3KRPB

Mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium and gpp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
259
structure length
256
Chain Sequence
MQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLTDGSRPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALEELGGKNAELMSSLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyl diphosphate synthase large subunit
publication title Structure of a heterotetrameric geranyl pyrophosphate synthase from mint (Mentha piperita) reveals intersubunit regulation
pubmed doi rcsb
source organism Mentha x piperita
total genus 87
structure length 256
sequence length 259
chains with identical sequence C
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2009-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3krpB00
4OKZA 4KVYA 4XQRF 3N0GA 4LA5A 2QISA 3OACA 3LVSA 3N46F 3V66A 4E1EA 2J5CA 1HXGA 4KQSA 3W7FA 3PDEA 4F62A 1WL1A 5IKHA 5IM1A 4LOBA 3NRIA 5B0LA 5IK6A 3SDUA 3Q2ZA 1VG2A 3S9VA 5JV2F 4EA1A 5EROA 3AQ0A 1N23A 1YHLA 2Z50A 3N5HF 3OYRA 4L2XF 5AYPA 3WJKA 4LZCA 5IK0A 4LFVF 5IL3A 3WCIA 3PYBA 5JA0F 4MC8A 5CG5A 4NKEA 3WCLA 1ZW5A 3ICKA 3RYWA 4F6VA 5DGSF 4NFKF 5JV1F 1PS1A 5B01A 2F92F 1FPSA 3AQBB 2E92A 1EZFA 4KVWA 4ZQ8A 4F6XA 2E90A 4LLSA 1YYUA 2F8ZF 3CKEA 2Z7HA 5IVGA 1HX9A 3Q1OA 3WJOA 1YHKA 5AHUB 2OA6A 4DHDA 4LZ0A 3WEFA 3WCJA 3AE0A 4LPGF 4FP4A 1KIYA 3WEJA 4LXWA 4OMHA 5ILDA 4DZWA 5ER8A 3N5JF 4DI5A 4JVJF 4PVYF 3WCBA 4KQUA 2ZCOA 5B0IA 2F89F 2F8CF 3WEHA 3EZ3A 3WJNA 3VJEA 4H5EF 5AELA 3B7LA 4NKFA 4QPFA 3DYHA 4RNQA 2OGDA 2Z4ZA 4GP1A 3VJDA 5B0KA 3M9UA 4RXEA 1DGPA 5ILHA 4NG6A 2ZCSA 4WK5A 2E8TA 5I1UA 2PS6A 3BNXA 5E8LA 5C05A 5IMIA 4KK2A 4LFGA 1JFGA 4KUXA 2Q9YA 4N9UA 3WE9A 3WCCA 4H5CF 5ILKA 1WL2A 1N21A 4DWBA 3M00A 3G4FA 1RQIA 4P0WA 3TC1A 3WSBA 2Z4YA 1WMWA 3VJBA 3M02A 1HXCA 1HM7A 3M0GA 3S4JA 2Q80A 3OACB 5IL8A 5CG6A 5DW7A 2PS8A 5EATA 3ICMA 2F7MF 3WCMA 3ZL6A 1VG6A 2AZLA 3CP6A 3M01A 4NFJF 3N1WF 3LDWA 3LSNA 5IMPA 4P0VA 3ADZA 2ONGA 3KB9A 4K10A 4MC3A 3SDTA 4LA6A 3NPKA 5ILJA 4GAXA 2AZJA 5HN8A 4MC0A 4DWGA 3Q30A 5KSXF 2ZEUA 4RXCA 1UBWA 1WL3A 4RYPA 5IKAA 3SAEA 5A0IA 3TFNA 4E9ZA 5ERNA 5ILYA 1HM4A 5B03A 3N1VF 3LZ9A 3N6KF 4GA3A 3ICNA 5DGNF 1V4IA 3IPIA 3WSAA 5ILIA 2E91A 3WCGA 4JXNA 3KRAB 3NF2A 5DJVF 3RBMA 3SDQA 3KRAA 4E9UA 1WL0A 3ID0A 5AFXA 2EWGA 4P0XA 2VF6A 2Z52A 2DH4A 1V4JA 3KRPA 2PS4A 2Z4XA 5DHKA 4N1ZF 3P5PA 3WCFA 3N45F 5JV0F 3ACWA 3WCEA 2AZKA 3VJ9A 1UBXA 4KVDA 4Q23A 5IMNA 3TS7A 2Z78A 1WKZA 3LMDA 4LIXA 3V1XA 1KIZA 2H8OA 4UMJA 5DZ2A 3Q2QA 3N3LF 4LZ3A 1N22A 3VJAA 1V4KA 4LLTA 3KROB 3LEEA 3P41A 4H5DF 3KROA 3VJ8A 4LPHF 3WEGA 4DXJA 3ZCDA 1YHMA 3KBKA 1N24A 4PVXF 1WY0A 2E93A 4QXSF 1JFAA 2I19A 3LK5A 4LFEA 3CC9A 5DGMF 3LJIA 3MZVA 3WEIA 3V1VA 3APZA 1N1ZA 3BNYA 1UBVA 3WC9A 4KPDA 1UBYA 5DJPF 3ZOUA 2F9KF 2PS5A 1VG7A 4OKMA 3LGZB 5HNAA 2Q9ZA 5EAUA 3DYGA 3N3DA 3P8LA 5JUZF 1YYQA 1VG4A 4KQ5A 1RTRA 3LOMA 3ACYA 5IK9A 3PYAA 3PH7A 5B0JA 1YYTA 3SDRA 2ZY1A 1V4EA 2E8VA 5B00A 2E4OA 3N0FA 5IN8A 1YYSA 2Z4VA 4EA2A 4EA0A 3N49F 2J1OA 2E94A 4KKMA 4KVIA 2ZCQA 5DIQF 4FJQA 2AEKA 2FTZA 5E8KA 3ICZA 2Q58A 4XQSF 3RMGA 4KFAA 1YQ7A 3QQVA 3LGKA 4KWDA 3RYEA 4XQTF 3TFPA 2E8WA 2P1CA 2AELA 4JXYA 1VG3A 5B02A 5H9DA 3KRPB 4RXDA 2E95A 2E8XA 2RAHA 4HD1A 5E8HA 3EGTA 3LG5A 3TFVA 3UCAA 2AETA 3EFQA 4JYXA 5ERMA 2Z7IA 4LTZA 3SDVA 5DHIA 5EASA 2ONHA 5B0MA 1DI1A 3ACXA 4KPJA 3WCHA 3KRFB 3IBAA 5DJRF 4JZXA 3KRFA 2E8UA 1YV5A 5A0KA 3WCAA 2ZEVA 3OABB 3PKOA 3WEKA 2ZCRA 2OPMA 3P5RA 3OABA 4NFIF 1HXAA 3QKCA 4DEMF 1YYRA 3DYFA 3G4DA 3KRCB 2OPNA 3KRCA 1N1BA 4NUAA 1YJ4A 3ASXA 3ZMCA 1V4HA 4GP2A 5A0JA 5ILZA 3ZMBA 2O1OA 2F94F 2FORA 2J1PA 2Z4WA 5HN9A 4LUUA 3WCDA 4JZBA 1RQJA 4OGUA 3P8RA 3NPRA 3VJCA 4LTVA 4OMGA 1N20A 3MAVA 4RXAA 3AQCB 5HN7A 3LLWA 2PS7A
chains in the Genus database with same CATH superfamily
4OKZA 4KVYA 4XQRF 3N0GA 4LA5A 2QISA 3OACA 3LVSA 3N46F 3V66A 4E1EA 2J5CA 1HXGA 4KQSA 3W7FA 3PDEA 4F62A 1WL1A 5IKHA 5IM1A 4LOBA 3NRIA 5B0LA 5IK6A 3SDUA 3Q2ZA 1VG2A 3S9VA 5JV2F 4EA1A 5EROA 3AQ0A 1N23A 1YHLA 2Z50A 3N5HF 3OYRA 4L2XF 5AYPA 3WJKA 4LZCA 5IK0A 4LFVF 5IL3A 3WCIA 3PYBA 5JA0F 4MC8A 5CG5A 4NKEA 3WCLA 1ZW5A 3ICKA 3RYWA 4F6VA 5DGSF 4NFKF 5JV1F 1PS1A 5B01A 2F92F 1FPSA 3AQBB 2E92A 1EZFA 4KVWA 4ZQ8A 4F6XA 2E90A 4LLSA 1YYUA 2F8ZF 3CKEA 2Z7HA 5IVGA 1HX9A 3Q1OA 3WJOA 1YHKA 5AHUB 2OA6A 4DHDA 4LZ0A 3WEFA 3WCJA 3AE0A 4LPGF 4FP4A 1KIYA 3WEJA 4LXWA 4OMHA 5ILDA 4DZWA 5ER8A 3N5JF 4DI5A 4JVJF 4PVYF 3WCBA 4KQUA 2ZCOA 5B0IA 2F89F 2F8CF 3WEHA 3EZ3A 3WJNA 3VJEA 4H5EF 5AELA 3B7LA 4NKFA 4QPFA 3DYHA 4RNQA 2OGDA 2Z4ZA 4GP1A 3VJDA 5B0KA 3M9UA 4RXEA 1DGPA 5ILHA 4NG6A 2ZCSA 4WK5A 2E8TA 5I1UA 2PS6A 3BNXA 5E8LA 5C05A 5IMIA 4KK2A 4LFGA 1JFGA 4KUXA 2Q9YA 4N9UA 3WE9A 3WCCA 4H5CF 5ILKA 1WL2A 1N21A 4DWBA 3M00A 3G4FA 1RQIA 4P0WA 3TC1A 3WSBA 2Z4YA 1WMWA 3VJBA 3M02A 1HXCA 1HM7A 3M0GA 3S4JA 2Q80A 3OACB 5IL8A 5CG6A 5DW7A 2PS8A 5EATA 3ICMA 2F7MF 3WCMA 3ZL6A 1VG6A 2AZLA 3CP6A 3M01A 4NFJF 3N1WF 3LDWA 3LSNA 5IMPA 4P0VA 3ADZA 2ONGA 3KB9A 4K10A 4MC3A 3SDTA 4LA6A 3NPKA 5ILJA 4GAXA 2AZJA 5HN8A 4MC0A 4DWGA 3Q30A 5KSXF 2ZEUA 4RXCA 1UBWA 1WL3A 4RYPA 5IKAA 3SAEA 5A0IA 3TFNA 4E9ZA 5ERNA 5ILYA 1HM4A 5B03A 3N1VF 3LZ9A 3N6KF 4GA3A 3ICNA 5DGNF 1V4IA 3IPIA 3WSAA 5ILIA 2E91A 3WCGA 4JXNA 3KRAB 3NF2A 5DJVF 3RBMA 3SDQA 3KRAA 4E9UA 1WL0A 3ID0A 5AFXA 2EWGA 4P0XA 2VF6A 2Z52A 2DH4A 1V4JA 3KRPA 2PS4A 2Z4XA 5DHKA 4N1ZF 3P5PA 3WCFA 3N45F 5JV0F 3ACWA 3WCEA 2AZKA 3VJ9A 1UBXA 4KVDA 4Q23A 5IMNA 3TS7A 2Z78A 1WKZA 3LMDA 4LIXA 3V1XA 1KIZA 2H8OA 4UMJA 5DZ2A 3Q2QA 3N3LF 4LZ3A 1N22A 3VJAA 1V4KA 4LLTA 3KROB 3LEEA 3P41A 4H5DF 3KROA 3VJ8A 4LPHF 3WEGA 4DXJA 3ZCDA 1YHMA 3KBKA 1N24A 4PVXF 1WY0A 2E93A 4QXSF 1JFAA 2I19A 3LK5A 4LFEA 3CC9A 5DGMF 3LJIA 3MZVA 3WEIA 3V1VA 3APZA 1N1ZA 3BNYA 1UBVA 3WC9A 4KPDA 1UBYA 5DJPF 3ZOUA 2F9KF 2PS5A 1VG7A 4OKMA 3LGZB 5HNAA 2Q9ZA 5EAUA 3DYGA 3N3DA 3P8LA 5JUZF 1YYQA 1VG4A 4KQ5A 1RTRA 3LOMA 3ACYA 5IK9A 3PYAA 3PH7A 5B0JA 1YYTA 3SDRA 2ZY1A 1V4EA 2E8VA 5B00A 2E4OA 3N0FA 5IN8A 1YYSA 2Z4VA 4EA2A 4EA0A 3N49F 2J1OA 2E94A 4KKMA 4KVIA 2ZCQA 5DIQF 4FJQA 2AEKA 2FTZA 5E8KA 3ICZA 2Q58A 4XQSF 3RMGA 4KFAA 1YQ7A 3QQVA 3LGKA 4KWDA 3RYEA 4XQTF 3TFPA 2E8WA 2P1CA 2AELA 4JXYA 1VG3A 5B02A 5H9DA 3KRPB 4RXDA 2E95A 2E8XA 2RAHA 4HD1A 5E8HA 3EGTA 3LG5A 3TFVA 3UCAA 2AETA 3EFQA 4JYXA 5ERMA 2Z7IA 4LTZA 3SDVA 5DHIA 5EASA 2ONHA 5B0MA 1DI1A 3ACXA 4KPJA 3WCHA 3KRFB 3IBAA 5DJRF 4JZXA 3KRFA 2E8UA 1YV5A 5A0KA 3WCAA 2ZEVA 3OABB 3PKOA 3WEKA 2ZCRA 2OPMA 3P5RA 3OABA 4NFIF 1HXAA 3QKCA 4DEMF 1YYRA 3DYFA 3G4DA 3KRCB 2OPNA 3KRCA 1N1BA 4NUAA 1YJ4A 3ASXA 3ZMCA 1V4HA 4GP2A 5A0JA 5ILZA 3ZMBA 2O1OA 2F94F 2FORA 2J1PA 2Z4WA 5HN9A 4LUUA 3WCDA 4JZBA 1RQJA 4OGUA 3P8RA 3NPRA 3VJCA 4LTVA 4OMGA 1N20A 3MAVA 4RXAA 3AQCB 5HN7A 3LLWA 2PS7A
chains in the Genus database with same CATH topology
4OKZA 4KVYA 4XQRF 3N0GA 4LA5A 2QISA 3OACA 3LVSA 3N46F 3V66A 4E1EA 2J5CA 1HXGA 4KQSA 3W7FA 3PDEA 4F62A 1WL1A 5IKHA 5IM1A 4LOBA 3NRIA 5B0LA 5IK6A 3SDUA 3Q2ZA 1VG2A 3S9VA 5JV2F 4EA1A 5EROA 3AQ0A 1N23A 1YHLA 2Z50A 3N5HF 3OYRA 4L2XF 5AYPA 3WJKA 4LZCA 5IK0A 4LFVF 5IL3A 3WCIA 3PYBA 5JA0F 4MC8A 5CG5A 4NKEA 3WCLA 1ZW5A 3ICKA 3RYWA 4F6VA 5DGSF 4NFKF 5JV1F 1PS1A 5B01A 2F92F 1FPSA 3AQBB 2E92A 1EZFA 4KVWA 4ZQ8A 4F6XA 2E90A 4LLSA 1YYUA 2F8ZF 3CKEA 2Z7HA 5IVGA 1HX9A 3Q1OA 3WJOA 1YHKA 5AHUB 2OA6A 4DHDA 4LZ0A 3WEFA 3WCJA 3AE0A 4LPGF 4FP4A 1KIYA 3WEJA 4LXWA 4OMHA 5ILDA 4DZWA 5ER8A 3N5JF 4DI5A 4JVJF 4PVYF 3WCBA 4KQUA 2ZCOA 5B0IA 2F89F 2F8CF 3WEHA 3EZ3A 3WJNA 3VJEA 4H5EF 5AELA 3B7LA 4NKFA 4QPFA 3DYHA 4RNQA 2OGDA 2Z4ZA 4GP1A 3VJDA 5B0KA 3M9UA 4RXEA 1DGPA 5ILHA 4NG6A 2ZCSA 4WK5A 2E8TA 5I1UA 2PS6A 3BNXA 5E8LA 5C05A 5IMIA 4KK2A 4LFGA 1JFGA 4KUXA 2Q9YA 4N9UA 3WE9A 3WCCA 4H5CF 5ILKA 1WL2A 1N21A 4DWBA 3M00A 3G4FA 1RQIA 4P0WA 3TC1A 3WSBA 2Z4YA 1WMWA 3VJBA 3M02A 1HXCA 1HM7A 3M0GA 3S4JA 2Q80A 3OACB 5IL8A 5CG6A 5DW7A 2PS8A 5EATA 3ICMA 2F7MF 3WCMA 3ZL6A 1VG6A 2AZLA 3CP6A 3M01A 4NFJF 3N1WF 3LDWA 3LSNA 5IMPA 4P0VA 3ADZA 2ONGA 3KB9A 4K10A 4MC3A 3SDTA 4LA6A 3NPKA 5ILJA 4GAXA 2AZJA 5HN8A 4MC0A 4DWGA 3Q30A 5KSXF 2ZEUA 4RXCA 1UBWA 1WL3A 4RYPA 5IKAA 3SAEA 5A0IA 3TFNA 4E9ZA 5ERNA 5ILYA 1HM4A 5B03A 3N1VF 3LZ9A 3N6KF 4GA3A 3ICNA 5DGNF 1V4IA 3IPIA 3WSAA 5ILIA 2E91A 3WCGA 4JXNA 3KRAB 3NF2A 5DJVF 3RBMA 3SDQA 3KRAA 4E9UA 1WL0A 3ID0A 5AFXA 2EWGA 4P0XA 2VF6A 2Z52A 2DH4A 1V4JA 3KRPA 2PS4A 2Z4XA 5DHKA 4N1ZF 3P5PA 3WCFA 3N45F 5JV0F 3ACWA 3WCEA 2AZKA 3VJ9A 1UBXA 4KVDA 4Q23A 5IMNA 3TS7A 2Z78A 1WKZA 3LMDA 4LIXA 3V1XA 1KIZA 2H8OA 4UMJA 5DZ2A 3Q2QA 3N3LF 4LZ3A 1N22A 3VJAA 1V4KA 4LLTA 3KROB 3LEEA 3P41A 4H5DF 3KROA 3VJ8A 4LPHF 3WEGA 4DXJA 3ZCDA 1YHMA 3KBKA 1N24A 4PVXF 1WY0A 2E93A 4QXSF 1JFAA 2I19A 3LK5A 4LFEA 3CC9A 5DGMF 3LJIA 3MZVA 3WEIA 3V1VA 3APZA 1N1ZA 3BNYA 1UBVA 3WC9A 4KPDA 1UBYA 5DJPF 3ZOUA 2F9KF 2PS5A 1VG7A 4OKMA 3LGZB 5HNAA 2Q9ZA 5EAUA 3DYGA 3N3DA 3P8LA 5JUZF 1YYQA 1VG4A 4KQ5A 1RTRA 3LOMA 3ACYA 5IK9A 3PYAA 3PH7A 5B0JA 1YYTA 3SDRA 2ZY1A 1V4EA 2E8VA 5B00A 2E4OA 3N0FA 5IN8A 1YYSA 2Z4VA 4EA2A 4EA0A 3N49F 2J1OA 2E94A 4KKMA 4KVIA 2ZCQA 5DIQF 4FJQA 2AEKA 2FTZA 5E8KA 3ICZA 2Q58A 4XQSF 3RMGA 4KFAA 1YQ7A 3QQVA 3LGKA 4KWDA 3RYEA 4XQTF 3TFPA 2E8WA 2P1CA 2AELA 4JXYA 1VG3A 5B02A 5H9DA 3KRPB 4RXDA 2E95A 2E8XA 2RAHA 4HD1A 5E8HA 3EGTA 3LG5A 3TFVA 3UCAA 2AETA 3EFQA 4JYXA 5ERMA 2Z7IA 4LTZA 3SDVA 5DHIA 5EASA 2ONHA 5B0MA 1DI1A 3ACXA 4KPJA 3WCHA 3KRFB 3IBAA 5DJRF 4JZXA 3KRFA 2E8UA 1YV5A 5A0KA 3WCAA 2ZEVA 3OABB 3PKOA 3WEKA 2ZCRA 2OPMA 3P5RA 3OABA 4NFIF 1HXAA 3QKCA 4DEMF 1YYRA 3DYFA 3G4DA 3KRCB 2OPNA 3KRCA 1N1BA 4NUAA 1YJ4A 3ASXA 3ZMCA 1V4HA 4GP2A 5A0JA 5ILZA 3ZMBA 2O1OA 2F94F 2FORA 2J1PA 2Z4WA 5HN9A 4LUUA 3WCDA 4JZBA 1RQJA 4OGUA 3P8RA 3NPRA 3VJCA 4LTVA 4OMGA 1N20A 3MAVA 4RXAA 3AQCB 5HN7A 3LLWA 2PS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OKZ A;  4KVY A;  4XQR F;  3N0G A;  4LA5 A;  2QIS A;  3OAC A;  3LVS A;  3N46 F;  3V66 A;  4E1E A;  2J5C A;  1HXG A;  4KQS A;  3W7F A;  3PDE A;  4F62 A;  1WL1 A;  5IKH A;  5IM1 A;  4LOB A;  3NRI A;  5B0L A;  5IK6 A;  3SDU A;  3Q2Z A;  1VG2 A;  3S9V A;  5JV2 F;  4EA1 A;  5ERO A;  3AQ0 A;  1N23 A;  1YHL A;  2Z50 A;  3N5H F;  3OYR A;  4L2X F;  5AYP A;  3WJK A;  4LZC A;  5IK0 A;  4LFV F;  5IL3 A;  3WCI A;  3PYB A;  5JA0 F;  4MC8 A;  5CG5 A;  4NKE A;  3WCL A;  1ZW5 A;  3ICK A;  3RYW A;  4F6V A;  5DGS F;  4NFK F;  5JV1 F;  1PS1 A;  5B01 A;  2F92 F;  1FPS A;  3AQB B;  2E92 A;  1EZF A;  4KVW A;  4ZQ8 A;  4F6X A;  2E90 A;  4LLS A;  1YYU A;  2F8Z F;  3CKE A;  2Z7H A;  5IVG A;  1HX9 A;  3Q1O A;  3WJO A;  1YHK A;  5AHU B;  2OA6 A;  4DHD A;  4LZ0 A;  3WEF A;  3WCJ A;  3AE0 A;  4LPG F;  4FP4 A;  1KIY A;  3WEJ A;  4LXW A;  4OMH A;  5ILD A;  4DZW A;  5ER8 A;  3N5J F;  4DI5 A;  4JVJ F;  4PVY F;  3WCB A;  4KQU A;  2ZCO A;  5B0I A;  2F89 F;  2F8C F;  3WEH A;  3EZ3 A;  3WJN A;  3VJE A;  4H5E F;  5AEL A;  3B7L A;  4NKF A;  4QPF A;  3DYH A;  4RNQ A;  2OGD A;  2Z4Z A;  4GP1 A;  3VJD A;  5B0K A;  3M9U A;  4RXE A;  1DGP A;  5ILH A;  4NG6 A;  2ZCS A;  4WK5 A;  2E8T A;  5I1U A;  2PS6 A;  3BNX A;  5E8L A;  5C05 A;  5IMI A;  4KK2 A;  4LFG A;  1JFG A;  4KUX A;  2Q9Y A;  4N9U A;  3WE9 A;  3WCC A;  4H5C F;  5ILK A;  1WL2 A;  1N21 A;  4DWB A;  3M00 A;  3G4F A;  1RQI A;  4P0W A;  3TC1 A;  3WSB A;  2Z4Y A;  1WMW A;  3VJB A;  3M02 A;  1HXC A;  1HM7 A;  3M0G A;  3S4J A;  2Q80 A;  3OAC B;  5IL8 A;  5CG6 A;  5DW7 A;  2PS8 A;  5EAT A;  3ICM A;  2F7M F;  3WCM A;  3ZL6 A;  1VG6 A;  2AZL A;  3CP6 A;  3M01 A;  4NFJ F;  3N1W F;  3LDW A;  3LSN A;  5IMP A;  4P0V A;  3ADZ A;  2ONG A;  3KB9 A;  4K10 A;  4MC3 A;  3SDT A;  4LA6 A;  3NPK A;  5ILJ A;  4GAX A;  2AZJ A;  5HN8 A;  4MC0 A;  4DWG A;  3Q30 A;  5KSX F;  2ZEU A;  4RXC A;  1UBW A;  1WL3 A;  4RYP A;  5IKA A;  3SAE A;  5A0I A;  3TFN A;  4E9Z A;  5ERN A;  5ILY A;  1HM4 A;  5B03 A;  3N1V F;  3LZ9 A;  3N6K F;  4GA3 A;  3ICN A;  5DGN F;  1V4I A;  3IPI A;  3WSA A;  5ILI A;  2E91 A;  3WCG A;  4JXN A;  3KRA B;  3NF2 A;  5DJV F;  3RBM A;  3SDQ A;  3KRA A;  4E9U A;  1WL0 A;  3ID0 A;  5AFX A;  2EWG A;  4P0X A;  2VF6 A;  2Z52 A;  2DH4 A;  1V4J A;  3KRP A;  2PS4 A;  2Z4X A;  5DHK A;  4N1Z F;  3P5P A;  3WCF A;  3N45 F;  5JV0 F;  3ACW A;  3WCE A;  2AZK A;  3VJ9 A;  1UBX A;  4KVD A;  4Q23 A;  5IMN A;  3TS7 A;  2Z78 A;  1WKZ A;  3LMD A;  4LIX A;  3V1X A;  1KIZ A;  2H8O A;  4UMJ A;  5DZ2 A;  3Q2Q A;  3N3L F;  4LZ3 A;  1N22 A;  3VJA A;  1V4K A;  4LLT A;  3KRO B;  3LEE A;  3P41 A;  4H5D F;  3KRO A;  3VJ8 A;  4LPH F;  3WEG A;  4DXJ A;  3ZCD A;  1YHM A;  3KBK A;  1N24 A;  4PVX F;  1WY0 A;  2E93 A;  4QXS F;  1JFA A;  2I19 A;  3LK5 A;  4LFE A;  3CC9 A;  5DGM F;  3LJI A;  3MZV A;  3WEI A;  3V1V A;  3APZ A;  1N1Z A;  3BNY A;  1UBV A;  3WC9 A;  4KPD A;  1UBY A;  5DJP F;  3ZOU A;  2F9K F;  2PS5 A;  1VG7 A;  4OKM A;  3LGZ B;  5HNA A;  2Q9Z A;  5EAU A;  3DYG A;  3N3D A;  3P8L A;  5JUZ F;  1YYQ A;  1VG4 A;  4KQ5 A;  1RTR A;  3LOM A;  3ACY A;  5IK9 A;  3PYA A;  3PH7 A;  5B0J A;  1YYT A;  3SDR A;  2ZY1 A;  1V4E A;  2E8V A;  5B00 A;  2E4O A;  3N0F A;  5IN8 A;  1YYS A;  2Z4V A;  4EA2 A;  4EA0 A;  3N49 F;  2J1O A;  2E94 A;  4KKM A;  4KVI A;  2ZCQ A;  5DIQ F;  4FJQ A;  2AEK A;  2FTZ A;  5E8K A;  3ICZ A;  2Q58 A;  4XQS F;  3RMG A;  4KFA A;  1YQ7 A;  3QQV A;  3LGK A;  4KWD A;  3RYE A;  4XQT F;  3TFP A;  2E8W A;  2P1C A;  2AEL A;  4JXY A;  1VG3 A;  5B02 A;  5H9D A;  3KRP B;  4RXD A;  2E95 A;  2E8X A;  2RAH A;  4HD1 A;  5E8H A;  3EGT A;  3LG5 A;  3TFV A;  3UCA A;  2AET A;  3EFQ A;  4JYX A;  5ERM A;  2Z7I A;  4LTZ A;  3SDV A;  5DHI A;  5EAS A;  2ONH A;  5B0M A;  1DI1 A;  3ACX A;  4KPJ A;  3WCH A;  3KRF B;  3IBA A;  5DJR F;  4JZX A;  3KRF A;  2E8U A;  1YV5 A;  5A0K A;  3WCA A;  2ZEV A;  3OAB B;  3PKO A;  3WEK A;  2ZCR A;  2OPM A;  3P5R A;  3OAB A;  4NFI F;  1HXA A;  3QKC A;  4DEM F;  1YYR A;  3DYF A;  3G4D A;  3KRC B;  2OPN A;  3KRC A;  1N1B A;  4NUA A;  1YJ4 A;  3ASX A;  3ZMC A;  1V4H A;  4GP2 A;  5A0J A;  5ILZ A;  3ZMB A;  2O1O A;  2F94 F;  2FOR A;  2J1P A;  2Z4W A;  5HN9 A;  4LUU A;  3WCD A;  4JZB A;  1RQJ A;  4OGU A;  3P8R A;  3NPR A;  3VJC A;  4LTV A;  4OMG A;  1N20 A;  3MAV A;  4RXA A;  3AQC B;  5HN7 A;  3LLW A;  2PS7 A; 
#chains in the Genus database with same CATH topology
 4OKZ A;  4KVY A;  4XQR F;  3N0G A;  4LA5 A;  2QIS A;  3OAC A;  3LVS A;  3N46 F;  3V66 A;  4E1E A;  2J5C A;  1HXG A;  4KQS A;  3W7F A;  3PDE A;  4F62 A;  1WL1 A;  5IKH A;  5IM1 A;  4LOB A;  3NRI A;  5B0L A;  5IK6 A;  3SDU A;  3Q2Z A;  1VG2 A;  3S9V A;  5JV2 F;  4EA1 A;  5ERO A;  3AQ0 A;  1N23 A;  1YHL A;  2Z50 A;  3N5H F;  3OYR A;  4L2X F;  5AYP A;  3WJK A;  4LZC A;  5IK0 A;  4LFV F;  5IL3 A;  3WCI A;  3PYB A;  5JA0 F;  4MC8 A;  5CG5 A;  4NKE A;  3WCL A;  1ZW5 A;  3ICK A;  3RYW A;  4F6V A;  5DGS F;  4NFK F;  5JV1 F;  1PS1 A;  5B01 A;  2F92 F;  1FPS A;  3AQB B;  2E92 A;  1EZF A;  4KVW A;  4ZQ8 A;  4F6X A;  2E90 A;  4LLS A;  1YYU A;  2F8Z F;  3CKE A;  2Z7H A;  5IVG A;  1HX9 A;  3Q1O A;  3WJO A;  1YHK A;  5AHU B;  2OA6 A;  4DHD A;  4LZ0 A;  3WEF A;  3WCJ A;  3AE0 A;  4LPG F;  4FP4 A;  1KIY A;  3WEJ A;  4LXW A;  4OMH A;  5ILD A;  4DZW A;  5ER8 A;  3N5J F;  4DI5 A;  4JVJ F;  4PVY F;  3WCB A;  4KQU A;  2ZCO A;  5B0I A;  2F89 F;  2F8C F;  3WEH A;  3EZ3 A;  3WJN A;  3VJE A;  4H5E F;  5AEL A;  3B7L A;  4NKF A;  4QPF A;  3DYH A;  4RNQ A;  2OGD A;  2Z4Z A;  4GP1 A;  3VJD A;  5B0K A;  3M9U A;  4RXE A;  1DGP A;  5ILH A;  4NG6 A;  2ZCS A;  4WK5 A;  2E8T A;  5I1U A;  2PS6 A;  3BNX A;  5E8L A;  5C05 A;  5IMI A;  4KK2 A;  4LFG A;  1JFG A;  4KUX A;  2Q9Y A;  4N9U A;  3WE9 A;  3WCC A;  4H5C F;  5ILK A;  1WL2 A;  1N21 A;  4DWB A;  3M00 A;  3G4F A;  1RQI A;  4P0W A;  3TC1 A;  3WSB A;  2Z4Y A;  1WMW A;  3VJB A;  3M02 A;  1HXC A;  1HM7 A;  3M0G A;  3S4J A;  2Q80 A;  3OAC B;  5IL8 A;  5CG6 A;  5DW7 A;  2PS8 A;  5EAT A;  3ICM A;  2F7M F;  3WCM A;  3ZL6 A;  1VG6 A;  2AZL A;  3CP6 A;  3M01 A;  4NFJ F;  3N1W F;  3LDW A;  3LSN A;  5IMP A;  4P0V A;  3ADZ A;  2ONG A;  3KB9 A;  4K10 A;  4MC3 A;  3SDT A;  4LA6 A;  3NPK A;  5ILJ A;  4GAX A;  2AZJ A;  5HN8 A;  4MC0 A;  4DWG A;  3Q30 A;  5KSX F;  2ZEU A;  4RXC A;  1UBW A;  1WL3 A;  4RYP A;  5IKA A;  3SAE A;  5A0I A;  3TFN A;  4E9Z A;  5ERN A;  5ILY A;  1HM4 A;  5B03 A;  3N1V F;  3LZ9 A;  3N6K F;  4GA3 A;  3ICN A;  5DGN F;  1V4I A;  3IPI A;  3WSA A;  5ILI A;  2E91 A;  3WCG A;  4JXN A;  3KRA B;  3NF2 A;  5DJV F;  3RBM A;  3SDQ A;  3KRA A;  4E9U A;  1WL0 A;  3ID0 A;  5AFX A;  2EWG A;  4P0X A;  2VF6 A;  2Z52 A;  2DH4 A;  1V4J A;  3KRP A;  2PS4 A;  2Z4X A;  5DHK A;  4N1Z F;  3P5P A;  3WCF A;  3N45 F;  5JV0 F;  3ACW A;  3WCE A;  2AZK A;  3VJ9 A;  1UBX A;  4KVD A;  4Q23 A;  5IMN A;  3TS7 A;  2Z78 A;  1WKZ A;  3LMD A;  4LIX A;  3V1X A;  1KIZ A;  2H8O A;  4UMJ A;  5DZ2 A;  3Q2Q A;  3N3L F;  4LZ3 A;  1N22 A;  3VJA A;  1V4K A;  4LLT A;  3KRO B;  3LEE A;  3P41 A;  4H5D F;  3KRO A;  3VJ8 A;  4LPH F;  3WEG A;  4DXJ A;  3ZCD A;  1YHM A;  3KBK A;  1N24 A;  4PVX F;  1WY0 A;  2E93 A;  4QXS F;  1JFA A;  2I19 A;  3LK5 A;  4LFE A;  3CC9 A;  5DGM F;  3LJI A;  3MZV A;  3WEI A;  3V1V A;  3APZ A;  1N1Z A;  3BNY A;  1UBV A;  3WC9 A;  4KPD A;  1UBY A;  5DJP F;  3ZOU A;  2F9K F;  2PS5 A;  1VG7 A;  4OKM A;  3LGZ B;  5HNA A;  2Q9Z A;  5EAU A;  3DYG A;  3N3D A;  3P8L A;  5JUZ F;  1YYQ A;  1VG4 A;  4KQ5 A;  1RTR A;  3LOM A;  3ACY A;  5IK9 A;  3PYA A;  3PH7 A;  5B0J A;  1YYT A;  3SDR A;  2ZY1 A;  1V4E A;  2E8V A;  5B00 A;  2E4O A;  3N0F A;  5IN8 A;  1YYS A;  2Z4V A;  4EA2 A;  4EA0 A;  3N49 F;  2J1O A;  2E94 A;  4KKM A;  4KVI A;  2ZCQ A;  5DIQ F;  4FJQ A;  2AEK A;  2FTZ A;  5E8K A;  3ICZ A;  2Q58 A;  4XQS F;  3RMG A;  4KFA A;  1YQ7 A;  3QQV A;  3LGK A;  4KWD A;  3RYE A;  4XQT F;  3TFP A;  2E8W A;  2P1C A;  2AEL A;  4JXY A;  1VG3 A;  5B02 A;  5H9D A;  3KRP B;  4RXD A;  2E95 A;  2E8X A;  2RAH A;  4HD1 A;  5E8H A;  3EGT A;  3LG5 A;  3TFV A;  3UCA A;  2AET A;  3EFQ A;  4JYX A;  5ERM A;  2Z7I A;  4LTZ A;  3SDV A;  5DHI A;  5EAS A;  2ONH A;  5B0M A;  1DI1 A;  3ACX A;  4KPJ A;  3WCH A;  3KRF B;  3IBA A;  5DJR F;  4JZX A;  3KRF A;  2E8U A;  1YV5 A;  5A0K A;  3WCA A;  2ZEV A;  3OAB B;  3PKO A;  3WEK A;  2ZCR A;  2OPM A;  3P5R A;  3OAB A;  4NFI F;  1HXA A;  3QKC A;  4DEM F;  1YYR A;  3DYF A;  3G4D A;  3KRC B;  2OPN A;  3KRC A;  1N1B A;  4NUA A;  1YJ4 A;  3ASX A;  3ZMC A;  1V4H A;  4GP2 A;  5A0J A;  5ILZ A;  3ZMB A;  2O1O A;  2F94 F;  2FOR A;  2J1P A;  2Z4W A;  5HN9 A;  4LUU A;  3WCD A;  4JZB A;  1RQJ A;  4OGU A;  3P8R A;  3NPR A;  3VJC A;  4LTV A;  4OMG A;  1N20 A;  3MAV A;  4RXA A;  3AQC B;  5HN7 A;  3LLW A;  2PS7 A; 
#chains in the Genus database with same CATH homology
 4OKZ A;  4KVY A;  4XQR F;  3N0G A;  4LA5 A;  2QIS A;  3OAC A;  3LVS A;  3N46 F;  3V66 A;  4E1E A;  2J5C A;  1HXG A;  4KQS A;  3W7F A;  3PDE A;  4F62 A;  1WL1 A;  5IKH A;  5IM1 A;  4LOB A;  3NRI A;  5B0L A;  5IK6 A;  3SDU A;  3Q2Z A;  1VG2 A;  3S9V A;  5JV2 F;  4EA1 A;  5ERO A;  3AQ0 A;  1N23 A;  1YHL A;  2Z50 A;  3N5H F;  3OYR A;  4L2X F;  5AYP A;  3WJK A;  4LZC A;  5IK0 A;  4LFV F;  5IL3 A;  3WCI A;  3PYB A;  5JA0 F;  4MC8 A;  5CG5 A;  4NKE A;  3WCL A;  1ZW5 A;  3ICK A;  3RYW A;  4F6V A;  5DGS F;  4NFK F;  5JV1 F;  1PS1 A;  5B01 A;  2F92 F;  1FPS A;  3AQB B;  2E92 A;  1EZF A;  4KVW A;  4ZQ8 A;  4F6X A;  2E90 A;  4LLS A;  1YYU A;  2F8Z F;  3CKE A;  2Z7H A;  5IVG A;  1HX9 A;  3Q1O A;  3WJO A;  1YHK A;  5AHU B;  2OA6 A;  4DHD A;  4LZ0 A;  3WEF A;  3WCJ A;  3AE0 A;  4LPG F;  4FP4 A;  1KIY A;  3WEJ A;  4LXW A;  4OMH A;  5ILD A;  4DZW A;  5ER8 A;  3N5J F;  4DI5 A;  4JVJ F;  4PVY F;  3WCB A;  4KQU A;  2ZCO A;  5B0I A;  2F89 F;  2F8C F;  3WEH A;  3EZ3 A;  3WJN A;  3VJE A;  4H5E F;  5AEL A;  3B7L A;  4NKF A;  4QPF A;  3DYH A;  4RNQ A;  2OGD A;  2Z4Z A;  4GP1 A;  3VJD A;  5B0K A;  3M9U A;  4RXE A;  1DGP A;  5ILH A;  4NG6 A;  2ZCS A;  4WK5 A;  2E8T A;  5I1U A;  2PS6 A;  3BNX A;  5E8L A;  5C05 A;  5IMI A;  4KK2 A;  4LFG A;  1JFG A;  4KUX A;  2Q9Y A;  4N9U A;  3WE9 A;  3WCC A;  4H5C F;  5ILK A;  1WL2 A;  1N21 A;  4DWB A;  3M00 A;  3G4F A;  1RQI A;  4P0W A;  3TC1 A;  3WSB A;  2Z4Y A;  1WMW A;  3VJB A;  3M02 A;  1HXC A;  1HM7 A;  3M0G A;  3S4J A;  2Q80 A;  3OAC B;  5IL8 A;  5CG6 A;  5DW7 A;  2PS8 A;  5EAT A;  3ICM A;  2F7M F;  3WCM A;  3ZL6 A;  1VG6 A;  2AZL A;  3CP6 A;  3M01 A;  4NFJ F;  3N1W F;  3LDW A;  3LSN A;  5IMP A;  4P0V A;  3ADZ A;  2ONG A;  3KB9 A;  4K10 A;  4MC3 A;  3SDT A;  4LA6 A;  3NPK A;  5ILJ A;  4GAX A;  2AZJ A;  5HN8 A;  4MC0 A;  4DWG A;  3Q30 A;  5KSX F;  2ZEU A;  4RXC A;  1UBW A;  1WL3 A;  4RYP A;  5IKA A;  3SAE A;  5A0I A;  3TFN A;  4E9Z A;  5ERN A;  5ILY A;  1HM4 A;  5B03 A;  3N1V F;  3LZ9 A;  3N6K F;  4GA3 A;  3ICN A;  5DGN F;  1V4I A;  3IPI A;  3WSA A;  5ILI A;  2E91 A;  3WCG A;  4JXN A;  3KRA B;  3NF2 A;  5DJV F;  3RBM A;  3SDQ A;  3KRA A;  4E9U A;  1WL0 A;  3ID0 A;  5AFX A;  2EWG A;  4P0X A;  2VF6 A;  2Z52 A;  2DH4 A;  1V4J A;  3KRP A;  2PS4 A;  2Z4X A;  5DHK A;  4N1Z F;  3P5P A;  3WCF A;  3N45 F;  5JV0 F;  3ACW A;  3WCE A;  2AZK A;  3VJ9 A;  1UBX A;  4KVD A;  4Q23 A;  5IMN A;  3TS7 A;  2Z78 A;  1WKZ A;  3LMD A;  4LIX A;  3V1X A;  1KIZ A;  2H8O A;  4UMJ A;  5DZ2 A;  3Q2Q A;  3N3L F;  4LZ3 A;  1N22 A;  3VJA A;  1V4K A;  4LLT A;  3KRO B;  3LEE A;  3P41 A;  4H5D F;  3KRO A;  3VJ8 A;  4LPH F;  3WEG A;  4DXJ A;  3ZCD A;  1YHM A;  3KBK A;  1N24 A;  4PVX F;  1WY0 A;  2E93 A;  4QXS F;  1JFA A;  2I19 A;  3LK5 A;  4LFE A;  3CC9 A;  5DGM F;  3LJI A;  3MZV A;  3WEI A;  3V1V A;  3APZ A;  1N1Z A;  3BNY A;  1UBV A;  3WC9 A;  4KPD A;  1UBY A;  5DJP F;  3ZOU A;  2F9K F;  2PS5 A;  1VG7 A;  4OKM A;  3LGZ B;  5HNA A;  2Q9Z A;  5EAU A;  3DYG A;  3N3D A;  3P8L A;  5JUZ F;  1YYQ A;  1VG4 A;  4KQ5 A;  1RTR A;  3LOM A;  3ACY A;  5IK9 A;  3PYA A;  3PH7 A;  5B0J A;  1YYT A;  3SDR A;  2ZY1 A;  1V4E A;  2E8V A;  5B00 A;  2E4O A;  3N0F A;  5IN8 A;  1YYS A;  2Z4V A;  4EA2 A;  4EA0 A;  3N49 F;  2J1O A;  2E94 A;  4KKM A;  4KVI A;  2ZCQ A;  5DIQ F;  4FJQ A;  2AEK A;  2FTZ A;  5E8K A;  3ICZ A;  2Q58 A;  4XQS F;  3RMG A;  4KFA A;  1YQ7 A;  3QQV A;  3LGK A;  4KWD A;  3RYE A;  4XQT F;  3TFP A;  2E8W A;  2P1C A;  2AEL A;  4JXY A;  1VG3 A;  5B02 A;  5H9D A;  3KRP B;  4RXD A;  2E95 A;  2E8X A;  2RAH A;  4HD1 A;  5E8H A;  3EGT A;  3LG5 A;  3TFV A;  3UCA A;  2AET A;  3EFQ A;  4JYX A;  5ERM A;  2Z7I A;  4LTZ A;  3SDV A;  5DHI A;  5EAS A;  2ONH A;  5B0M A;  1DI1 A;  3ACX A;  4KPJ A;  3WCH A;  3KRF B;  3IBA A;  5DJR F;  4JZX A;  3KRF A;  2E8U A;  1YV5 A;  5A0K A;  3WCA A;  2ZEV A;  3OAB B;  3PKO A;  3WEK A;  2ZCR A;  2OPM A;  3P5R A;  3OAB A;  4NFI F;  1HXA A;  3QKC A;  4DEM F;  1YYR A;  3DYF A;  3G4D A;  3KRC B;  2OPN A;  3KRC A;  1N1B A;  4NUA A;  1YJ4 A;  3ASX A;  3ZMC A;  1V4H A;  4GP2 A;  5A0J A;  5ILZ A;  3ZMB A;  2O1O A;  2F94 F;  2FOR A;  2J1P A;  2Z4W A;  5HN9 A;  4LUU A;  3WCD A;  4JZB A;  1RQJ A;  4OGU A;  3P8R A;  3NPR A;  3VJC A;  4LTV A;  4OMG A;  1N20 A;  3MAV A;  4RXA A;  3AQC B;  5HN7 A;  3LLW A;  2PS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...