 4EA0A 4LFVF 5B0LA 2E91A 4KVYA 3KRPA 3Q30A 1YQ7A 4Q23A 2E92A 5ILIA 3G4FA 2E90A 2AETA 3WCBA 3UCAA 4LPGF 5E8LA 4E9UA 5I1UA 4OMHA 2Z52A 4FJQA 2Q9ZA 2FTZA 4JXNA 3M01A 2H8OA 4RXEA 5B01A 3LZ9A 3WC9A 5JV2F 3PKOA 5CG6A 5AELA 3OABB 4N1ZF 5EATA 3DYFA 1YV5A 3VJBA 3V1VA 3SAEA 4LFGA 2Q80A 3WCMA 3KRAA 1UBXA 1VG2A 4FP4A 4LOBA 3SDVA 4LZCA 5HN7A 2F8ZF 2Z4XA 4LTZA 5DZ2A 1RQIA 3N5HF 3Q2ZA 4GP2A 3LEEA 2AZKA 3WSBA 3M9UA 1KIZA 5ERMA 3P8RA 3DYHA 5ER8A 1VG7A 4DWBA 3EZ3A 5JV0F 5HNAA 4KQUA 3ICKA 4F62A 1HM7A 3ZMCA 3ASXA 5B00A 3WCAA 3LLWA 5AFXA 4LXWA 5E8HA 5IMIA 5B0KA 3WCCA 4K10A 4MC3A 2PS8A 4RXCA 3LDWA 3RBMA 5B02A 3TFNA 1KIYA 4KKMA 3WCGA 3LGZB 2ZCOA 2Z4VA 3M00A 2J1PA 4RNQA 1HXAA 1HXCA 5EROA 3N1VF 3LJIA 3ZCDA 2RAHA 3KRCB 5DHKA 3Q1OA 1PS1A 4JZXA 5HN9A 5DJPF 4KPDA 4KFAA 3ICZA 5B03A 3WCIA 3PYAA 4XQTF 4JYXA 1YHLA 4DWGA
chains in the Genus database with same CATH superfamily
3ICNA 4OGUA 3V1XA 1JFGA 3NRIA 5DW7A 3CKEA 2ONHA 2P1CA 5ILHA 2E8TA 3TFVA 3TS7A 4DXJA 4EA2A 1HX9A 1RTRA 4F6VA 3NF2A 3BNXA 1V4EA 4MC8A 3LGKA 5HN8A 4LLTA 2ZEUA 3WEGA 1N23A 5JUZF 3TFPA 5C05A 3KRFA 2AELA 5H9DA 4LZ0A 3ID0A 3EGTA 3VJ8A 3WJOA 3ZMBA 2Q58A 2AZLA 5ERNA 4ZQ8A 2E95A 2E4OA 2EWGA 4H5EF 1UBWA 5DIQF 2Z78A 5DGMF 3S9VA 3KRCA 2PS5A 3P8LA 2DH4A 5B0IA 3VJEA 2ZCQA 3N6KF 3WCHA 1N1BA 4XQSF 5DJVF 3WEFA 4RYPA 1UBVA 3QQVA 4LA5A 4GAXA 1HM4A 1V4IA 5A0JA 5IM1A 3WCFA 5DHIA 3MAVA 3AQ0A 4EA1A 3N1WF 2ZEVA 2Z50A 2AZJA 2F9KF 4KQSA 4KVWA 4P0VA 1WL2A 3ZL6A 3LVSA 5KSXF 3NPRA 4NKFA 1RQJA 5EASA 4LLSA 2ONGA 5IK0A 5A0IA 5ILJA 3PH7A 4NUAA 3KB9A 2Z7IA 4OKZA 5IL8A 3KRFB 3N3DA 3LSNA 4JVJF 4DHDA 4LTVA 5EAUA 5B0MA 4LZ3A 4QXSF 2E93A 1YYQA 1N21A 3N46F 4L2XF 5IKHA 4KVDA 3ACXA 3AQCB 1WY0A 5AYPA 4GP1A 4E9ZA 3EFQA 3CP6A 2OPNA 2F92F 1YYSA 3RYWA 2E8UA 2Q9YA 3RMGA 5JV1F 1UBYA 3G4DA 1DGPA 4OMGA 3VJCA 2ZCRA 3OYRA 3KROB 3WEJA 2FORA 4WK5A 2J1OA 1N24A 5ILDA 2Z4ZA 4JXYA 4LFEA 4MC0A 4DI5A 4NFJF 1YYRA 3P5PA 4H5CF 5A0KA 3ACWA 5IN8A 5DGNF 3M02A 1DI1A 3APZA 3ZOUA 4KWDA 4P0XA 4XQRF 3ACYA 3P41A 5ILZA 3KBKA 2OPMA 5JA0F 1WKZA 4NFKF 5DJRF 3OACA 4JZBA 4LUUA 5ILKA 5E8KA 3LK5A 3N3LF 5IK6A 3SDRA 3WCDA 3S4JA 3AQBB 2F89F 5ILYA 4KQ5A 1N22A 4P0WA 1WMWA 1VG3A 1V4HA 5DGSF 3B7LA 3PDEA 2Z4WA 3WEKA 5IMNA 4GA3A 3KROA 4QPFA 5IVGA 3SDTA 1N1ZA 1FPSA 3ICMA 2ZY1A 4PVXF 3BNYA 5IMPA 3WJNA 4RXAA 1WL3A 2PS6A 2Z4YA 2PS7A 1WL0A 4NKEA 3ADZA 1YHMA 4KVIA 5IKAA 3LG5A 2O1OA 3WCEA 3IPIA 3VJ9A 3VJAA 4RXDA 4PVYF 3WEHA 2AEKA 3WE9A 3SDQA 3CC9A 3DYGA 2E8XA 3SDUA 4N9UA 1JFAA 1N20A 2PS4A 3M0GA 5B0JA 2E8WA 3V66A 3PYBA 4KUXA 1WL1A 3WSAA 5AHUB 3N45F 5IK9A 4DEMF 3WEIA 3KRPB 3OACB 3Q2QA 3TC1A 4NFIF 4LA6A 5CG5A 4HD1A 4OKMA 2Z7HA 1YJ4A 2OA6A 3LMDA 3N0FA 1YHKA 2F8CF 2ZCSA 3P5RA 3RYEA 1VG4A 3OABA 4UMJA 2VF6A 3N0GA 3N49F 4LPHF 1HXGA 3NPKA 4H5DF 1VG6A 3VJDA 2I19A 3IBAA 1V4KA 4KK2A 2F94F 5IL3A 4E1EA 4LIXA 2E8VA 4NG6A 2OGDA 3LOMA 3W7FA 3AE0A 3N5JF 1ZW5A 3WCJA 3WJKA 1YYUA 3MZVA 1EZFA 1YYTA 4F6XA 2E94A 2QISA 2J5CA 3KRAB 4KPJA 1V4JA 2F7MF 3QKCA 3WCLA 4DZWA 4EA0A 4LFVF 5B0LA 2E91A 4KVYA 3KRPA 3Q30A 1YQ7A 4Q23A 2E92A 5ILIA 3G4FA 2E90A 2AETA 3WCBA 3UCAA 4LPGF 5E8LA 4E9UA 5I1UA 4OMHA 2Z52A 4FJQA 2Q9ZA 2FTZA 4JXNA 3M01A 2H8OA 4RXEA 5B01A 3LZ9A 3WC9A 5JV2F 3PKOA 5CG6A 5AELA 3OABB 4N1ZF 5EATA 3DYFA 1YV5A 3VJBA 3V1VA 3SAEA 4LFGA 2Q80A 3WCMA 3KRAA 1UBXA 1VG2A 4FP4A 4LOBA 3SDVA 4LZCA 5HN7A 2F8ZF 2Z4XA 4LTZA 5DZ2A 1RQIA 3N5HF 3Q2ZA 4GP2A 3LEEA 2AZKA 3WSBA 3M9UA 1KIZA 5ERMA 3P8RA 3DYHA 5ER8A 1VG7A 4DWBA 3EZ3A 5JV0F 5HNAA 4KQUA 3ICKA 4F62A 1HM7A 3ZMCA 3ASXA 5B00A 3WCAA 3LLWA 5AFXA 4LXWA 5E8HA 5IMIA 5B0KA 3WCCA 4K10A 4MC3A 2PS8A 4RXCA 3LDWA 3RBMA 5B02A 3TFNA 1KIYA 4KKMA 3WCGA 3LGZB 2ZCOA 2Z4VA 3M00A 2J1PA 4RNQA 1HXAA 1HXCA 5EROA 3N1VF 3LJIA 3ZCDA 2RAHA 3KRCB 5DHKA 3Q1OA 1PS1A 4JZXA 5HN9A 5DJPF 4KPDA 4KFAA 3ICZA 5B03A 3WCIA 3PYAA 4XQTF 4JYXA 1YHLA 4DWGA
chains in the Genus database with same CATH topology
3ICNA 4OGUA 3V1XA 1JFGA 3NRIA 5DW7A 3CKEA 2ONHA 2P1CA 5ILHA 2E8TA 3TFVA 3TS7A 4DXJA 4EA2A 1HX9A 1RTRA 4F6VA 3NF2A 3BNXA 1V4EA 4MC8A 3LGKA 5HN8A 4LLTA 2ZEUA 3WEGA 1N23A 5JUZF 3TFPA 5C05A 3KRFA 2AELA 5H9DA 4LZ0A 3ID0A 3EGTA 3VJ8A 3WJOA 3ZMBA 2Q58A 2AZLA 5ERNA 4ZQ8A 2E95A 2E4OA 2EWGA 4H5EF 1UBWA 5DIQF 2Z78A 5DGMF 3S9VA 3KRCA 2PS5A 3P8LA 2DH4A 5B0IA 3VJEA 2ZCQA 3N6KF 3WCHA 1N1BA 4XQSF 5DJVF 3WEFA 4RYPA 1UBVA 3QQVA 4LA5A 4GAXA 1HM4A 1V4IA 5A0JA 5IM1A 3WCFA 5DHIA 3MAVA 3AQ0A 4EA1A 3N1WF 2ZEVA 2Z50A 2AZJA 2F9KF 4KQSA 4KVWA 4P0VA 1WL2A 3ZL6A 3LVSA 5KSXF 3NPRA 4NKFA 1RQJA 5EASA 4LLSA 2ONGA 5IK0A 5A0IA 5ILJA 3PH7A 4NUAA 3KB9A 2Z7IA 4OKZA 5IL8A 3KRFB 3N3DA 3LSNA 4JVJF 4DHDA 4LTVA 5EAUA 5B0MA 4LZ3A 4QXSF 2E93A 1YYQA 1N21A 3N46F 4L2XF 5IKHA 4KVDA 3ACXA 3AQCB 1WY0A 5AYPA 4GP1A 4E9ZA 3EFQA 3CP6A 2OPNA 2F92F 1YYSA 3RYWA 2E8UA 2Q9YA 3RMGA 5JV1F 1UBYA 3G4DA 1DGPA 4OMGA 3VJCA 2ZCRA 3OYRA 3KROB 3WEJA 2FORA 4WK5A 2J1OA 1N24A 5ILDA 2Z4ZA 4JXYA 4LFEA 4MC0A 4DI5A 4NFJF 1YYRA 3P5PA 4H5CF 5A0KA 3ACWA 5IN8A 5DGNF 3M02A 1DI1A 3APZA 3ZOUA 4KWDA 4P0XA 4XQRF 3ACYA 3P41A 5ILZA 3KBKA 2OPMA 5JA0F 1WKZA 4NFKF 5DJRF 3OACA 4JZBA 4LUUA 5ILKA 5E8KA 3LK5A 3N3LF 5IK6A 3SDRA 3WCDA 3S4JA 3AQBB 2F89F 5ILYA 4KQ5A 1N22A 4P0WA 1WMWA 1VG3A 1V4HA 5DGSF 3B7LA 3PDEA 2Z4WA 3WEKA 5IMNA 4GA3A 3KROA 4QPFA 5IVGA 3SDTA 1N1ZA 1FPSA 3ICMA 2ZY1A 4PVXF 3BNYA 5IMPA 3WJNA 4RXAA 1WL3A 2PS6A 2Z4YA 2PS7A 1WL0A 4NKEA 3ADZA 1YHMA 4KVIA 5IKAA 3LG5A 2O1OA 3WCEA 3IPIA 3VJ9A 3VJAA 4RXDA 4PVYF 3WEHA 2AEKA 3WE9A 3SDQA 3CC9A 3DYGA 2E8XA 3SDUA 4N9UA 1JFAA 1N20A 2PS4A 3M0GA 5B0JA 2E8WA 3V66A 3PYBA 4KUXA 1WL1A 3WSAA 5AHUB 3N45F 5IK9A 4DEMF 3WEIA 3KRPB 3OACB 3Q2QA 3TC1A 4NFIF 4LA6A 5CG5A 4HD1A 4OKMA 2Z7HA 1YJ4A 2OA6A 3LMDA 3N0FA 1YHKA 2F8CF 2ZCSA 3P5RA 3RYEA 1VG4A 3OABA 4UMJA 2VF6A 3N0GA 3N49F 4LPHF 1HXGA 3NPKA 4H5DF 1VG6A 3VJDA 2I19A 3IBAA 1V4KA 4KK2A 2F94F 5IL3A 4E1EA 4LIXA 2E8VA 4NG6A 2OGDA 3LOMA 3W7FA 3AE0A 3N5JF 1ZW5A 3WCJA 3WJKA 1YYUA 3MZVA 1EZFA 1YYTA 4F6XA 2E94A 2QISA 2J5CA 3KRAB 4KPJA 1V4JA 2F7MF 3QKCA 3WCLA 4DZWA 4EA0A 4LFVF 5B0LA 2E91A 4KVYA 3KRPA 3Q30A 1YQ7A 4Q23A 2E92A 5ILIA 3G4FA 2E90A 2AETA 3WCBA 3UCAA 4LPGF 5E8LA 4E9UA 5I1UA 4OMHA 2Z52A 4FJQA 2Q9ZA 2FTZA 4JXNA 3M01A 2H8OA 4RXEA 5B01A 3LZ9A 3WC9A 5JV2F 3PKOA 5CG6A 5AELA 3OABB 4N1ZF 5EATA 3DYFA 1YV5A 3VJBA 3V1VA 3SAEA 4LFGA 2Q80A 3WCMA 3KRAA 1UBXA 1VG2A 4FP4A 4LOBA 3SDVA 4LZCA 5HN7A 2F8ZF 2Z4XA 4LTZA 5DZ2A 1RQIA 3N5HF 3Q2ZA 4GP2A 3LEEA 2AZKA 3WSBA 3M9UA 1KIZA 5ERMA 3P8RA 3DYHA 5ER8A 1VG7A 4DWBA 3EZ3A 5JV0F 5HNAA 4KQUA 3ICKA 4F62A 1HM7A 3ZMCA 3ASXA 5B00A 3WCAA 3LLWA 5AFXA 4LXWA 5E8HA 5IMIA 5B0KA 3WCCA 4K10A 4MC3A 2PS8A 4RXCA 3LDWA 3RBMA 5B02A 3TFNA 1KIYA 4KKMA 3WCGA 3LGZB 2ZCOA 2Z4VA 3M00A 2J1PA 4RNQA 1HXAA 1HXCA 5EROA 3N1VF 3LJIA 3ZCDA 2RAHA 3KRCB 5DHKA 3Q1OA 1PS1A 4JZXA 5HN9A 5DJPF 4KPDA 4KFAA 3ICZA 5B03A 3WCIA 3PYAA 4XQTF 4JYXA 1YHLA 4DWGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ICN A;  4OGU A;  3V1X A;  1JFG A;  3NRI A;  5DW7 A;  3CKE A;  2ONH A;  2P1C A;  5ILH A;  2E8T A;  3TFV A;  3TS7 A;  4DXJ A;  4EA2 A;  1HX9 A;  1RTR A;  4F6V A;  3NF2 A;  3BNX A;  1V4E A;  4MC8 A;  3LGK A;  5HN8 A;  4LLT A;  2ZEU A;  3WEG A;  1N23 A;  5JUZ F;  3TFP A;  5C05 A;  3KRF A;  2AEL A;  5H9D A;  4LZ0 A;  3ID0 A;  3EGT A;  3VJ8 A;  3WJO A;  3ZMB A;  2Q58 A;  2AZL A;  5ERN A;  4ZQ8 A;  2E95 A;  2E4O A;  2EWG A;  4H5E F;  1UBW A;  5DIQ F;  2Z78 A;  5DGM F;  3S9V A;  3KRC A;  2PS5 A;  3P8L A;  2DH4 A;  5B0I A;  3VJE A;  2ZCQ A;  3N6K F;  3WCH A;  1N1B A;  4XQS F;  5DJV F;  3WEF A;  4RYP A;  1UBV A;  3QQV A;  4LA5 A;  4GAX A;  1HM4 A;  1V4I A;  5A0J A;  5IM1 A;  3WCF A;  5DHI A;  3MAV A;  3AQ0 A;  4EA1 A;  3N1W F;  2ZEV A;  2Z50 A;  2AZJ A;  2F9K F;  4KQS A;  4KVW A;  4P0V A;  1WL2 A;  3ZL6 A;  3LVS A;  5KSX F;  3NPR A;  4NKF A;  1RQJ A;  5EAS A;  4LLS A;  2ONG A;  5IK0 A;  5A0I A;  5ILJ A;  3PH7 A;  4NUA A;  3KB9 A;  2Z7I A;  4OKZ A;  5IL8 A;  3KRF B;  3N3D A;  3LSN A;  4JVJ F;  4DHD A;  4LTV A;  5EAU A;  5B0M A;  4LZ3 A;  4QXS F;  2E93 A;  1YYQ A;  1N21 A;  3N46 F;  4L2X F;  5IKH A;  4KVD A;  3ACX A;  3AQC B;  1WY0 A;  5AYP A;  4GP1 A;  4E9Z A;  3EFQ A;  3CP6 A;  2OPN A;  2F92 F;  1YYS A;  3RYW A;  2E8U A;  2Q9Y A;  3RMG A;  5JV1 F;  1UBY A;  3G4D A;  1DGP A;  4OMG A;  3VJC A;  2ZCR A;  3OYR A;  3KRO B;  3WEJ A;  2FOR A;  4WK5 A;  2J1O A;  1N24 A;  5ILD A;  2Z4Z A;  4JXY A;  4LFE A;  4MC0 A;  4DI5 A;  4NFJ F;  1YYR A;  3P5P A;  4H5C F;  5A0K A;  3ACW A;  5IN8 A;  5DGN F;  3M02 A;  1DI1 A;  3APZ A;  3ZOU A;  4KWD A;  4P0X A;  4XQR F;  3ACY A;  3P41 A;  5ILZ A;  3KBK A;  2OPM A;  5JA0 F;  1WKZ A;  4NFK F;  5DJR F;  3OAC A;  4JZB A;  4LUU A;  5ILK A;  5E8K A;  3LK5 A;  3N3L F;  5IK6 A;  3SDR A;  3WCD A;  3S4J A;  3AQB B;  2F89 F;  5ILY A;  4KQ5 A;  1N22 A;  4P0W A;  1WMW A;  1VG3 A;  1V4H A;  5DGS F;  3B7L A;  3PDE A;  2Z4W A;  3WEK A;  5IMN A;  4GA3 A;  3KRO A;  4QPF A;  5IVG A;  3SDT A;  1N1Z A;  1FPS A;  3ICM A;  2ZY1 A;  4PVX F;  3BNY A;  5IMP A;  3WJN A;  4RXA A;  1WL3 A;  2PS6 A;  2Z4Y A;  2PS7 A;  1WL0 A;  4NKE A;  3ADZ A;  1YHM A;  4KVI A;  5IKA A;  3LG5 A;  2O1O A;  3WCE A;  3IPI A;  3VJ9 A;  3VJA A;  4RXD A;  4PVY F;  3WEH A;  2AEK A;  3WE9 A;  3SDQ A;  3CC9 A;  3DYG A;  2E8X A;  3SDU A;  4N9U A;  1JFA A;  1N20 A;  2PS4 A;  3M0G A;  5B0J A;  2E8W A;  3V66 A;  3PYB A;  4KUX A;  1WL1 A;  3WSA A;  5AHU B;  3N45 F;  5IK9 A;  4DEM F;  3WEI A;  3KRP B;  3OAC B;  3Q2Q A;  3TC1 A;  4NFI F;  4LA6 A;  5CG5 A;  4HD1 A;  4OKM A;  2Z7H A;  1YJ4 A;  2OA6 A;  3LMD A;  3N0F A;  1YHK A;  2F8C F;  2ZCS A;  3P5R A;  3RYE A;  1VG4 A;  3OAB A;  4UMJ A;  2VF6 A;  3N0G A;  3N49 F;  4LPH F;  1HXG A;  3NPK A;  4H5D F;  1VG6 A;  3VJD A;  2I19 A;  3IBA A;  1V4K A;  4KK2 A;  2F94 F;  5IL3 A;  4E1E A;  4LIX A;  2E8V A;  4NG6 A;  2OGD A;  3LOM A;  3W7F A;  3AE0 A;  3N5J F;  1ZW5 A;  3WCJ A;  3WJK A;  1YYU A;  3MZV A;  1EZF A;  1YYT A;  4F6X A;  2E94 A;  2QIS A;  2J5C A;  3KRA B;  4KPJ A;  1V4J A;  2F7M F;  3QKC A;  3WCL A;  4DZW A;  4EA0 A;  4LFV F;  5B0L A;  2E91 A;  4KVY A;  3KRP A;  3Q30 A;  1YQ7 A;  4Q23 A;  2E92 A;  5ILI A;  3G4F A;  2E90 A;  2AET A;  3WCB A;  3UCA A;  4LPG F;  5E8L A;  4E9U A;  5I1U A;  4OMH A;  2Z52 A;  4FJQ A;  2Q9Z A;  2FTZ A;  4JXN A;  3M01 A;  2H8O A;  4RXE A;  5B01 A;  3LZ9 A;  3WC9 A;  5JV2 F;  3PKO A;  5CG6 A;  5AEL A;  3OAB B;  4N1Z F;  5EAT A;  3DYF A;  1YV5 A;  3VJB A;  3V1V A;  3SAE A;  4LFG A;  2Q80 A;  3WCM A;  3KRA A;  1UBX A;  1VG2 A;  4FP4 A;  4LOB A;  3SDV A;  4LZC A;  5HN7 A;  2F8Z F;  2Z4X A;  4LTZ A;  5DZ2 A;  1RQI A;  3N5H F;  3Q2Z A;  4GP2 A;  3LEE A;  2AZK A;  3WSB A;  3M9U A;  1KIZ A;  5ERM A;  3P8R A;  3DYH A;  5ER8 A;  1VG7 A;  4DWB A;  3EZ3 A;  5JV0 F;  5HNA A;  4KQU A;  3ICK A;  4F62 A;  1HM7 A;  3ZMC A;  3ASX A;  5B00 A;  3WCA A;  3LLW A;  5AFX A;  4LXW A;  5E8H A;  5IMI A;  5B0K A;  3WCC A;  4K10 A;  4MC3 A;  2PS8 A;  4RXC A;  3LDW A;  3RBM A;  5B02 A;  3TFN A;  1KIY A;  4KKM A;  3WCG A;  3LGZ B;  2ZCO A;  2Z4V A;  3M00 A;  2J1P A;  4RNQ A;  1HXA A;  1HXC A;  5ERO A;  3N1V F;  3LJI A;  3ZCD A;  2RAH A;  3KRC B;  5DHK A;  3Q1O A;  1PS1 A;  4JZX A;  5HN9 A;  5DJP F;  4KPD A;  4KFA A;  3ICZ A;  5B03 A;  3WCI A;  3PYA A;  4XQT F;  4JYX A;  1YHL A;  4DWG A; 
#chains in the Genus database with same CATH topology
 3ICN A;  4OGU A;  3V1X A;  1JFG A;  3NRI A;  5DW7 A;  3CKE A;  2ONH A;  2P1C A;  5ILH A;  2E8T A;  3TFV A;  3TS7 A;  4DXJ A;  4EA2 A;  1HX9 A;  1RTR A;  4F6V A;  3NF2 A;  3BNX A;  1V4E A;  4MC8 A;  3LGK A;  5HN8 A;  4LLT A;  2ZEU A;  3WEG A;  1N23 A;  5JUZ F;  3TFP A;  5C05 A;  3KRF A;  2AEL A;  5H9D A;  4LZ0 A;  3ID0 A;  3EGT A;  3VJ8 A;  3WJO A;  3ZMB A;  2Q58 A;  2AZL A;  5ERN A;  4ZQ8 A;  2E95 A;  2E4O A;  2EWG A;  4H5E F;  1UBW A;  5DIQ F;  2Z78 A;  5DGM F;  3S9V A;  3KRC A;  2PS5 A;  3P8L A;  2DH4 A;  5B0I A;  3VJE A;  2ZCQ A;  3N6K F;  3WCH A;  1N1B A;  4XQS F;  5DJV F;  3WEF A;  4RYP A;  1UBV A;  3QQV A;  4LA5 A;  4GAX A;  1HM4 A;  1V4I A;  5A0J A;  5IM1 A;  3WCF A;  5DHI A;  3MAV A;  3AQ0 A;  4EA1 A;  3N1W F;  2ZEV A;  2Z50 A;  2AZJ A;  2F9K F;  4KQS A;  4KVW A;  4P0V A;  1WL2 A;  3ZL6 A;  3LVS A;  5KSX F;  3NPR A;  4NKF A;  1RQJ A;  5EAS A;  4LLS A;  2ONG A;  5IK0 A;  5A0I A;  5ILJ A;  3PH7 A;  4NUA A;  3KB9 A;  2Z7I A;  4OKZ A;  5IL8 A;  3KRF B;  3N3D A;  3LSN A;  4JVJ F;  4DHD A;  4LTV A;  5EAU A;  5B0M A;  4LZ3 A;  4QXS F;  2E93 A;  1YYQ A;  1N21 A;  3N46 F;  4L2X F;  5IKH A;  4KVD A;  3ACX A;  3AQC B;  1WY0 A;  5AYP A;  4GP1 A;  4E9Z A;  3EFQ A;  3CP6 A;  2OPN A;  2F92 F;  1YYS A;  3RYW A;  2E8U A;  2Q9Y A;  3RMG A;  5JV1 F;  1UBY A;  3G4D A;  1DGP A;  4OMG A;  3VJC A;  2ZCR A;  3OYR A;  3KRO B;  3WEJ A;  2FOR A;  4WK5 A;  2J1O A;  1N24 A;  5ILD A;  2Z4Z A;  4JXY A;  4LFE A;  4MC0 A;  4DI5 A;  4NFJ F;  1YYR A;  3P5P A;  4H5C F;  5A0K A;  3ACW A;  5IN8 A;  5DGN F;  3M02 A;  1DI1 A;  3APZ A;  3ZOU A;  4KWD A;  4P0X A;  4XQR F;  3ACY A;  3P41 A;  5ILZ A;  3KBK A;  2OPM A;  5JA0 F;  1WKZ A;  4NFK F;  5DJR F;  3OAC A;  4JZB A;  4LUU A;  5ILK A;  5E8K A;  3LK5 A;  3N3L F;  5IK6 A;  3SDR A;  3WCD A;  3S4J A;  3AQB B;  2F89 F;  5ILY A;  4KQ5 A;  1N22 A;  4P0W A;  1WMW A;  1VG3 A;  1V4H A;  5DGS F;  3B7L A;  3PDE A;  2Z4W A;  3WEK A;  5IMN A;  4GA3 A;  3KRO A;  4QPF A;  5IVG A;  3SDT A;  1N1Z A;  1FPS A;  3ICM A;  2ZY1 A;  4PVX F;  3BNY A;  5IMP A;  3WJN A;  4RXA A;  1WL3 A;  2PS6 A;  2Z4Y A;  2PS7 A;  1WL0 A;  4NKE A;  3ADZ A;  1YHM A;  4KVI A;  5IKA A;  3LG5 A;  2O1O A;  3WCE A;  3IPI A;  3VJ9 A;  3VJA A;  4RXD A;  4PVY F;  3WEH A;  2AEK A;  3WE9 A;  3SDQ A;  3CC9 A;  3DYG A;  2E8X A;  3SDU A;  4N9U A;  1JFA A;  1N20 A;  2PS4 A;  3M0G A;  5B0J A;  2E8W A;  3V66 A;  3PYB A;  4KUX A;  1WL1 A;  3WSA A;  5AHU B;  3N45 F;  5IK9 A;  4DEM F;  3WEI A;  3KRP B;  3OAC B;  3Q2Q A;  3TC1 A;  4NFI F;  4LA6 A;  5CG5 A;  4HD1 A;  4OKM A;  2Z7H A;  1YJ4 A;  2OA6 A;  3LMD A;  3N0F A;  1YHK A;  2F8C F;  2ZCS A;  3P5R A;  3RYE A;  1VG4 A;  3OAB A;  4UMJ A;  2VF6 A;  3N0G A;  3N49 F;  4LPH F;  1HXG A;  3NPK A;  4H5D F;  1VG6 A;  3VJD A;  2I19 A;  3IBA A;  1V4K A;  4KK2 A;  2F94 F;  5IL3 A;  4E1E A;  4LIX A;  2E8V A;  4NG6 A;  2OGD A;  3LOM A;  3W7F A;  3AE0 A;  3N5J F;  1ZW5 A;  3WCJ A;  3WJK A;  1YYU A;  3MZV A;  1EZF A;  1YYT A;  4F6X A;  2E94 A;  2QIS A;  2J5C A;  3KRA B;  4KPJ A;  1V4J A;  2F7M F;  3QKC A;  3WCL A;  4DZW A;  4EA0 A;  4LFV F;  5B0L A;  2E91 A;  4KVY A;  3KRP A;  3Q30 A;  1YQ7 A;  4Q23 A;  2E92 A;  5ILI A;  3G4F A;  2E90 A;  2AET A;  3WCB A;  3UCA A;  4LPG F;  5E8L A;  4E9U A;  5I1U A;  4OMH A;  2Z52 A;  4FJQ A;  2Q9Z A;  2FTZ A;  4JXN A;  3M01 A;  2H8O A;  4RXE A;  5B01 A;  3LZ9 A;  3WC9 A;  5JV2 F;  3PKO A;  5CG6 A;  5AEL A;  3OAB B;  4N1Z F;  5EAT A;  3DYF A;  1YV5 A;  3VJB A;  3V1V A;  3SAE A;  4LFG A;  2Q80 A;  3WCM A;  3KRA A;  1UBX A;  1VG2 A;  4FP4 A;  4LOB A;  3SDV A;  4LZC A;  5HN7 A;  2F8Z F;  2Z4X A;  4LTZ A;  5DZ2 A;  1RQI A;  3N5H F;  3Q2Z A;  4GP2 A;  3LEE A;  2AZK A;  3WSB A;  3M9U A;  1KIZ A;  5ERM A;  3P8R A;  3DYH A;  5ER8 A;  1VG7 A;  4DWB A;  3EZ3 A;  5JV0 F;  5HNA A;  4KQU A;  3ICK A;  4F62 A;  1HM7 A;  3ZMC A;  3ASX A;  5B00 A;  3WCA A;  3LLW A;  5AFX A;  4LXW A;  5E8H A;  5IMI A;  5B0K A;  3WCC A;  4K10 A;  4MC3 A;  2PS8 A;  4RXC A;  3LDW A;  3RBM A;  5B02 A;  3TFN A;  1KIY A;  4KKM A;  3WCG A;  3LGZ B;  2ZCO A;  2Z4V A;  3M00 A;  2J1P A;  4RNQ A;  1HXA A;  1HXC A;  5ERO A;  3N1V F;  3LJI A;  3ZCD A;  2RAH A;  3KRC B;  5DHK A;  3Q1O A;  1PS1 A;  4JZX A;  5HN9 A;  5DJP F;  4KPD A;  4KFA A;  3ICZ A;  5B03 A;  3WCI A;  3PYA A;  4XQT F;  4JYX A;  1YHL A;  4DWG A; 
#chains in the Genus database with same CATH homology
 3ICN A;  4OGU A;  3V1X A;  1JFG A;  3NRI A;  5DW7 A;  3CKE A;  2ONH A;  2P1C A;  5ILH A;  2E8T A;  3TFV A;  3TS7 A;  4DXJ A;  4EA2 A;  1HX9 A;  1RTR A;  4F6V A;  3NF2 A;  3BNX A;  1V4E A;  4MC8 A;  3LGK A;  5HN8 A;  4LLT A;  2ZEU A;  3WEG A;  1N23 A;  5JUZ F;  3TFP A;  5C05 A;  3KRF A;  2AEL A;  5H9D A;  4LZ0 A;  3ID0 A;  3EGT A;  3VJ8 A;  3WJO A;  3ZMB A;  2Q58 A;  2AZL A;  5ERN A;  4ZQ8 A;  2E95 A;  2E4O A;  2EWG A;  4H5E F;  1UBW A;  5DIQ F;  2Z78 A;  5DGM F;  3S9V A;  3KRC A;  2PS5 A;  3P8L A;  2DH4 A;  5B0I A;  3VJE A;  2ZCQ A;  3N6K F;  3WCH A;  1N1B A;  4XQS F;  5DJV F;  3WEF A;  4RYP A;  1UBV A;  3QQV A;  4LA5 A;  4GAX A;  1HM4 A;  1V4I A;  5A0J A;  5IM1 A;  3WCF A;  5DHI A;  3MAV A;  3AQ0 A;  4EA1 A;  3N1W F;  2ZEV A;  2Z50 A;  2AZJ A;  2F9K F;  4KQS A;  4KVW A;  4P0V A;  1WL2 A;  3ZL6 A;  3LVS A;  5KSX F;  3NPR A;  4NKF A;  1RQJ A;  5EAS A;  4LLS A;  2ONG A;  5IK0 A;  5A0I A;  5ILJ A;  3PH7 A;  4NUA A;  3KB9 A;  2Z7I A;  4OKZ A;  5IL8 A;  3KRF B;  3N3D A;  3LSN A;  4JVJ F;  4DHD A;  4LTV A;  5EAU A;  5B0M A;  4LZ3 A;  4QXS F;  2E93 A;  1YYQ A;  1N21 A;  3N46 F;  4L2X F;  5IKH A;  4KVD A;  3ACX A;  3AQC B;  1WY0 A;  5AYP A;  4GP1 A;  4E9Z A;  3EFQ A;  3CP6 A;  2OPN A;  2F92 F;  1YYS A;  3RYW A;  2E8U A;  2Q9Y A;  3RMG A;  5JV1 F;  1UBY A;  3G4D A;  1DGP A;  4OMG A;  3VJC A;  2ZCR A;  3OYR A;  3KRO B;  3WEJ A;  2FOR A;  4WK5 A;  2J1O A;  1N24 A;  5ILD A;  2Z4Z A;  4JXY A;  4LFE A;  4MC0 A;  4DI5 A;  4NFJ F;  1YYR A;  3P5P A;  4H5C F;  5A0K A;  3ACW A;  5IN8 A;  5DGN F;  3M02 A;  1DI1 A;  3APZ A;  3ZOU A;  4KWD A;  4P0X A;  4XQR F;  3ACY A;  3P41 A;  5ILZ A;  3KBK A;  2OPM A;  5JA0 F;  1WKZ A;  4NFK F;  5DJR F;  3OAC A;  4JZB A;  4LUU A;  5ILK A;  5E8K A;  3LK5 A;  3N3L F;  5IK6 A;  3SDR A;  3WCD A;  3S4J A;  3AQB B;  2F89 F;  5ILY A;  4KQ5 A;  1N22 A;  4P0W A;  1WMW A;  1VG3 A;  1V4H A;  5DGS F;  3B7L A;  3PDE A;  2Z4W A;  3WEK A;  5IMN A;  4GA3 A;  3KRO A;  4QPF A;  5IVG A;  3SDT A;  1N1Z A;  1FPS A;  3ICM A;  2ZY1 A;  4PVX F;  3BNY A;  5IMP A;  3WJN A;  4RXA A;  1WL3 A;  2PS6 A;  2Z4Y A;  2PS7 A;  1WL0 A;  4NKE A;  3ADZ A;  1YHM A;  4KVI A;  5IKA A;  3LG5 A;  2O1O A;  3WCE A;  3IPI A;  3VJ9 A;  3VJA A;  4RXD A;  4PVY F;  3WEH A;  2AEK A;  3WE9 A;  3SDQ A;  3CC9 A;  3DYG A;  2E8X A;  3SDU A;  4N9U A;  1JFA A;  1N20 A;  2PS4 A;  3M0G A;  5B0J A;  2E8W A;  3V66 A;  3PYB A;  4KUX A;  1WL1 A;  3WSA A;  5AHU B;  3N45 F;  5IK9 A;  4DEM F;  3WEI A;  3KRP B;  3OAC B;  3Q2Q A;  3TC1 A;  4NFI F;  4LA6 A;  5CG5 A;  4HD1 A;  4OKM A;  2Z7H A;  1YJ4 A;  2OA6 A;  3LMD A;  3N0F A;  1YHK A;  2F8C F;  2ZCS A;  3P5R A;  3RYE A;  1VG4 A;  3OAB A;  4UMJ A;  2VF6 A;  3N0G A;  3N49 F;  4LPH F;  1HXG A;  3NPK A;  4H5D F;  1VG6 A;  3VJD A;  2I19 A;  3IBA A;  1V4K A;  4KK2 A;  2F94 F;  5IL3 A;  4E1E A;  4LIX A;  2E8V A;  4NG6 A;  2OGD A;  3LOM A;  3W7F A;  3AE0 A;  3N5J F;  1ZW5 A;  3WCJ A;  3WJK A;  1YYU A;  3MZV A;  1EZF A;  1YYT A;  4F6X A;  2E94 A;  2QIS A;  2J5C A;  3KRA B;  4KPJ A;  1V4J A;  2F7M F;  3QKC A;  3WCL A;  4DZW A;  4EA0 A;  4LFV F;  5B0L A;  2E91 A;  4KVY A;  3KRP A;  3Q30 A;  1YQ7 A;  4Q23 A;  2E92 A;  5ILI A;  3G4F A;  2E90 A;  2AET A;  3WCB A;  3UCA A;  4LPG F;  5E8L A;  4E9U A;  5I1U A;  4OMH A;  2Z52 A;  4FJQ A;  2Q9Z A;  2FTZ A;  4JXN A;  3M01 A;  2H8O A;  4RXE A;  5B01 A;  3LZ9 A;  3WC9 A;  5JV2 F;  3PKO A;  5CG6 A;  5AEL A;  3OAB B;  4N1Z F;  5EAT A;  3DYF A;  1YV5 A;  3VJB A;  3V1V A;  3SAE A;  4LFG A;  2Q80 A;  3WCM A;  3KRA A;  1UBX A;  1VG2 A;  4FP4 A;  4LOB A;  3SDV A;  4LZC A;  5HN7 A;  2F8Z F;  2Z4X A;  4LTZ A;  5DZ2 A;  1RQI A;  3N5H F;  3Q2Z A;  4GP2 A;  3LEE A;  2AZK A;  3WSB A;  3M9U A;  1KIZ A;  5ERM A;  3P8R A;  3DYH A;  5ER8 A;  1VG7 A;  4DWB A;  3EZ3 A;  5JV0 F;  5HNA A;  4KQU A;  3ICK A;  4F62 A;  1HM7 A;  3ZMC A;  3ASX A;  5B00 A;  3WCA A;  3LLW A;  5AFX A;  4LXW A;  5E8H A;  5IMI A;  5B0K A;  3WCC A;  4K10 A;  4MC3 A;  2PS8 A;  4RXC A;  3LDW A;  3RBM A;  5B02 A;  3TFN A;  1KIY A;  4KKM A;  3WCG A;  3LGZ B;  2ZCO A;  2Z4V A;  3M00 A;  2J1P A;  4RNQ A;  1HXA A;  1HXC A;  5ERO A;  3N1V F;  3LJI A;  3ZCD A;  2RAH A;  3KRC B;  5DHK A;  3Q1O A;  1PS1 A;  4JZX A;  5HN9 A;  5DJP F;  4KPD A;  4KFA A;  3ICZ A;  5B03 A;  3WCI A;  3PYA A;  4XQT F;  4JYX A;  1YHL A;  4DWG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...