3KRPB

Mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium and gpp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
256
Chain Sequence
MQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLTDGSRPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALEELGGKNAELMSSLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranyl diphosphate synthase large subunit
publication title Structure of a heterotetrameric geranyl pyrophosphate synthase from mint (Mentha piperita) reveals intersubunit regulation
pubmed doi rcsb
source organism Mentha x piperita
molecule tags Transferase
total genus 87
structure length 256
sequence length 259
chains with identical sequence C
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2009-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3krpB00
3V1VA 4DHDA 1RQIA 3ID0A 3NF2A 1YV5A 5IK9A 5B0JA 5HN8A 3S9VA 1YHMA 4JZXA 3AQ0A 3ACYA 3ACWA 3MAVA 3EZ3A 5EAUA 4P0XA 2OPMA 1YYUA 3RBMA 5EASA 3TFNA 2VF6A 3WSAA 4N1ZF 3UCAA 5EROA 2OGDA 3DYHA 1N21A 5IL8A 5DGSF 1N20A 3P41A 1UBVA 3SDVA 3Q1OA 2F92F 3WEFA 4L2XF 1WMWA 1V4IA 1HXCA 1KIYA 4KVWA 4DI5A 1RQJA 3DYGA 1DI1A 1N1ZA 3WCLA 3LK5A 2Z52A 4FJQA 5ER8A 4OGUA 2ZEUA 2Z7IA 3ZMBA 3RYEA 4PVYF 3S4JA 3WCMA 4NFIF 2Z50A 3ZL6A 2P1CA 4LFVF 2E94A 1VG6A 5IKHA 4EA1A 3WCAA 3WC9A 2Q9ZA 5JUZF 3LSNA 2Z78A 4KVYA 4EA0A 3WJOA 3RMGA 4JZBA 2J1PA 4FP4A 2OA6A 3N3DA 3N45F 3SAEA 1YYSA 3WCBA 5DJVF 3OABB 4E9UA 3PDEA 2AEKA 4LLSA 3LGKA 3ADZA 4NFJF 5JV0F 2F8CF 2H8OA 4K10A 2Z7HA 1VG4A 2PS4A 4RNQA 5DGMF 3M01A 4NFKF 4OMHA 3AE0A 1UBYA 2I19A 3N1VF 2F7MF 1V4KA 3SDTA 2E95A 1DGPA 2ZCQA 3N49F 4KQ5A 5B0KA 3LOMA 4KPDA 3P8RA 2E91A 3ICZA 3Q2ZA 5JV1F 4H5CF 4Q23A 3WCIA 3KROB 4N9UA 1N24A 2OPNA 5E8LA 2PS7A 3WEHA 5ILDA 3VJBA 5DJRF 3ZOUA 4JXYA 3KRCB 4OKZA 4PVXF 3WEKA 1YYRA 2Z4WA 4KPJA 1HX9A 4RXDA 1HXGA 5HN9A 3BNYA 3DYFA 2E8UA 4OKMA 1HXAA 3N46F 1V4EA 2E4OA 4XQRF 3CKEA 3OYRA 4LFEA 5A0KA 3KRAB 4LA5A 5CG6A 2FORA 2E8TA 1JFGA 5B02A 3TFPA 3OABA 3ASXA 4DEMF 3WEGA 3TS7A 3WCDA 3ZMCA 3QQVA 5IVGA 5B03A 5B01A 5AELA 2AZKA 4LUUA 1WY0A 3KBKA 4KWDA 5DHIA 2Z4XA 2F89F 3ZCDA 1YYTA 3WEIA 2Z4YA 3KRPB 5AFXA 1WL0A 4LIXA 5DW7A 3AQBB 4F62A 4KUXA 3OACB 4LPGF 2E8VA 4RXCA 3P5RA 3NPRA 2ZEVA 3TFVA 4E9ZA 5KSXF 4RXEA 4XQSF 1FPSA 3VJ9A 1WKZA 2PS8A 3KROA 4MC3A 3WEJA 4KQSA 3WCGA 5I1UA 2J1OA 4LA6A 1VG3A 2E90A 4MC8A 3P5PA 3CP6A 1WL1A 4H5DF 3KRCA 1VG2A 5EATA 2F94F 5H9DA 1HM4A 4E1EA 3W7FA 2PS5A 2Q9YA 3WJKA 4EA2A 5ILJA 4H5EF 3LDWA 3PYAA 4F6XA 3KRFB 4LTZA 4HD1A 1YQ7A 2E92A 4KK2A 4RXAA 2ONHA 4NKEA 5ILKA 4OMGA 3KRAA 2PS6A 4NUAA 3CC9A 4KVDA 2AETA 4QXSF 5AHUB 5HN7A 3ACXA 2Q58A 3N5JF 3EFQA 1UBXA 3VJCA 5DGNF 2DH4A 3WE9A 3WCCA 3N0GA 1RTRA 2FTZA 5ERNA 5E8HA 4KVIA 3WJNA 5CG5A 2Z4VA 4DXJA 2E93A 3SDQA 5HNAA 3KRPA 3WSBA 1WL3A 3WCHA 4GA3A 4MC0A 2AELA 3OACA 3PYBA 2EWGA 4KQUA 5ILIA 4JXNA 3NPKA 5IMIA 1WL2A 3VJEA 4LPHF 3LZ9A 3M02A 1YYQA 4LLTA 4LOBA 3IPIA 5IMPA 3LJIA 3N0FA 1YJ4A 5IMNA 4GAXA 1VG7A 1JFAA 4DWBA 4LTVA 3ICNA 4LZCA 5B0MA 4NKFA 3TC1A 1V4HA 5ILZA 5ILHA 2E8XA 3ICMA 3WCJA 3LG5A 4WK5A 3BNXA 4LXWA 1UBWA 1N23A 2AZLA 4LFGA 3RYWA 3KRFA 3VJAA 3LVSA 5C05A 3P8LA 1N22A 2ZCRA 3LEEA 3MZVA 3Q2QA 5JA0F 3VJDA 4P0WA 5IL3A 5IM1A 4RYPA 4DWGA 2ONGA 3ICKA 3APZA 2F9KF 4GP1A 4DZWA 5DHKA 3N5HF 4GP2A 3N6KF 5ILYA 3G4DA 4QPFA 5IKAA 1N1BA 2RAHA 4NG6A 5IK6A 2ZY1A 5IK0A 3AQCB 3PH7A 2Z4ZA 2AZJA 3M0GA 3Q30A 3PKOA 3WCFA 1EZFA 4LZ0A 3SDRA 3EGTA 3NRIA 3VJ8A 5DIQF 3KB9A 4XQTF 3LGZB 3SDUA 4F6VA 2ZCOA 3B7LA 3M9UA 3LMDA 2E8WA 2ZCSA 1PS1A 1YHKA 1V4JA 2J5CA 3M00A 4JYXA 5B0LA 1KIZA 5A0JA 2F8ZF 3V66A 2O1OA 4UMJA 3N3LF 5DZ2A 5B0IA 3IBAA 3WCEA 5A0IA 2QISA 5DJPF 1ZW5A 3LLWA 4JVJF 5IN8A 1YHLA 4P0VA 5B00A 3QKCA 5JV2F 2Q80A 1HM7A 3V1XA 5AYPA 3N1WF 4KKMA 3G4FA 4ZQ8A 5ERMA 4LZ3A 4KFAA 5E8KA
chains in the Genus database with same CATH superfamily
3V1VA 4DHDA 1RQIA 3ID0A 3NF2A 1YV5A 5IK9A 5B0JA 5HN8A 3S9VA 1YHMA 4JZXA 3AQ0A 3ACYA 3ACWA 3MAVA 3EZ3A 5EAUA 4P0XA 2OPMA 1YYUA 3RBMA 5EASA 3TFNA 2VF6A 3WSAA 4N1ZF 3UCAA 5EROA 2OGDA 3DYHA 1N21A 5IL8A 5DGSF 1N20A 3P41A 1UBVA 3SDVA 3Q1OA 2F92F 3WEFA 4L2XF 1WMWA 1V4IA 1HXCA 1KIYA 4KVWA 4DI5A 1RQJA 3DYGA 1DI1A 1N1ZA 3WCLA 3LK5A 2Z52A 4FJQA 5ER8A 4OGUA 2ZEUA 2Z7IA 3ZMBA 3RYEA 4PVYF 3S4JA 3WCMA 4NFIF 2Z50A 3ZL6A 2P1CA 4LFVF 2E94A 1VG6A 5IKHA 4EA1A 3WCAA 3WC9A 2Q9ZA 5JUZF 3LSNA 2Z78A 4KVYA 4EA0A 3WJOA 3RMGA 4JZBA 2J1PA 4FP4A 2OA6A 3N3DA 3N45F 3SAEA 1YYSA 3WCBA 5DJVF 3OABB 4E9UA 3PDEA 2AEKA 4LLSA 3LGKA 3ADZA 4NFJF 5JV0F 2F8CF 2H8OA 4K10A 2Z7HA 1VG4A 2PS4A 4RNQA 5DGMF 3M01A 4NFKF 4OMHA 3AE0A 1UBYA 2I19A 3N1VF 2F7MF 1V4KA 3SDTA 2E95A 1DGPA 2ZCQA 3N49F 4KQ5A 5B0KA 3LOMA 4KPDA 3P8RA 2E91A 3ICZA 3Q2ZA 5JV1F 4H5CF 4Q23A 3WCIA 3KROB 4N9UA 1N24A 2OPNA 5E8LA 2PS7A 3WEHA 5ILDA 3VJBA 5DJRF 3ZOUA 4JXYA 3KRCB 4OKZA 4PVXF 3WEKA 1YYRA 2Z4WA 4KPJA 1HX9A 4RXDA 1HXGA 5HN9A 3BNYA 3DYFA 2E8UA 4OKMA 1HXAA 3N46F 1V4EA 2E4OA 4XQRF 3CKEA 3OYRA 4LFEA 5A0KA 3KRAB 4LA5A 5CG6A 2FORA 2E8TA 1JFGA 5B02A 3TFPA 3OABA 3ASXA 4DEMF 3WEGA 3TS7A 3WCDA 3ZMCA 3QQVA 5IVGA 5B03A 5B01A 5AELA 2AZKA 4LUUA 1WY0A 3KBKA 4KWDA 5DHIA 2Z4XA 2F89F 3ZCDA 1YYTA 3WEIA 2Z4YA 3KRPB 5AFXA 1WL0A 4LIXA 5DW7A 3AQBB 4F62A 4KUXA 3OACB 4LPGF 2E8VA 4RXCA 3P5RA 3NPRA 2ZEVA 3TFVA 4E9ZA 5KSXF 4RXEA 4XQSF 1FPSA 3VJ9A 1WKZA 2PS8A 3KROA 4MC3A 3WEJA 4KQSA 3WCGA 5I1UA 2J1OA 4LA6A 1VG3A 2E90A 4MC8A 3P5PA 3CP6A 1WL1A 4H5DF 3KRCA 1VG2A 5EATA 2F94F 5H9DA 1HM4A 4E1EA 3W7FA 2PS5A 2Q9YA 3WJKA 4EA2A 5ILJA 4H5EF 3LDWA 3PYAA 4F6XA 3KRFB 4LTZA 4HD1A 1YQ7A 2E92A 4KK2A 4RXAA 2ONHA 4NKEA 5ILKA 4OMGA 3KRAA 2PS6A 4NUAA 3CC9A 4KVDA 2AETA 4QXSF 5AHUB 5HN7A 3ACXA 2Q58A 3N5JF 3EFQA 1UBXA 3VJCA 5DGNF 2DH4A 3WE9A 3WCCA 3N0GA 1RTRA 2FTZA 5ERNA 5E8HA 4KVIA 3WJNA 5CG5A 2Z4VA 4DXJA 2E93A 3SDQA 5HNAA 3KRPA 3WSBA 1WL3A 3WCHA 4GA3A 4MC0A 2AELA 3OACA 3PYBA 2EWGA 4KQUA 5ILIA 4JXNA 3NPKA 5IMIA 1WL2A 3VJEA 4LPHF 3LZ9A 3M02A 1YYQA 4LLTA 4LOBA 3IPIA 5IMPA 3LJIA 3N0FA 1YJ4A 5IMNA 4GAXA 1VG7A 1JFAA 4DWBA 4LTVA 3ICNA 4LZCA 5B0MA 4NKFA 3TC1A 1V4HA 5ILZA 5ILHA 2E8XA 3ICMA 3WCJA 3LG5A 4WK5A 3BNXA 4LXWA 1UBWA 1N23A 2AZLA 4LFGA 3RYWA 3KRFA 3VJAA 3LVSA 5C05A 3P8LA 1N22A 2ZCRA 3LEEA 3MZVA 3Q2QA 5JA0F 3VJDA 4P0WA 5IL3A 5IM1A 4RYPA 4DWGA 2ONGA 3ICKA 3APZA 2F9KF 4GP1A 4DZWA 5DHKA 3N5HF 4GP2A 3N6KF 5ILYA 3G4DA 4QPFA 5IKAA 1N1BA 2RAHA 4NG6A 5IK6A 2ZY1A 5IK0A 3AQCB 3PH7A 2Z4ZA 2AZJA 3M0GA 3Q30A 3PKOA 3WCFA 1EZFA 4LZ0A 3SDRA 3EGTA 3NRIA 3VJ8A 5DIQF 3KB9A 4XQTF 3LGZB 3SDUA 4F6VA 2ZCOA 3B7LA 3M9UA 3LMDA 2E8WA 2ZCSA 1PS1A 1YHKA 1V4JA 2J5CA 3M00A 4JYXA 5B0LA 1KIZA 5A0JA 2F8ZF 3V66A 2O1OA 4UMJA 3N3LF 5DZ2A 5B0IA 3IBAA 3WCEA 5A0IA 2QISA 5DJPF 1ZW5A 3LLWA 4JVJF 5IN8A 1YHLA 4P0VA 5B00A 3QKCA 5JV2F 2Q80A 1HM7A 3V1XA 5AYPA 3N1WF 4KKMA 3G4FA 4ZQ8A 5ERMA 4LZ3A 4KFAA 5E8KA
chains in the Genus database with same CATH topology
3V1VA 4DHDA 1RQIA 3ID0A 3NF2A 1YV5A 5IK9A 5B0JA 5HN8A 3S9VA 1YHMA 4JZXA 3AQ0A 3ACYA 3ACWA 3MAVA 3EZ3A 5EAUA 4P0XA 2OPMA 1YYUA 3RBMA 5EASA 3TFNA 2VF6A 3WSAA 4N1ZF 3UCAA 5EROA 2OGDA 3DYHA 1N21A 5IL8A 5DGSF 1N20A 3P41A 1UBVA 3SDVA 3Q1OA 2F92F 3WEFA 4L2XF 1WMWA 1V4IA 1HXCA 1KIYA 4KVWA 4DI5A 1RQJA 3DYGA 1DI1A 1N1ZA 3WCLA 3LK5A 2Z52A 4FJQA 5ER8A 4OGUA 2ZEUA 2Z7IA 3ZMBA 3RYEA 4PVYF 3S4JA 3WCMA 4NFIF 2Z50A 3ZL6A 2P1CA 4LFVF 2E94A 1VG6A 5IKHA 4EA1A 3WCAA 3WC9A 2Q9ZA 5JUZF 3LSNA 2Z78A 4KVYA 4EA0A 3WJOA 3RMGA 4JZBA 2J1PA 4FP4A 2OA6A 3N3DA 3N45F 3SAEA 1YYSA 3WCBA 5DJVF 3OABB 4E9UA 3PDEA 2AEKA 4LLSA 3LGKA 3ADZA 4NFJF 5JV0F 2F8CF 2H8OA 4K10A 2Z7HA 1VG4A 2PS4A 4RNQA 5DGMF 3M01A 4NFKF 4OMHA 3AE0A 1UBYA 2I19A 3N1VF 2F7MF 1V4KA 3SDTA 2E95A 1DGPA 2ZCQA 3N49F 4KQ5A 5B0KA 3LOMA 4KPDA 3P8RA 2E91A 3ICZA 3Q2ZA 5JV1F 4H5CF 4Q23A 3WCIA 3KROB 4N9UA 1N24A 2OPNA 5E8LA 2PS7A 3WEHA 5ILDA 3VJBA 5DJRF 3ZOUA 4JXYA 3KRCB 4OKZA 4PVXF 3WEKA 1YYRA 2Z4WA 4KPJA 1HX9A 4RXDA 1HXGA 5HN9A 3BNYA 3DYFA 2E8UA 4OKMA 1HXAA 3N46F 1V4EA 2E4OA 4XQRF 3CKEA 3OYRA 4LFEA 5A0KA 3KRAB 4LA5A 5CG6A 2FORA 2E8TA 1JFGA 5B02A 3TFPA 3OABA 3ASXA 4DEMF 3WEGA 3TS7A 3WCDA 3ZMCA 3QQVA 5IVGA 5B03A 5B01A 5AELA 2AZKA 4LUUA 1WY0A 3KBKA 4KWDA 5DHIA 2Z4XA 2F89F 3ZCDA 1YYTA 3WEIA 2Z4YA 3KRPB 5AFXA 1WL0A 4LIXA 5DW7A 3AQBB 4F62A 4KUXA 3OACB 4LPGF 2E8VA 4RXCA 3P5RA 3NPRA 2ZEVA 3TFVA 4E9ZA 5KSXF 4RXEA 4XQSF 1FPSA 3VJ9A 1WKZA 2PS8A 3KROA 4MC3A 3WEJA 4KQSA 3WCGA 5I1UA 2J1OA 4LA6A 1VG3A 2E90A 4MC8A 3P5PA 3CP6A 1WL1A 4H5DF 3KRCA 1VG2A 5EATA 2F94F 5H9DA 1HM4A 4E1EA 3W7FA 2PS5A 2Q9YA 3WJKA 4EA2A 5ILJA 4H5EF 3LDWA 3PYAA 4F6XA 3KRFB 4LTZA 4HD1A 1YQ7A 2E92A 4KK2A 4RXAA 2ONHA 4NKEA 5ILKA 4OMGA 3KRAA 2PS6A 4NUAA 3CC9A 4KVDA 2AETA 4QXSF 5AHUB 5HN7A 3ACXA 2Q58A 3N5JF 3EFQA 1UBXA 3VJCA 5DGNF 2DH4A 3WE9A 3WCCA 3N0GA 1RTRA 2FTZA 5ERNA 5E8HA 4KVIA 3WJNA 5CG5A 2Z4VA 4DXJA 2E93A 3SDQA 5HNAA 3KRPA 3WSBA 1WL3A 3WCHA 4GA3A 4MC0A 2AELA 3OACA 3PYBA 2EWGA 4KQUA 5ILIA 4JXNA 3NPKA 5IMIA 1WL2A 3VJEA 4LPHF 3LZ9A 3M02A 1YYQA 4LLTA 4LOBA 3IPIA 5IMPA 3LJIA 3N0FA 1YJ4A 5IMNA 4GAXA 1VG7A 1JFAA 4DWBA 4LTVA 3ICNA 4LZCA 5B0MA 4NKFA 3TC1A 1V4HA 5ILZA 5ILHA 2E8XA 3ICMA 3WCJA 3LG5A 4WK5A 3BNXA 4LXWA 1UBWA 1N23A 2AZLA 4LFGA 3RYWA 3KRFA 3VJAA 3LVSA 5C05A 3P8LA 1N22A 2ZCRA 3LEEA 3MZVA 3Q2QA 5JA0F 3VJDA 4P0WA 5IL3A 5IM1A 4RYPA 4DWGA 2ONGA 3ICKA 3APZA 2F9KF 4GP1A 4DZWA 5DHKA 3N5HF 4GP2A 3N6KF 5ILYA 3G4DA 4QPFA 5IKAA 1N1BA 2RAHA 4NG6A 5IK6A 2ZY1A 5IK0A 3AQCB 3PH7A 2Z4ZA 2AZJA 3M0GA 3Q30A 3PKOA 3WCFA 1EZFA 4LZ0A 3SDRA 3EGTA 3NRIA 3VJ8A 5DIQF 3KB9A 4XQTF 3LGZB 3SDUA 4F6VA 2ZCOA 3B7LA 3M9UA 3LMDA 2E8WA 2ZCSA 1PS1A 1YHKA 1V4JA 2J5CA 3M00A 4JYXA 5B0LA 1KIZA 5A0JA 2F8ZF 3V66A 2O1OA 4UMJA 3N3LF 5DZ2A 5B0IA 3IBAA 3WCEA 5A0IA 2QISA 5DJPF 1ZW5A 3LLWA 4JVJF 5IN8A 1YHLA 4P0VA 5B00A 3QKCA 5JV2F 2Q80A 1HM7A 3V1XA 5AYPA 3N1WF 4KKMA 3G4FA 4ZQ8A 5ERMA 4LZ3A 4KFAA 5E8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V1V A;  4DHD A;  1RQI A;  3ID0 A;  3NF2 A;  1YV5 A;  5IK9 A;  5B0J A;  5HN8 A;  3S9V A;  1YHM A;  4JZX A;  3AQ0 A;  3ACY A;  3ACW A;  3MAV A;  3EZ3 A;  5EAU A;  4P0X A;  2OPM A;  1YYU A;  3RBM A;  5EAS A;  3TFN A;  2VF6 A;  3WSA A;  4N1Z F;  3UCA A;  5ERO A;  2OGD A;  3DYH A;  1N21 A;  5IL8 A;  5DGS F;  1N20 A;  3P41 A;  1UBV A;  3SDV A;  3Q1O A;  2F92 F;  3WEF A;  4L2X F;  1WMW A;  1V4I A;  1HXC A;  1KIY A;  4KVW A;  4DI5 A;  1RQJ A;  3DYG A;  1DI1 A;  1N1Z A;  3WCL A;  3LK5 A;  2Z52 A;  4FJQ A;  5ER8 A;  4OGU A;  2ZEU A;  2Z7I A;  3ZMB A;  3RYE A;  4PVY F;  3S4J A;  3WCM A;  4NFI F;  2Z50 A;  3ZL6 A;  2P1C A;  4LFV F;  2E94 A;  1VG6 A;  5IKH A;  4EA1 A;  3WCA A;  3WC9 A;  2Q9Z A;  5JUZ F;  3LSN A;  2Z78 A;  4KVY A;  4EA0 A;  3WJO A;  3RMG A;  4JZB A;  2J1P A;  4FP4 A;  2OA6 A;  3N3D A;  3N45 F;  3SAE A;  1YYS A;  3WCB A;  5DJV F;  3OAB B;  4E9U A;  3PDE A;  2AEK A;  4LLS A;  3LGK A;  3ADZ A;  4NFJ F;  5JV0 F;  2F8C F;  2H8O A;  4K10 A;  2Z7H A;  1VG4 A;  2PS4 A;  4RNQ A;  5DGM F;  3M01 A;  4NFK F;  4OMH A;  3AE0 A;  1UBY A;  2I19 A;  3N1V F;  2F7M F;  1V4K A;  3SDT A;  2E95 A;  1DGP A;  2ZCQ A;  3N49 F;  4KQ5 A;  5B0K A;  3LOM A;  4KPD A;  3P8R A;  2E91 A;  3ICZ A;  3Q2Z A;  5JV1 F;  4H5C F;  4Q23 A;  3WCI A;  3KRO B;  4N9U A;  1N24 A;  2OPN A;  5E8L A;  2PS7 A;  3WEH A;  5ILD A;  3VJB A;  5DJR F;  3ZOU A;  4JXY A;  3KRC B;  4OKZ A;  4PVX F;  3WEK A;  1YYR A;  2Z4W A;  4KPJ A;  1HX9 A;  4RXD A;  1HXG A;  5HN9 A;  3BNY A;  3DYF A;  2E8U A;  4OKM A;  1HXA A;  3N46 F;  1V4E A;  2E4O A;  4XQR F;  3CKE A;  3OYR A;  4LFE A;  5A0K A;  3KRA B;  4LA5 A;  5CG6 A;  2FOR A;  2E8T A;  1JFG A;  5B02 A;  3TFP A;  3OAB A;  3ASX A;  4DEM F;  3WEG A;  3TS7 A;  3WCD A;  3ZMC A;  3QQV A;  5IVG A;  5B03 A;  5B01 A;  5AEL A;  2AZK A;  4LUU A;  1WY0 A;  3KBK A;  4KWD A;  5DHI A;  2Z4X A;  2F89 F;  3ZCD A;  1YYT A;  3WEI A;  2Z4Y A;  3KRP B;  5AFX A;  1WL0 A;  4LIX A;  5DW7 A;  3AQB B;  4F62 A;  4KUX A;  3OAC B;  4LPG F;  2E8V A;  4RXC A;  3P5R A;  3NPR A;  2ZEV A;  3TFV A;  4E9Z A;  5KSX F;  4RXE A;  4XQS F;  1FPS A;  3VJ9 A;  1WKZ A;  2PS8 A;  3KRO A;  4MC3 A;  3WEJ A;  4KQS A;  3WCG A;  5I1U A;  2J1O A;  4LA6 A;  1VG3 A;  2E90 A;  4MC8 A;  3P5P A;  3CP6 A;  1WL1 A;  4H5D F;  3KRC A;  1VG2 A;  5EAT A;  2F94 F;  5H9D A;  1HM4 A;  4E1E A;  3W7F A;  2PS5 A;  2Q9Y A;  3WJK A;  4EA2 A;  5ILJ A;  4H5E F;  3LDW A;  3PYA A;  4F6X A;  3KRF B;  4LTZ A;  4HD1 A;  1YQ7 A;  2E92 A;  4KK2 A;  4RXA A;  2ONH A;  4NKE A;  5ILK A;  4OMG A;  3KRA A;  2PS6 A;  4NUA A;  3CC9 A;  4KVD A;  2AET A;  4QXS F;  5AHU B;  5HN7 A;  3ACX A;  2Q58 A;  3N5J F;  3EFQ A;  1UBX A;  3VJC A;  5DGN F;  2DH4 A;  3WE9 A;  3WCC A;  3N0G A;  1RTR A;  2FTZ A;  5ERN A;  5E8H A;  4KVI A;  3WJN A;  5CG5 A;  2Z4V A;  4DXJ A;  2E93 A;  3SDQ A;  5HNA A;  3KRP A;  3WSB A;  1WL3 A;  3WCH A;  4GA3 A;  4MC0 A;  2AEL A;  3OAC A;  3PYB A;  2EWG A;  4KQU A;  5ILI A;  4JXN A;  3NPK A;  5IMI A;  1WL2 A;  3VJE A;  4LPH F;  3LZ9 A;  3M02 A;  1YYQ A;  4LLT A;  4LOB A;  3IPI A;  5IMP A;  3LJI A;  3N0F A;  1YJ4 A;  5IMN A;  4GAX A;  1VG7 A;  1JFA A;  4DWB A;  4LTV A;  3ICN A;  4LZC A;  5B0M A;  4NKF A;  3TC1 A;  1V4H A;  5ILZ A;  5ILH A;  2E8X A;  3ICM A;  3WCJ A;  3LG5 A;  4WK5 A;  3BNX A;  4LXW A;  1UBW A;  1N23 A;  2AZL A;  4LFG A;  3RYW A;  3KRF A;  3VJA A;  3LVS A;  5C05 A;  3P8L A;  1N22 A;  2ZCR A;  3LEE A;  3MZV A;  3Q2Q A;  5JA0 F;  3VJD A;  4P0W A;  5IL3 A;  5IM1 A;  4RYP A;  4DWG A;  2ONG A;  3ICK A;  3APZ A;  2F9K F;  4GP1 A;  4DZW A;  5DHK A;  3N5H F;  4GP2 A;  3N6K F;  5ILY A;  3G4D A;  4QPF A;  5IKA A;  1N1B A;  2RAH A;  4NG6 A;  5IK6 A;  2ZY1 A;  5IK0 A;  3AQC B;  3PH7 A;  2Z4Z A;  2AZJ A;  3M0G A;  3Q30 A;  3PKO A;  3WCF A;  1EZF A;  4LZ0 A;  3SDR A;  3EGT A;  3NRI A;  3VJ8 A;  5DIQ F;  3KB9 A;  4XQT F;  3LGZ B;  3SDU A;  4F6V A;  2ZCO A;  3B7L A;  3M9U A;  3LMD A;  2E8W A;  2ZCS A;  1PS1 A;  1YHK A;  1V4J A;  2J5C A;  3M00 A;  4JYX A;  5B0L A;  1KIZ A;  5A0J A;  2F8Z F;  3V66 A;  2O1O A;  4UMJ A;  3N3L F;  5DZ2 A;  5B0I A;  3IBA A;  3WCE A;  5A0I A;  2QIS A;  5DJP F;  1ZW5 A;  3LLW A;  4JVJ F;  5IN8 A;  1YHL A;  4P0V A;  5B00 A;  3QKC A;  5JV2 F;  2Q80 A;  1HM7 A;  3V1X A;  5AYP A;  3N1W F;  4KKM A;  3G4F A;  4ZQ8 A;  5ERM A;  4LZ3 A;  4KFA A;  5E8K A; 
#chains in the Genus database with same CATH topology
 3V1V A;  4DHD A;  1RQI A;  3ID0 A;  3NF2 A;  1YV5 A;  5IK9 A;  5B0J A;  5HN8 A;  3S9V A;  1YHM A;  4JZX A;  3AQ0 A;  3ACY A;  3ACW A;  3MAV A;  3EZ3 A;  5EAU A;  4P0X A;  2OPM A;  1YYU A;  3RBM A;  5EAS A;  3TFN A;  2VF6 A;  3WSA A;  4N1Z F;  3UCA A;  5ERO A;  2OGD A;  3DYH A;  1N21 A;  5IL8 A;  5DGS F;  1N20 A;  3P41 A;  1UBV A;  3SDV A;  3Q1O A;  2F92 F;  3WEF A;  4L2X F;  1WMW A;  1V4I A;  1HXC A;  1KIY A;  4KVW A;  4DI5 A;  1RQJ A;  3DYG A;  1DI1 A;  1N1Z A;  3WCL A;  3LK5 A;  2Z52 A;  4FJQ A;  5ER8 A;  4OGU A;  2ZEU A;  2Z7I A;  3ZMB A;  3RYE A;  4PVY F;  3S4J A;  3WCM A;  4NFI F;  2Z50 A;  3ZL6 A;  2P1C A;  4LFV F;  2E94 A;  1VG6 A;  5IKH A;  4EA1 A;  3WCA A;  3WC9 A;  2Q9Z A;  5JUZ F;  3LSN A;  2Z78 A;  4KVY A;  4EA0 A;  3WJO A;  3RMG A;  4JZB A;  2J1P A;  4FP4 A;  2OA6 A;  3N3D A;  3N45 F;  3SAE A;  1YYS A;  3WCB A;  5DJV F;  3OAB B;  4E9U A;  3PDE A;  2AEK A;  4LLS A;  3LGK A;  3ADZ A;  4NFJ F;  5JV0 F;  2F8C F;  2H8O A;  4K10 A;  2Z7H A;  1VG4 A;  2PS4 A;  4RNQ A;  5DGM F;  3M01 A;  4NFK F;  4OMH A;  3AE0 A;  1UBY A;  2I19 A;  3N1V F;  2F7M F;  1V4K A;  3SDT A;  2E95 A;  1DGP A;  2ZCQ A;  3N49 F;  4KQ5 A;  5B0K A;  3LOM A;  4KPD A;  3P8R A;  2E91 A;  3ICZ A;  3Q2Z A;  5JV1 F;  4H5C F;  4Q23 A;  3WCI A;  3KRO B;  4N9U A;  1N24 A;  2OPN A;  5E8L A;  2PS7 A;  3WEH A;  5ILD A;  3VJB A;  5DJR F;  3ZOU A;  4JXY A;  3KRC B;  4OKZ A;  4PVX F;  3WEK A;  1YYR A;  2Z4W A;  4KPJ A;  1HX9 A;  4RXD A;  1HXG A;  5HN9 A;  3BNY A;  3DYF A;  2E8U A;  4OKM A;  1HXA A;  3N46 F;  1V4E A;  2E4O A;  4XQR F;  3CKE A;  3OYR A;  4LFE A;  5A0K A;  3KRA B;  4LA5 A;  5CG6 A;  2FOR A;  2E8T A;  1JFG A;  5B02 A;  3TFP A;  3OAB A;  3ASX A;  4DEM F;  3WEG A;  3TS7 A;  3WCD A;  3ZMC A;  3QQV A;  5IVG A;  5B03 A;  5B01 A;  5AEL A;  2AZK A;  4LUU A;  1WY0 A;  3KBK A;  4KWD A;  5DHI A;  2Z4X A;  2F89 F;  3ZCD A;  1YYT A;  3WEI A;  2Z4Y A;  3KRP B;  5AFX A;  1WL0 A;  4LIX A;  5DW7 A;  3AQB B;  4F62 A;  4KUX A;  3OAC B;  4LPG F;  2E8V A;  4RXC A;  3P5R A;  3NPR A;  2ZEV A;  3TFV A;  4E9Z A;  5KSX F;  4RXE A;  4XQS F;  1FPS A;  3VJ9 A;  1WKZ A;  2PS8 A;  3KRO A;  4MC3 A;  3WEJ A;  4KQS A;  3WCG A;  5I1U A;  2J1O A;  4LA6 A;  1VG3 A;  2E90 A;  4MC8 A;  3P5P A;  3CP6 A;  1WL1 A;  4H5D F;  3KRC A;  1VG2 A;  5EAT A;  2F94 F;  5H9D A;  1HM4 A;  4E1E A;  3W7F A;  2PS5 A;  2Q9Y A;  3WJK A;  4EA2 A;  5ILJ A;  4H5E F;  3LDW A;  3PYA A;  4F6X A;  3KRF B;  4LTZ A;  4HD1 A;  1YQ7 A;  2E92 A;  4KK2 A;  4RXA A;  2ONH A;  4NKE A;  5ILK A;  4OMG A;  3KRA A;  2PS6 A;  4NUA A;  3CC9 A;  4KVD A;  2AET A;  4QXS F;  5AHU B;  5HN7 A;  3ACX A;  2Q58 A;  3N5J F;  3EFQ A;  1UBX A;  3VJC A;  5DGN F;  2DH4 A;  3WE9 A;  3WCC A;  3N0G A;  1RTR A;  2FTZ A;  5ERN A;  5E8H A;  4KVI A;  3WJN A;  5CG5 A;  2Z4V A;  4DXJ A;  2E93 A;  3SDQ A;  5HNA A;  3KRP A;  3WSB A;  1WL3 A;  3WCH A;  4GA3 A;  4MC0 A;  2AEL A;  3OAC A;  3PYB A;  2EWG A;  4KQU A;  5ILI A;  4JXN A;  3NPK A;  5IMI A;  1WL2 A;  3VJE A;  4LPH F;  3LZ9 A;  3M02 A;  1YYQ A;  4LLT A;  4LOB A;  3IPI A;  5IMP A;  3LJI A;  3N0F A;  1YJ4 A;  5IMN A;  4GAX A;  1VG7 A;  1JFA A;  4DWB A;  4LTV A;  3ICN A;  4LZC A;  5B0M A;  4NKF A;  3TC1 A;  1V4H A;  5ILZ A;  5ILH A;  2E8X A;  3ICM A;  3WCJ A;  3LG5 A;  4WK5 A;  3BNX A;  4LXW A;  1UBW A;  1N23 A;  2AZL A;  4LFG A;  3RYW A;  3KRF A;  3VJA A;  3LVS A;  5C05 A;  3P8L A;  1N22 A;  2ZCR A;  3LEE A;  3MZV A;  3Q2Q A;  5JA0 F;  3VJD A;  4P0W A;  5IL3 A;  5IM1 A;  4RYP A;  4DWG A;  2ONG A;  3ICK A;  3APZ A;  2F9K F;  4GP1 A;  4DZW A;  5DHK A;  3N5H F;  4GP2 A;  3N6K F;  5ILY A;  3G4D A;  4QPF A;  5IKA A;  1N1B A;  2RAH A;  4NG6 A;  5IK6 A;  2ZY1 A;  5IK0 A;  3AQC B;  3PH7 A;  2Z4Z A;  2AZJ A;  3M0G A;  3Q30 A;  3PKO A;  3WCF A;  1EZF A;  4LZ0 A;  3SDR A;  3EGT A;  3NRI A;  3VJ8 A;  5DIQ F;  3KB9 A;  4XQT F;  3LGZ B;  3SDU A;  4F6V A;  2ZCO A;  3B7L A;  3M9U A;  3LMD A;  2E8W A;  2ZCS A;  1PS1 A;  1YHK A;  1V4J A;  2J5C A;  3M00 A;  4JYX A;  5B0L A;  1KIZ A;  5A0J A;  2F8Z F;  3V66 A;  2O1O A;  4UMJ A;  3N3L F;  5DZ2 A;  5B0I A;  3IBA A;  3WCE A;  5A0I A;  2QIS A;  5DJP F;  1ZW5 A;  3LLW A;  4JVJ F;  5IN8 A;  1YHL A;  4P0V A;  5B00 A;  3QKC A;  5JV2 F;  2Q80 A;  1HM7 A;  3V1X A;  5AYP A;  3N1W F;  4KKM A;  3G4F A;  4ZQ8 A;  5ERM A;  4LZ3 A;  4KFA A;  5E8K A; 
#chains in the Genus database with same CATH homology
 3V1V A;  4DHD A;  1RQI A;  3ID0 A;  3NF2 A;  1YV5 A;  5IK9 A;  5B0J A;  5HN8 A;  3S9V A;  1YHM A;  4JZX A;  3AQ0 A;  3ACY A;  3ACW A;  3MAV A;  3EZ3 A;  5EAU A;  4P0X A;  2OPM A;  1YYU A;  3RBM A;  5EAS A;  3TFN A;  2VF6 A;  3WSA A;  4N1Z F;  3UCA A;  5ERO A;  2OGD A;  3DYH A;  1N21 A;  5IL8 A;  5DGS F;  1N20 A;  3P41 A;  1UBV A;  3SDV A;  3Q1O A;  2F92 F;  3WEF A;  4L2X F;  1WMW A;  1V4I A;  1HXC A;  1KIY A;  4KVW A;  4DI5 A;  1RQJ A;  3DYG A;  1DI1 A;  1N1Z A;  3WCL A;  3LK5 A;  2Z52 A;  4FJQ A;  5ER8 A;  4OGU A;  2ZEU A;  2Z7I A;  3ZMB A;  3RYE A;  4PVY F;  3S4J A;  3WCM A;  4NFI F;  2Z50 A;  3ZL6 A;  2P1C A;  4LFV F;  2E94 A;  1VG6 A;  5IKH A;  4EA1 A;  3WCA A;  3WC9 A;  2Q9Z A;  5JUZ F;  3LSN A;  2Z78 A;  4KVY A;  4EA0 A;  3WJO A;  3RMG A;  4JZB A;  2J1P A;  4FP4 A;  2OA6 A;  3N3D A;  3N45 F;  3SAE A;  1YYS A;  3WCB A;  5DJV F;  3OAB B;  4E9U A;  3PDE A;  2AEK A;  4LLS A;  3LGK A;  3ADZ A;  4NFJ F;  5JV0 F;  2F8C F;  2H8O A;  4K10 A;  2Z7H A;  1VG4 A;  2PS4 A;  4RNQ A;  5DGM F;  3M01 A;  4NFK F;  4OMH A;  3AE0 A;  1UBY A;  2I19 A;  3N1V F;  2F7M F;  1V4K A;  3SDT A;  2E95 A;  1DGP A;  2ZCQ A;  3N49 F;  4KQ5 A;  5B0K A;  3LOM A;  4KPD A;  3P8R A;  2E91 A;  3ICZ A;  3Q2Z A;  5JV1 F;  4H5C F;  4Q23 A;  3WCI A;  3KRO B;  4N9U A;  1N24 A;  2OPN A;  5E8L A;  2PS7 A;  3WEH A;  5ILD A;  3VJB A;  5DJR F;  3ZOU A;  4JXY A;  3KRC B;  4OKZ A;  4PVX F;  3WEK A;  1YYR A;  2Z4W A;  4KPJ A;  1HX9 A;  4RXD A;  1HXG A;  5HN9 A;  3BNY A;  3DYF A;  2E8U A;  4OKM A;  1HXA A;  3N46 F;  1V4E A;  2E4O A;  4XQR F;  3CKE A;  3OYR A;  4LFE A;  5A0K A;  3KRA B;  4LA5 A;  5CG6 A;  2FOR A;  2E8T A;  1JFG A;  5B02 A;  3TFP A;  3OAB A;  3ASX A;  4DEM F;  3WEG A;  3TS7 A;  3WCD A;  3ZMC A;  3QQV A;  5IVG A;  5B03 A;  5B01 A;  5AEL A;  2AZK A;  4LUU A;  1WY0 A;  3KBK A;  4KWD A;  5DHI A;  2Z4X A;  2F89 F;  3ZCD A;  1YYT A;  3WEI A;  2Z4Y A;  3KRP B;  5AFX A;  1WL0 A;  4LIX A;  5DW7 A;  3AQB B;  4F62 A;  4KUX A;  3OAC B;  4LPG F;  2E8V A;  4RXC A;  3P5R A;  3NPR A;  2ZEV A;  3TFV A;  4E9Z A;  5KSX F;  4RXE A;  4XQS F;  1FPS A;  3VJ9 A;  1WKZ A;  2PS8 A;  3KRO A;  4MC3 A;  3WEJ A;  4KQS A;  3WCG A;  5I1U A;  2J1O A;  4LA6 A;  1VG3 A;  2E90 A;  4MC8 A;  3P5P A;  3CP6 A;  1WL1 A;  4H5D F;  3KRC A;  1VG2 A;  5EAT A;  2F94 F;  5H9D A;  1HM4 A;  4E1E A;  3W7F A;  2PS5 A;  2Q9Y A;  3WJK A;  4EA2 A;  5ILJ A;  4H5E F;  3LDW A;  3PYA A;  4F6X A;  3KRF B;  4LTZ A;  4HD1 A;  1YQ7 A;  2E92 A;  4KK2 A;  4RXA A;  2ONH A;  4NKE A;  5ILK A;  4OMG A;  3KRA A;  2PS6 A;  4NUA A;  3CC9 A;  4KVD A;  2AET A;  4QXS F;  5AHU B;  5HN7 A;  3ACX A;  2Q58 A;  3N5J F;  3EFQ A;  1UBX A;  3VJC A;  5DGN F;  2DH4 A;  3WE9 A;  3WCC A;  3N0G A;  1RTR A;  2FTZ A;  5ERN A;  5E8H A;  4KVI A;  3WJN A;  5CG5 A;  2Z4V A;  4DXJ A;  2E93 A;  3SDQ A;  5HNA A;  3KRP A;  3WSB A;  1WL3 A;  3WCH A;  4GA3 A;  4MC0 A;  2AEL A;  3OAC A;  3PYB A;  2EWG A;  4KQU A;  5ILI A;  4JXN A;  3NPK A;  5IMI A;  1WL2 A;  3VJE A;  4LPH F;  3LZ9 A;  3M02 A;  1YYQ A;  4LLT A;  4LOB A;  3IPI A;  5IMP A;  3LJI A;  3N0F A;  1YJ4 A;  5IMN A;  4GAX A;  1VG7 A;  1JFA A;  4DWB A;  4LTV A;  3ICN A;  4LZC A;  5B0M A;  4NKF A;  3TC1 A;  1V4H A;  5ILZ A;  5ILH A;  2E8X A;  3ICM A;  3WCJ A;  3LG5 A;  4WK5 A;  3BNX A;  4LXW A;  1UBW A;  1N23 A;  2AZL A;  4LFG A;  3RYW A;  3KRF A;  3VJA A;  3LVS A;  5C05 A;  3P8L A;  1N22 A;  2ZCR A;  3LEE A;  3MZV A;  3Q2Q A;  5JA0 F;  3VJD A;  4P0W A;  5IL3 A;  5IM1 A;  4RYP A;  4DWG A;  2ONG A;  3ICK A;  3APZ A;  2F9K F;  4GP1 A;  4DZW A;  5DHK A;  3N5H F;  4GP2 A;  3N6K F;  5ILY A;  3G4D A;  4QPF A;  5IKA A;  1N1B A;  2RAH A;  4NG6 A;  5IK6 A;  2ZY1 A;  5IK0 A;  3AQC B;  3PH7 A;  2Z4Z A;  2AZJ A;  3M0G A;  3Q30 A;  3PKO A;  3WCF A;  1EZF A;  4LZ0 A;  3SDR A;  3EGT A;  3NRI A;  3VJ8 A;  5DIQ F;  3KB9 A;  4XQT F;  3LGZ B;  3SDU A;  4F6V A;  2ZCO A;  3B7L A;  3M9U A;  3LMD A;  2E8W A;  2ZCS A;  1PS1 A;  1YHK A;  1V4J A;  2J5C A;  3M00 A;  4JYX A;  5B0L A;  1KIZ A;  5A0J A;  2F8Z F;  3V66 A;  2O1O A;  4UMJ A;  3N3L F;  5DZ2 A;  5B0I A;  3IBA A;  3WCE A;  5A0I A;  2QIS A;  5DJP F;  1ZW5 A;  3LLW A;  4JVJ F;  5IN8 A;  1YHL A;  4P0V A;  5B00 A;  3QKC A;  5JV2 F;  2Q80 A;  1HM7 A;  3V1X A;  5AYP A;  3N1W F;  4KKM A;  3G4F A;  4ZQ8 A;  5ERM A;  4LZ3 A;  4KFA A;  5E8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...