4OKZA

Selinadiene synthase in complex with dihydrofarnesyl pyrophosphate
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
346
structure length
346
Chain Sequence
ELTVPPLFSPIRQAIHPKHADIDVQTAAWAETFRIGSEELRGKLVTQDIGTFSARILPEGREEVVSLLADFILWLFGVDDGHCEEGELGHRPGDLAGLLHRLIRVAQNPEAPMMQDDPLAAGLRDLRMRVDRFGTAGQTARWVDALREYFFSVVWEAAHRRAGTVPDLNDYTLMRLYDGATSVVLPMLEMGHGYELQPYERDRTAVRAVAEMASFIITWDNDIFSYHKERRGSGYYLNALRVLEQERGLTPAQALDAAISQRDRVMCLFTTVSEQLAEQGSPQLRQYLHSLRCFIRGAQDWGISSVRYTTPDDPANMPSVFTDVPTDDSTEPLDIPAVSWWWDLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Terpene synthase metal-binding domain-containing protein
publication title Induced-fit mechanism in class i terpene cyclases.
pubmed doi rcsb
source organism Streptomyces pristinaespiralis
total genus 135
structure length 346
sequence length 346
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.181: Selina-4(15),7(11)-diene synthase.
pdb deposition date 2014-01-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4okzA00
3NRIA 3AQCB 5KSXF 1N23A 1V4IA 3WCMA 4PVXF 3UCAA 1N21A 1KIZA 3KROA 4LUUA 5IL3A 2AELA 2DH4A 4EA2A 3KRFA 3WCHA 3TC1A 2F92F 3M00A 2Z7HA 2E90A 3WCEA 2RAHA 5JV1F 5DJRF 5ERNA 3VJCA 2I19A 3AE0A 2E8UA 4JVJF 2O1OA 3M01A 3N6KF 3ICMA 4DI5A 5B0MA 4KVDA 4LA5A 5B0KA 3DYFA 4RXDA 5DGMF 3P8LA 3VJBA 4P0WA 3ACWA 3P8RA 4LLTA 2F8CF 5AYPA 4KQSA 4LTVA 1VG2A 3VJDA 3DYGA 4XQRF 1WMWA 1UBWA 4E9UA 4FJQA 3N0FA 5DGSF 4E9ZA 3VJ9A 3OABA 2OA6A 4NKEA 5DJVF 5B0JA 3WCDA 3OYRA 4MC8A 2PS5A 2E4OA 4KFAA 4DEMF 3Q2QA 4LZ0A 3WCAA 1YHLA 4KQ5A 3LGZB 5IKHA 3WCJA 4KWDA 5B03A 3CP6A 4LFVF 3TFNA 5HN7A 2E95A 2Z4WA 2PS7A 4DZWA 2VF6A 5E8HA 1JFGA 2P1CA 3PH7A 3AQBB 4KPDA 2E91A 3N46F 1YYUA 3QQVA 4KQUA 3PKOA 3OACB 3RYEA 3KRCA 1N20A 2PS4A 5IM1A 2Q58A 3WCIA 3ID0A 3KRCB 2ONGA 4NKFA 5ERMA 2QISA 2Q9ZA 5IK6A 3LLWA 4KUXA 5DW7A 3DYHA 2E8XA 3IPIA 4LA6A 3N5HF 4H5CF 2Z7IA 3LZ9A 1KIYA 2EWGA 1YYSA 2E8VA 3WSAA 3WCGA 1JFAA 2AZJA 4OKZA 1YQ7A 1YHMA 2OPNA 5EROA 2F7MF 4GAXA 3WJNA 4OMGA 4DWBA 3KROB 2PS6A 2AZLA 3AQ0A 4K10A 2Z50A 4N9UA 2Z4YA 1WL3A 4NG6A 1HM4A 2E8WA 3G4FA 4MC3A 5A0KA 3Q2ZA 1YYQA 4XQTF 3KRFB 3SAEA 4MC0A 5IMPA 3S4JA 3LVSA 1RQIA 3M9UA 5H9DA 1WL0A 1VG3A 3NF2A 2Z4ZA 2H8OA 3LEEA 3SDQA 2AETA 3ASXA 3WCLA 3LK5A 3APZA 1YV5A 1VG6A 2PS8A 3SDTA 5HN9A 3V1XA 3WEGA 4F62A 3P41A 3CKEA 2Q9YA 4NFKF 2F9KF 4DHDA 2FTZA 5I1UA 5E8KA 3LSNA 2Z52A 3WC9A 4JZBA 2Q80A 5IK9A 3ICZA 3LOMA 3MZVA 5CG6A 2ZCQA 3V66A 1V4HA 4NUAA 5DGNF 3WEHA 1VG7A 2OGDA 3EZ3A 5C05A 2J1PA 4JYXA 3N3DA 3OABB 2ZEUA 5IN8A 2F94F 1DGPA 3ZL6A 3ZOUA 3PYBA 5B01A 3PYAA 4GA3A 5AFXA 2E93A 5JV0F 1UBVA 1V4JA 4GP2A 5ILHA 4P0VA 2FORA 5IMIA 4LPGF 3W7FA 5IMNA 3TFPA 3EFQA 3RMGA 4QPFA 4RXEA 5DHKA 3ZCDA 3SDUA 4KVYA 5DZ2A 5ILYA 4LIXA 2ONHA 2AZKA 4NFIF 3N1VF 2E92A 1YYTA 3LDWA 3RBMA 4F6XA 3N49F 4KVWA 4GP1A 1N24A 4RYPA 5A0JA 1VG4A 4KK2A 5IL8A 1V4KA 4QXSF 3MAVA 5ILKA 5JV2F 4KPJA 5ILDA 3ZMBA 1EZFA 3KRAA 1HM7A 4LFGA 2F8ZF 4JZXA 3WJKA 4LXWA 3WEJA 5EATA 5E8LA 3WCBA 4F6VA 5EASA 3N0GA 5ER8A 3LGKA 1V4EA 1WL2A 4HD1A 1DI1A 3TS7A 5HNAA 3KB9A 3VJEA 2Z4XA 1HXAA 3WCCA 3ACXA 3N1WF 4KKMA 4DXJA 4OGUA 3P5RA 4RNQA 2ZEVA 5HN8A 3SDVA 4RXCA 3P5PA 2ZCSA 4OKMA 1PS1A 2ZCOA 4H5DF 3BNYA 4PVYF 5ILJA 1YJ4A 4Q23A 5AELA 3WE9A 3M0GA 3LMDA 4OMHA 5B02A 4JXYA 2J1OA 3LJIA 4KVIA 3TFVA 3NPKA 3S9VA 1HX9A 3ICNA 5DJPF 3N3LF 4NFJF 3ACYA 1WKZA 1WL1A 4L2XF 5JA0F 1N1ZA 2J5CA 3IBAA 3QKCA 1N22A 3ADZA 1YYRA 4E1EA 3WJOA 4RXAA 4XQSF 3V1VA 3M02A 4LZ3A 4EA0A 4WK5A 4LLSA 2E94A 3NPRA 1UBYA 1HXGA 3WCFA 2AEKA 4EA1A 3N45F 3PDEA 5DIQF 3KBKA 4FP4A 3EGTA 2F89F 5DHIA 1HXCA 1UBXA 1RTRA 4LOBA 3SDRA 3ZMCA 3N5JF 4UMJA 4H5EF 1ZW5A 3RYWA 1RQJA 5A0IA 3KRPA 3LG5A 5AHUB 1WY0A 4DWGA 3VJAA 5JUZF 3G4DA 3KRPB 2Z4VA 4LTZA 3Q30A 5IVGA 3VJ8A 1N1BA 5IKAA 3Q1OA 4N1ZF 4LZCA 2Z78A 2ZCRA 3WEFA 4P0XA 3OACA 5IK0A 5CG5A 3B7LA 4LPHF 3WEIA 2ZY1A 3KRAB 4JXNA 3BNXA 4ZQ8A 5B00A 5B0IA 2E8TA 5EAUA 3CC9A 1FPSA 3WEKA 3ICKA 5B0LA 4LFEA 3WSBA 2OPMA 5ILIA 1YHKA 5ILZA
chains in the Genus database with same CATH superfamily
3NRIA 3AQCB 5KSXF 1N23A 1V4IA 3WCMA 4PVXF 3UCAA 1N21A 1KIZA 3KROA 4LUUA 5IL3A 2AELA 2DH4A 4EA2A 3KRFA 3WCHA 3TC1A 2F92F 3M00A 2Z7HA 2E90A 3WCEA 2RAHA 5JV1F 5DJRF 5ERNA 3VJCA 2I19A 3AE0A 2E8UA 4JVJF 2O1OA 3M01A 3N6KF 3ICMA 4DI5A 5B0MA 4KVDA 4LA5A 5B0KA 3DYFA 4RXDA 5DGMF 3P8LA 3VJBA 4P0WA 3ACWA 3P8RA 4LLTA 2F8CF 5AYPA 4KQSA 4LTVA 1VG2A 3VJDA 3DYGA 4XQRF 1WMWA 1UBWA 4E9UA 4FJQA 3N0FA 5DGSF 4E9ZA 3VJ9A 3OABA 2OA6A 4NKEA 5DJVF 5B0JA 3WCDA 3OYRA 4MC8A 2PS5A 2E4OA 4KFAA 4DEMF 3Q2QA 4LZ0A 3WCAA 1YHLA 4KQ5A 3LGZB 5IKHA 3WCJA 4KWDA 5B03A 3CP6A 4LFVF 3TFNA 5HN7A 2E95A 2Z4WA 2PS7A 4DZWA 2VF6A 5E8HA 1JFGA 2P1CA 3PH7A 3AQBB 4KPDA 2E91A 3N46F 1YYUA 3QQVA 4KQUA 3PKOA 3OACB 3RYEA 3KRCA 1N20A 2PS4A 5IM1A 2Q58A 3WCIA 3ID0A 3KRCB 2ONGA 4NKFA 5ERMA 2QISA 2Q9ZA 5IK6A 3LLWA 4KUXA 5DW7A 3DYHA 2E8XA 3IPIA 4LA6A 3N5HF 4H5CF 2Z7IA 3LZ9A 1KIYA 2EWGA 1YYSA 2E8VA 3WSAA 3WCGA 1JFAA 2AZJA 4OKZA 1YQ7A 1YHMA 2OPNA 5EROA 2F7MF 4GAXA 3WJNA 4OMGA 4DWBA 3KROB 2PS6A 2AZLA 3AQ0A 4K10A 2Z50A 4N9UA 2Z4YA 1WL3A 4NG6A 1HM4A 2E8WA 3G4FA 4MC3A 5A0KA 3Q2ZA 1YYQA 4XQTF 3KRFB 3SAEA 4MC0A 5IMPA 3S4JA 3LVSA 1RQIA 3M9UA 5H9DA 1WL0A 1VG3A 3NF2A 2Z4ZA 2H8OA 3LEEA 3SDQA 2AETA 3ASXA 3WCLA 3LK5A 3APZA 1YV5A 1VG6A 2PS8A 3SDTA 5HN9A 3V1XA 3WEGA 4F62A 3P41A 3CKEA 2Q9YA 4NFKF 2F9KF 4DHDA 2FTZA 5I1UA 5E8KA 3LSNA 2Z52A 3WC9A 4JZBA 2Q80A 5IK9A 3ICZA 3LOMA 3MZVA 5CG6A 2ZCQA 3V66A 1V4HA 4NUAA 5DGNF 3WEHA 1VG7A 2OGDA 3EZ3A 5C05A 2J1PA 4JYXA 3N3DA 3OABB 2ZEUA 5IN8A 2F94F 1DGPA 3ZL6A 3ZOUA 3PYBA 5B01A 3PYAA 4GA3A 5AFXA 2E93A 5JV0F 1UBVA 1V4JA 4GP2A 5ILHA 4P0VA 2FORA 5IMIA 4LPGF 3W7FA 5IMNA 3TFPA 3EFQA 3RMGA 4QPFA 4RXEA 5DHKA 3ZCDA 3SDUA 4KVYA 5DZ2A 5ILYA 4LIXA 2ONHA 2AZKA 4NFIF 3N1VF 2E92A 1YYTA 3LDWA 3RBMA 4F6XA 3N49F 4KVWA 4GP1A 1N24A 4RYPA 5A0JA 1VG4A 4KK2A 5IL8A 1V4KA 4QXSF 3MAVA 5ILKA 5JV2F 4KPJA 5ILDA 3ZMBA 1EZFA 3KRAA 1HM7A 4LFGA 2F8ZF 4JZXA 3WJKA 4LXWA 3WEJA 5EATA 5E8LA 3WCBA 4F6VA 5EASA 3N0GA 5ER8A 3LGKA 1V4EA 1WL2A 4HD1A 1DI1A 3TS7A 5HNAA 3KB9A 3VJEA 2Z4XA 1HXAA 3WCCA 3ACXA 3N1WF 4KKMA 4DXJA 4OGUA 3P5RA 4RNQA 2ZEVA 5HN8A 3SDVA 4RXCA 3P5PA 2ZCSA 4OKMA 1PS1A 2ZCOA 4H5DF 3BNYA 4PVYF 5ILJA 1YJ4A 4Q23A 5AELA 3WE9A 3M0GA 3LMDA 4OMHA 5B02A 4JXYA 2J1OA 3LJIA 4KVIA 3TFVA 3NPKA 3S9VA 1HX9A 3ICNA 5DJPF 3N3LF 4NFJF 3ACYA 1WKZA 1WL1A 4L2XF 5JA0F 1N1ZA 2J5CA 3IBAA 3QKCA 1N22A 3ADZA 1YYRA 4E1EA 3WJOA 4RXAA 4XQSF 3V1VA 3M02A 4LZ3A 4EA0A 4WK5A 4LLSA 2E94A 3NPRA 1UBYA 1HXGA 3WCFA 2AEKA 4EA1A 3N45F 3PDEA 5DIQF 3KBKA 4FP4A 3EGTA 2F89F 5DHIA 1HXCA 1UBXA 1RTRA 4LOBA 3SDRA 3ZMCA 3N5JF 4UMJA 4H5EF 1ZW5A 3RYWA 1RQJA 5A0IA 3KRPA 3LG5A 5AHUB 1WY0A 4DWGA 3VJAA 5JUZF 3G4DA 3KRPB 2Z4VA 4LTZA 3Q30A 5IVGA 3VJ8A 1N1BA 5IKAA 3Q1OA 4N1ZF 4LZCA 2Z78A 2ZCRA 3WEFA 4P0XA 3OACA 5IK0A 5CG5A 3B7LA 4LPHF 3WEIA 2ZY1A 3KRAB 4JXNA 3BNXA 4ZQ8A 5B00A 5B0IA 2E8TA 5EAUA 3CC9A 1FPSA 3WEKA 3ICKA 5B0LA 4LFEA 3WSBA 2OPMA 5ILIA 1YHKA 5ILZA
chains in the Genus database with same CATH topology
3NRIA 3AQCB 5KSXF 1N23A 1V4IA 3WCMA 4PVXF 3UCAA 1N21A 1KIZA 3KROA 4LUUA 5IL3A 2AELA 2DH4A 4EA2A 3KRFA 3WCHA 3TC1A 2F92F 3M00A 2Z7HA 2E90A 3WCEA 2RAHA 5JV1F 5DJRF 5ERNA 3VJCA 2I19A 3AE0A 2E8UA 4JVJF 2O1OA 3M01A 3N6KF 3ICMA 4DI5A 5B0MA 4KVDA 4LA5A 5B0KA 3DYFA 4RXDA 5DGMF 3P8LA 3VJBA 4P0WA 3ACWA 3P8RA 4LLTA 2F8CF 5AYPA 4KQSA 4LTVA 1VG2A 3VJDA 3DYGA 4XQRF 1WMWA 1UBWA 4E9UA 4FJQA 3N0FA 5DGSF 4E9ZA 3VJ9A 3OABA 2OA6A 4NKEA 5DJVF 5B0JA 3WCDA 3OYRA 4MC8A 2PS5A 2E4OA 4KFAA 4DEMF 3Q2QA 4LZ0A 3WCAA 1YHLA 4KQ5A 3LGZB 5IKHA 3WCJA 4KWDA 5B03A 3CP6A 4LFVF 3TFNA 5HN7A 2E95A 2Z4WA 2PS7A 4DZWA 2VF6A 5E8HA 1JFGA 2P1CA 3PH7A 3AQBB 4KPDA 2E91A 3N46F 1YYUA 3QQVA 4KQUA 3PKOA 3OACB 3RYEA 3KRCA 1N20A 2PS4A 5IM1A 2Q58A 3WCIA 3ID0A 3KRCB 2ONGA 4NKFA 5ERMA 2QISA 2Q9ZA 5IK6A 3LLWA 4KUXA 5DW7A 3DYHA 2E8XA 3IPIA 4LA6A 3N5HF 4H5CF 2Z7IA 3LZ9A 1KIYA 2EWGA 1YYSA 2E8VA 3WSAA 3WCGA 1JFAA 2AZJA 4OKZA 1YQ7A 1YHMA 2OPNA 5EROA 2F7MF 4GAXA 3WJNA 4OMGA 4DWBA 3KROB 2PS6A 2AZLA 3AQ0A 4K10A 2Z50A 4N9UA 2Z4YA 1WL3A 4NG6A 1HM4A 2E8WA 3G4FA 4MC3A 5A0KA 3Q2ZA 1YYQA 4XQTF 3KRFB 3SAEA 4MC0A 5IMPA 3S4JA 3LVSA 1RQIA 3M9UA 5H9DA 1WL0A 1VG3A 3NF2A 2Z4ZA 2H8OA 3LEEA 3SDQA 2AETA 3ASXA 3WCLA 3LK5A 3APZA 1YV5A 1VG6A 2PS8A 3SDTA 5HN9A 3V1XA 3WEGA 4F62A 3P41A 3CKEA 2Q9YA 4NFKF 2F9KF 4DHDA 2FTZA 5I1UA 5E8KA 3LSNA 2Z52A 3WC9A 4JZBA 2Q80A 5IK9A 3ICZA 3LOMA 3MZVA 5CG6A 2ZCQA 3V66A 1V4HA 4NUAA 5DGNF 3WEHA 1VG7A 2OGDA 3EZ3A 5C05A 2J1PA 4JYXA 3N3DA 3OABB 2ZEUA 5IN8A 2F94F 1DGPA 3ZL6A 3ZOUA 3PYBA 5B01A 3PYAA 4GA3A 5AFXA 2E93A 5JV0F 1UBVA 1V4JA 4GP2A 5ILHA 4P0VA 2FORA 5IMIA 4LPGF 3W7FA 5IMNA 3TFPA 3EFQA 3RMGA 4QPFA 4RXEA 5DHKA 3ZCDA 3SDUA 4KVYA 5DZ2A 5ILYA 4LIXA 2ONHA 2AZKA 4NFIF 3N1VF 2E92A 1YYTA 3LDWA 3RBMA 4F6XA 3N49F 4KVWA 4GP1A 1N24A 4RYPA 5A0JA 1VG4A 4KK2A 5IL8A 1V4KA 4QXSF 3MAVA 5ILKA 5JV2F 4KPJA 5ILDA 3ZMBA 1EZFA 3KRAA 1HM7A 4LFGA 2F8ZF 4JZXA 3WJKA 4LXWA 3WEJA 5EATA 5E8LA 3WCBA 4F6VA 5EASA 3N0GA 5ER8A 3LGKA 1V4EA 1WL2A 4HD1A 1DI1A 3TS7A 5HNAA 3KB9A 3VJEA 2Z4XA 1HXAA 3WCCA 3ACXA 3N1WF 4KKMA 4DXJA 4OGUA 3P5RA 4RNQA 2ZEVA 5HN8A 3SDVA 4RXCA 3P5PA 2ZCSA 4OKMA 1PS1A 2ZCOA 4H5DF 3BNYA 4PVYF 5ILJA 1YJ4A 4Q23A 5AELA 3WE9A 3M0GA 3LMDA 4OMHA 5B02A 4JXYA 2J1OA 3LJIA 4KVIA 3TFVA 3NPKA 3S9VA 1HX9A 3ICNA 5DJPF 3N3LF 4NFJF 3ACYA 1WKZA 1WL1A 4L2XF 5JA0F 1N1ZA 2J5CA 3IBAA 3QKCA 1N22A 3ADZA 1YYRA 4E1EA 3WJOA 4RXAA 4XQSF 3V1VA 3M02A 4LZ3A 4EA0A 4WK5A 4LLSA 2E94A 3NPRA 1UBYA 1HXGA 3WCFA 2AEKA 4EA1A 3N45F 3PDEA 5DIQF 3KBKA 4FP4A 3EGTA 2F89F 5DHIA 1HXCA 1UBXA 1RTRA 4LOBA 3SDRA 3ZMCA 3N5JF 4UMJA 4H5EF 1ZW5A 3RYWA 1RQJA 5A0IA 3KRPA 3LG5A 5AHUB 1WY0A 4DWGA 3VJAA 5JUZF 3G4DA 3KRPB 2Z4VA 4LTZA 3Q30A 5IVGA 3VJ8A 1N1BA 5IKAA 3Q1OA 4N1ZF 4LZCA 2Z78A 2ZCRA 3WEFA 4P0XA 3OACA 5IK0A 5CG5A 3B7LA 4LPHF 3WEIA 2ZY1A 3KRAB 4JXNA 3BNXA 4ZQ8A 5B00A 5B0IA 2E8TA 5EAUA 3CC9A 1FPSA 3WEKA 3ICKA 5B0LA 4LFEA 3WSBA 2OPMA 5ILIA 1YHKA 5ILZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRI A;  3AQC B;  5KSX F;  1N23 A;  1V4I A;  3WCM A;  4PVX F;  3UCA A;  1N21 A;  1KIZ A;  3KRO A;  4LUU A;  5IL3 A;  2AEL A;  2DH4 A;  4EA2 A;  3KRF A;  3WCH A;  3TC1 A;  2F92 F;  3M00 A;  2Z7H A;  2E90 A;  3WCE A;  2RAH A;  5JV1 F;  5DJR F;  5ERN A;  3VJC A;  2I19 A;  3AE0 A;  2E8U A;  4JVJ F;  2O1O A;  3M01 A;  3N6K F;  3ICM A;  4DI5 A;  5B0M A;  4KVD A;  4LA5 A;  5B0K A;  3DYF A;  4RXD A;  5DGM F;  3P8L A;  3VJB A;  4P0W A;  3ACW A;  3P8R A;  4LLT A;  2F8C F;  5AYP A;  4KQS A;  4LTV A;  1VG2 A;  3VJD A;  3DYG A;  4XQR F;  1WMW A;  1UBW A;  4E9U A;  4FJQ A;  3N0F A;  5DGS F;  4E9Z A;  3VJ9 A;  3OAB A;  2OA6 A;  4NKE A;  5DJV F;  5B0J A;  3WCD A;  3OYR A;  4MC8 A;  2PS5 A;  2E4O A;  4KFA A;  4DEM F;  3Q2Q A;  4LZ0 A;  3WCA A;  1YHL A;  4KQ5 A;  3LGZ B;  5IKH A;  3WCJ A;  4KWD A;  5B03 A;  3CP6 A;  4LFV F;  3TFN A;  5HN7 A;  2E95 A;  2Z4W A;  2PS7 A;  4DZW A;  2VF6 A;  5E8H A;  1JFG A;  2P1C A;  3PH7 A;  3AQB B;  4KPD A;  2E91 A;  3N46 F;  1YYU A;  3QQV A;  4KQU A;  3PKO A;  3OAC B;  3RYE A;  3KRC A;  1N20 A;  2PS4 A;  5IM1 A;  2Q58 A;  3WCI A;  3ID0 A;  3KRC B;  2ONG A;  4NKF A;  5ERM A;  2QIS A;  2Q9Z A;  5IK6 A;  3LLW A;  4KUX A;  5DW7 A;  3DYH A;  2E8X A;  3IPI A;  4LA6 A;  3N5H F;  4H5C F;  2Z7I A;  3LZ9 A;  1KIY A;  2EWG A;  1YYS A;  2E8V A;  3WSA A;  3WCG A;  1JFA A;  2AZJ A;  4OKZ A;  1YQ7 A;  1YHM A;  2OPN A;  5ERO A;  2F7M F;  4GAX A;  3WJN A;  4OMG A;  4DWB A;  3KRO B;  2PS6 A;  2AZL A;  3AQ0 A;  4K10 A;  2Z50 A;  4N9U A;  2Z4Y A;  1WL3 A;  4NG6 A;  1HM4 A;  2E8W A;  3G4F A;  4MC3 A;  5A0K A;  3Q2Z A;  1YYQ A;  4XQT F;  3KRF B;  3SAE A;  4MC0 A;  5IMP A;  3S4J A;  3LVS A;  1RQI A;  3M9U A;  5H9D A;  1WL0 A;  1VG3 A;  3NF2 A;  2Z4Z A;  2H8O A;  3LEE A;  3SDQ A;  2AET A;  3ASX A;  3WCL A;  3LK5 A;  3APZ A;  1YV5 A;  1VG6 A;  2PS8 A;  3SDT A;  5HN9 A;  3V1X A;  3WEG A;  4F62 A;  3P41 A;  3CKE A;  2Q9Y A;  4NFK F;  2F9K F;  4DHD A;  2FTZ A;  5I1U A;  5E8K A;  3LSN A;  2Z52 A;  3WC9 A;  4JZB A;  2Q80 A;  5IK9 A;  3ICZ A;  3LOM A;  3MZV A;  5CG6 A;  2ZCQ A;  3V66 A;  1V4H A;  4NUA A;  5DGN F;  3WEH A;  1VG7 A;  2OGD A;  3EZ3 A;  5C05 A;  2J1P A;  4JYX A;  3N3D A;  3OAB B;  2ZEU A;  5IN8 A;  2F94 F;  1DGP A;  3ZL6 A;  3ZOU A;  3PYB A;  5B01 A;  3PYA A;  4GA3 A;  5AFX A;  2E93 A;  5JV0 F;  1UBV A;  1V4J A;  4GP2 A;  5ILH A;  4P0V A;  2FOR A;  5IMI A;  4LPG F;  3W7F A;  5IMN A;  3TFP A;  3EFQ A;  3RMG A;  4QPF A;  4RXE A;  5DHK A;  3ZCD A;  3SDU A;  4KVY A;  5DZ2 A;  5ILY A;  4LIX A;  2ONH A;  2AZK A;  4NFI F;  3N1V F;  2E92 A;  1YYT A;  3LDW A;  3RBM A;  4F6X A;  3N49 F;  4KVW A;  4GP1 A;  1N24 A;  4RYP A;  5A0J A;  1VG4 A;  4KK2 A;  5IL8 A;  1V4K A;  4QXS F;  3MAV A;  5ILK A;  5JV2 F;  4KPJ A;  5ILD A;  3ZMB A;  1EZF A;  3KRA A;  1HM7 A;  4LFG A;  2F8Z F;  4JZX A;  3WJK A;  4LXW A;  3WEJ A;  5EAT A;  5E8L A;  3WCB A;  4F6V A;  5EAS A;  3N0G A;  5ER8 A;  3LGK A;  1V4E A;  1WL2 A;  4HD1 A;  1DI1 A;  3TS7 A;  5HNA A;  3KB9 A;  3VJE A;  2Z4X A;  1HXA A;  3WCC A;  3ACX A;  3N1W F;  4KKM A;  4DXJ A;  4OGU A;  3P5R A;  4RNQ A;  2ZEV A;  5HN8 A;  3SDV A;  4RXC A;  3P5P A;  2ZCS A;  4OKM A;  1PS1 A;  2ZCO A;  4H5D F;  3BNY A;  4PVY F;  5ILJ A;  1YJ4 A;  4Q23 A;  5AEL A;  3WE9 A;  3M0G A;  3LMD A;  4OMH A;  5B02 A;  4JXY A;  2J1O A;  3LJI A;  4KVI A;  3TFV A;  3NPK A;  3S9V A;  1HX9 A;  3ICN A;  5DJP F;  3N3L F;  4NFJ F;  3ACY A;  1WKZ A;  1WL1 A;  4L2X F;  5JA0 F;  1N1Z A;  2J5C A;  3IBA A;  3QKC A;  1N22 A;  3ADZ A;  1YYR A;  4E1E A;  3WJO A;  4RXA A;  4XQS F;  3V1V A;  3M02 A;  4LZ3 A;  4EA0 A;  4WK5 A;  4LLS A;  2E94 A;  3NPR A;  1UBY A;  1HXG A;  3WCF A;  2AEK A;  4EA1 A;  3N45 F;  3PDE A;  5DIQ F;  3KBK A;  4FP4 A;  3EGT A;  2F89 F;  5DHI A;  1HXC A;  1UBX A;  1RTR A;  4LOB A;  3SDR A;  3ZMC A;  3N5J F;  4UMJ A;  4H5E F;  1ZW5 A;  3RYW A;  1RQJ A;  5A0I A;  3KRP A;  3LG5 A;  5AHU B;  1WY0 A;  4DWG A;  3VJA A;  5JUZ F;  3G4D A;  3KRP B;  2Z4V A;  4LTZ A;  3Q30 A;  5IVG A;  3VJ8 A;  1N1B A;  5IKA A;  3Q1O A;  4N1Z F;  4LZC A;  2Z78 A;  2ZCR A;  3WEF A;  4P0X A;  3OAC A;  5IK0 A;  5CG5 A;  3B7L A;  4LPH F;  3WEI A;  2ZY1 A;  3KRA B;  4JXN A;  3BNX A;  4ZQ8 A;  5B00 A;  5B0I A;  2E8T A;  5EAU A;  3CC9 A;  1FPS A;  3WEK A;  3ICK A;  5B0L A;  4LFE A;  3WSB A;  2OPM A;  5ILI A;  1YHK A;  5ILZ A; 
#chains in the Genus database with same CATH topology
 3NRI A;  3AQC B;  5KSX F;  1N23 A;  1V4I A;  3WCM A;  4PVX F;  3UCA A;  1N21 A;  1KIZ A;  3KRO A;  4LUU A;  5IL3 A;  2AEL A;  2DH4 A;  4EA2 A;  3KRF A;  3WCH A;  3TC1 A;  2F92 F;  3M00 A;  2Z7H A;  2E90 A;  3WCE A;  2RAH A;  5JV1 F;  5DJR F;  5ERN A;  3VJC A;  2I19 A;  3AE0 A;  2E8U A;  4JVJ F;  2O1O A;  3M01 A;  3N6K F;  3ICM A;  4DI5 A;  5B0M A;  4KVD A;  4LA5 A;  5B0K A;  3DYF A;  4RXD A;  5DGM F;  3P8L A;  3VJB A;  4P0W A;  3ACW A;  3P8R A;  4LLT A;  2F8C F;  5AYP A;  4KQS A;  4LTV A;  1VG2 A;  3VJD A;  3DYG A;  4XQR F;  1WMW A;  1UBW A;  4E9U A;  4FJQ A;  3N0F A;  5DGS F;  4E9Z A;  3VJ9 A;  3OAB A;  2OA6 A;  4NKE A;  5DJV F;  5B0J A;  3WCD A;  3OYR A;  4MC8 A;  2PS5 A;  2E4O A;  4KFA A;  4DEM F;  3Q2Q A;  4LZ0 A;  3WCA A;  1YHL A;  4KQ5 A;  3LGZ B;  5IKH A;  3WCJ A;  4KWD A;  5B03 A;  3CP6 A;  4LFV F;  3TFN A;  5HN7 A;  2E95 A;  2Z4W A;  2PS7 A;  4DZW A;  2VF6 A;  5E8H A;  1JFG A;  2P1C A;  3PH7 A;  3AQB B;  4KPD A;  2E91 A;  3N46 F;  1YYU A;  3QQV A;  4KQU A;  3PKO A;  3OAC B;  3RYE A;  3KRC A;  1N20 A;  2PS4 A;  5IM1 A;  2Q58 A;  3WCI A;  3ID0 A;  3KRC B;  2ONG A;  4NKF A;  5ERM A;  2QIS A;  2Q9Z A;  5IK6 A;  3LLW A;  4KUX A;  5DW7 A;  3DYH A;  2E8X A;  3IPI A;  4LA6 A;  3N5H F;  4H5C F;  2Z7I A;  3LZ9 A;  1KIY A;  2EWG A;  1YYS A;  2E8V A;  3WSA A;  3WCG A;  1JFA A;  2AZJ A;  4OKZ A;  1YQ7 A;  1YHM A;  2OPN A;  5ERO A;  2F7M F;  4GAX A;  3WJN A;  4OMG A;  4DWB A;  3KRO B;  2PS6 A;  2AZL A;  3AQ0 A;  4K10 A;  2Z50 A;  4N9U A;  2Z4Y A;  1WL3 A;  4NG6 A;  1HM4 A;  2E8W A;  3G4F A;  4MC3 A;  5A0K A;  3Q2Z A;  1YYQ A;  4XQT F;  3KRF B;  3SAE A;  4MC0 A;  5IMP A;  3S4J A;  3LVS A;  1RQI A;  3M9U A;  5H9D A;  1WL0 A;  1VG3 A;  3NF2 A;  2Z4Z A;  2H8O A;  3LEE A;  3SDQ A;  2AET A;  3ASX A;  3WCL A;  3LK5 A;  3APZ A;  1YV5 A;  1VG6 A;  2PS8 A;  3SDT A;  5HN9 A;  3V1X A;  3WEG A;  4F62 A;  3P41 A;  3CKE A;  2Q9Y A;  4NFK F;  2F9K F;  4DHD A;  2FTZ A;  5I1U A;  5E8K A;  3LSN A;  2Z52 A;  3WC9 A;  4JZB A;  2Q80 A;  5IK9 A;  3ICZ A;  3LOM A;  3MZV A;  5CG6 A;  2ZCQ A;  3V66 A;  1V4H A;  4NUA A;  5DGN F;  3WEH A;  1VG7 A;  2OGD A;  3EZ3 A;  5C05 A;  2J1P A;  4JYX A;  3N3D A;  3OAB B;  2ZEU A;  5IN8 A;  2F94 F;  1DGP A;  3ZL6 A;  3ZOU A;  3PYB A;  5B01 A;  3PYA A;  4GA3 A;  5AFX A;  2E93 A;  5JV0 F;  1UBV A;  1V4J A;  4GP2 A;  5ILH A;  4P0V A;  2FOR A;  5IMI A;  4LPG F;  3W7F A;  5IMN A;  3TFP A;  3EFQ A;  3RMG A;  4QPF A;  4RXE A;  5DHK A;  3ZCD A;  3SDU A;  4KVY A;  5DZ2 A;  5ILY A;  4LIX A;  2ONH A;  2AZK A;  4NFI F;  3N1V F;  2E92 A;  1YYT A;  3LDW A;  3RBM A;  4F6X A;  3N49 F;  4KVW A;  4GP1 A;  1N24 A;  4RYP A;  5A0J A;  1VG4 A;  4KK2 A;  5IL8 A;  1V4K A;  4QXS F;  3MAV A;  5ILK A;  5JV2 F;  4KPJ A;  5ILD A;  3ZMB A;  1EZF A;  3KRA A;  1HM7 A;  4LFG A;  2F8Z F;  4JZX A;  3WJK A;  4LXW A;  3WEJ A;  5EAT A;  5E8L A;  3WCB A;  4F6V A;  5EAS A;  3N0G A;  5ER8 A;  3LGK A;  1V4E A;  1WL2 A;  4HD1 A;  1DI1 A;  3TS7 A;  5HNA A;  3KB9 A;  3VJE A;  2Z4X A;  1HXA A;  3WCC A;  3ACX A;  3N1W F;  4KKM A;  4DXJ A;  4OGU A;  3P5R A;  4RNQ A;  2ZEV A;  5HN8 A;  3SDV A;  4RXC A;  3P5P A;  2ZCS A;  4OKM A;  1PS1 A;  2ZCO A;  4H5D F;  3BNY A;  4PVY F;  5ILJ A;  1YJ4 A;  4Q23 A;  5AEL A;  3WE9 A;  3M0G A;  3LMD A;  4OMH A;  5B02 A;  4JXY A;  2J1O A;  3LJI A;  4KVI A;  3TFV A;  3NPK A;  3S9V A;  1HX9 A;  3ICN A;  5DJP F;  3N3L F;  4NFJ F;  3ACY A;  1WKZ A;  1WL1 A;  4L2X F;  5JA0 F;  1N1Z A;  2J5C A;  3IBA A;  3QKC A;  1N22 A;  3ADZ A;  1YYR A;  4E1E A;  3WJO A;  4RXA A;  4XQS F;  3V1V A;  3M02 A;  4LZ3 A;  4EA0 A;  4WK5 A;  4LLS A;  2E94 A;  3NPR A;  1UBY A;  1HXG A;  3WCF A;  2AEK A;  4EA1 A;  3N45 F;  3PDE A;  5DIQ F;  3KBK A;  4FP4 A;  3EGT A;  2F89 F;  5DHI A;  1HXC A;  1UBX A;  1RTR A;  4LOB A;  3SDR A;  3ZMC A;  3N5J F;  4UMJ A;  4H5E F;  1ZW5 A;  3RYW A;  1RQJ A;  5A0I A;  3KRP A;  3LG5 A;  5AHU B;  1WY0 A;  4DWG A;  3VJA A;  5JUZ F;  3G4D A;  3KRP B;  2Z4V A;  4LTZ A;  3Q30 A;  5IVG A;  3VJ8 A;  1N1B A;  5IKA A;  3Q1O A;  4N1Z F;  4LZC A;  2Z78 A;  2ZCR A;  3WEF A;  4P0X A;  3OAC A;  5IK0 A;  5CG5 A;  3B7L A;  4LPH F;  3WEI A;  2ZY1 A;  3KRA B;  4JXN A;  3BNX A;  4ZQ8 A;  5B00 A;  5B0I A;  2E8T A;  5EAU A;  3CC9 A;  1FPS A;  3WEK A;  3ICK A;  5B0L A;  4LFE A;  3WSB A;  2OPM A;  5ILI A;  1YHK A;  5ILZ A; 
#chains in the Genus database with same CATH homology
 3NRI A;  3AQC B;  5KSX F;  1N23 A;  1V4I A;  3WCM A;  4PVX F;  3UCA A;  1N21 A;  1KIZ A;  3KRO A;  4LUU A;  5IL3 A;  2AEL A;  2DH4 A;  4EA2 A;  3KRF A;  3WCH A;  3TC1 A;  2F92 F;  3M00 A;  2Z7H A;  2E90 A;  3WCE A;  2RAH A;  5JV1 F;  5DJR F;  5ERN A;  3VJC A;  2I19 A;  3AE0 A;  2E8U A;  4JVJ F;  2O1O A;  3M01 A;  3N6K F;  3ICM A;  4DI5 A;  5B0M A;  4KVD A;  4LA5 A;  5B0K A;  3DYF A;  4RXD A;  5DGM F;  3P8L A;  3VJB A;  4P0W A;  3ACW A;  3P8R A;  4LLT A;  2F8C F;  5AYP A;  4KQS A;  4LTV A;  1VG2 A;  3VJD A;  3DYG A;  4XQR F;  1WMW A;  1UBW A;  4E9U A;  4FJQ A;  3N0F A;  5DGS F;  4E9Z A;  3VJ9 A;  3OAB A;  2OA6 A;  4NKE A;  5DJV F;  5B0J A;  3WCD A;  3OYR A;  4MC8 A;  2PS5 A;  2E4O A;  4KFA A;  4DEM F;  3Q2Q A;  4LZ0 A;  3WCA A;  1YHL A;  4KQ5 A;  3LGZ B;  5IKH A;  3WCJ A;  4KWD A;  5B03 A;  3CP6 A;  4LFV F;  3TFN A;  5HN7 A;  2E95 A;  2Z4W A;  2PS7 A;  4DZW A;  2VF6 A;  5E8H A;  1JFG A;  2P1C A;  3PH7 A;  3AQB B;  4KPD A;  2E91 A;  3N46 F;  1YYU A;  3QQV A;  4KQU A;  3PKO A;  3OAC B;  3RYE A;  3KRC A;  1N20 A;  2PS4 A;  5IM1 A;  2Q58 A;  3WCI A;  3ID0 A;  3KRC B;  2ONG A;  4NKF A;  5ERM A;  2QIS A;  2Q9Z A;  5IK6 A;  3LLW A;  4KUX A;  5DW7 A;  3DYH A;  2E8X A;  3IPI A;  4LA6 A;  3N5H F;  4H5C F;  2Z7I A;  3LZ9 A;  1KIY A;  2EWG A;  1YYS A;  2E8V A;  3WSA A;  3WCG A;  1JFA A;  2AZJ A;  4OKZ A;  1YQ7 A;  1YHM A;  2OPN A;  5ERO A;  2F7M F;  4GAX A;  3WJN A;  4OMG A;  4DWB A;  3KRO B;  2PS6 A;  2AZL A;  3AQ0 A;  4K10 A;  2Z50 A;  4N9U A;  2Z4Y A;  1WL3 A;  4NG6 A;  1HM4 A;  2E8W A;  3G4F A;  4MC3 A;  5A0K A;  3Q2Z A;  1YYQ A;  4XQT F;  3KRF B;  3SAE A;  4MC0 A;  5IMP A;  3S4J A;  3LVS A;  1RQI A;  3M9U A;  5H9D A;  1WL0 A;  1VG3 A;  3NF2 A;  2Z4Z A;  2H8O A;  3LEE A;  3SDQ A;  2AET A;  3ASX A;  3WCL A;  3LK5 A;  3APZ A;  1YV5 A;  1VG6 A;  2PS8 A;  3SDT A;  5HN9 A;  3V1X A;  3WEG A;  4F62 A;  3P41 A;  3CKE A;  2Q9Y A;  4NFK F;  2F9K F;  4DHD A;  2FTZ A;  5I1U A;  5E8K A;  3LSN A;  2Z52 A;  3WC9 A;  4JZB A;  2Q80 A;  5IK9 A;  3ICZ A;  3LOM A;  3MZV A;  5CG6 A;  2ZCQ A;  3V66 A;  1V4H A;  4NUA A;  5DGN F;  3WEH A;  1VG7 A;  2OGD A;  3EZ3 A;  5C05 A;  2J1P A;  4JYX A;  3N3D A;  3OAB B;  2ZEU A;  5IN8 A;  2F94 F;  1DGP A;  3ZL6 A;  3ZOU A;  3PYB A;  5B01 A;  3PYA A;  4GA3 A;  5AFX A;  2E93 A;  5JV0 F;  1UBV A;  1V4J A;  4GP2 A;  5ILH A;  4P0V A;  2FOR A;  5IMI A;  4LPG F;  3W7F A;  5IMN A;  3TFP A;  3EFQ A;  3RMG A;  4QPF A;  4RXE A;  5DHK A;  3ZCD A;  3SDU A;  4KVY A;  5DZ2 A;  5ILY A;  4LIX A;  2ONH A;  2AZK A;  4NFI F;  3N1V F;  2E92 A;  1YYT A;  3LDW A;  3RBM A;  4F6X A;  3N49 F;  4KVW A;  4GP1 A;  1N24 A;  4RYP A;  5A0J A;  1VG4 A;  4KK2 A;  5IL8 A;  1V4K A;  4QXS F;  3MAV A;  5ILK A;  5JV2 F;  4KPJ A;  5ILD A;  3ZMB A;  1EZF A;  3KRA A;  1HM7 A;  4LFG A;  2F8Z F;  4JZX A;  3WJK A;  4LXW A;  3WEJ A;  5EAT A;  5E8L A;  3WCB A;  4F6V A;  5EAS A;  3N0G A;  5ER8 A;  3LGK A;  1V4E A;  1WL2 A;  4HD1 A;  1DI1 A;  3TS7 A;  5HNA A;  3KB9 A;  3VJE A;  2Z4X A;  1HXA A;  3WCC A;  3ACX A;  3N1W F;  4KKM A;  4DXJ A;  4OGU A;  3P5R A;  4RNQ A;  2ZEV A;  5HN8 A;  3SDV A;  4RXC A;  3P5P A;  2ZCS A;  4OKM A;  1PS1 A;  2ZCO A;  4H5D F;  3BNY A;  4PVY F;  5ILJ A;  1YJ4 A;  4Q23 A;  5AEL A;  3WE9 A;  3M0G A;  3LMD A;  4OMH A;  5B02 A;  4JXY A;  2J1O A;  3LJI A;  4KVI A;  3TFV A;  3NPK A;  3S9V A;  1HX9 A;  3ICN A;  5DJP F;  3N3L F;  4NFJ F;  3ACY A;  1WKZ A;  1WL1 A;  4L2X F;  5JA0 F;  1N1Z A;  2J5C A;  3IBA A;  3QKC A;  1N22 A;  3ADZ A;  1YYR A;  4E1E A;  3WJO A;  4RXA A;  4XQS F;  3V1V A;  3M02 A;  4LZ3 A;  4EA0 A;  4WK5 A;  4LLS A;  2E94 A;  3NPR A;  1UBY A;  1HXG A;  3WCF A;  2AEK A;  4EA1 A;  3N45 F;  3PDE A;  5DIQ F;  3KBK A;  4FP4 A;  3EGT A;  2F89 F;  5DHI A;  1HXC A;  1UBX A;  1RTR A;  4LOB A;  3SDR A;  3ZMC A;  3N5J F;  4UMJ A;  4H5E F;  1ZW5 A;  3RYW A;  1RQJ A;  5A0I A;  3KRP A;  3LG5 A;  5AHU B;  1WY0 A;  4DWG A;  3VJA A;  5JUZ F;  3G4D A;  3KRP B;  2Z4V A;  4LTZ A;  3Q30 A;  5IVG A;  3VJ8 A;  1N1B A;  5IKA A;  3Q1O A;  4N1Z F;  4LZC A;  2Z78 A;  2ZCR A;  3WEF A;  4P0X A;  3OAC A;  5IK0 A;  5CG5 A;  3B7L A;  4LPH F;  3WEI A;  2ZY1 A;  3KRA B;  4JXN A;  3BNX A;  4ZQ8 A;  5B00 A;  5B0I A;  2E8T A;  5EAU A;  3CC9 A;  1FPS A;  3WEK A;  3ICK A;  5B0L A;  4LFE A;  3WSB A;  2OPM A;  5ILI A;  1YHK A;  5ILZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...