3DYHA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-721
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
367
structure length
358
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyl pyrophosphate synthase
publication title Lipophilic bisphosphonates as dual farnesyl/geranylgeranyl diphosphate synthase inhibitors: an X-ray and NMR investigation.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 148
structure length 358
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2008-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3dyhA00
2Z7HA 2J1OA 4NG6A 4NKEA 3S4JA 3ICMA 3TC1A 4NUAA 2E91A 3WJNA 3N6KF 3ICZA 1YHKA 4LFGA 4LOBA 3KRFB 2H8OA 3VJAA 2PS6A 4RXCA 4KKMA 1YHMA 1UBXA 3VJ8A 4LLTA 3ZMCA 1JFAA 3PKOA 4Q23A 3N3LF 3WEHA 3ZL6A 1HXGA 3N0FA 3M9UA 1HXAA 5IK6A 1VG4A 3LMDA 4LFVF 3N5HF 3N1WF 3UCAA 3ASXA 2ONGA 4E9ZA 3WCGA 1DGPA 5JUZF 5DJPF 4DHDA 2E8WA 5DGNF 5I1UA 5ER8A 4JZXA 5B0LA 1EZFA 3N0GA 2OPNA 2E92A 4UMJA 5IL8A 5HNAA 1YYSA 2J5CA 4DEMF 2RAHA 3N45F 2E4OA 4ZQ8A 3WCCA 3Q30A 2E94A 3TFNA 3TS7A 4KQUA 5IL3A 1WMWA 4N1ZF 2PS4A 5EAUA 4KVDA 3SDQA 3RBMA 2ONHA 2F7MF 3WCDA 5AFXA 3LDWA 3WCJA 4PVXF 5EASA 3APZA 1HM4A 2AZJA 3WJKA 2ZCSA 2AEKA 1YYRA 3P41A 3WSAA 3SAEA 5B0IA 3SDVA 4DWGA 5H9DA 3QKCA 4PVYF 1RQIA 2PS7A 5B00A 4JVJF 1N1ZA 3KRAB 2Z4WA 1DI1A 3VJDA 4RXEA 2Z50A 3NRIA 4KVYA 5ILYA 1V4KA 4WK5A 3WEJA 3ICKA 3B7LA 3KRPA 5AYPA 3MZVA 5DW7A 4LPHF 4LIXA 4K10A 2DH4A 4GAXA 5IK0A 4KPJA 3WCMA 3WSBA 3LOMA 1ZW5A 2Q80A 5DIQF 4LA6A 3OACA 5IN8A 2Q9YA 4LTZA 4RNQA 2E8UA 3LJIA 5ILIA 2F94F 5DGSF 4XQTF 5DHIA 1UBVA 2AZLA 3WCFA 3KROB 2ZCQA 2Q9ZA 2P1CA 3ICNA 5ILZA 1VG2A 4KK2A 3RYWA 3IPIA 4H5CF 4H5EF 1N24A 4FJQA 4NFKF 1V4JA 1FPSA 5JA0F 1V4IA 3WCIA 3DYGA 5B03A 4KQSA 5B0JA 3CC9A 2EWGA 3EZ3A 4QPFA 3SDUA 4F6XA 3KB9A 2F8CF 5B0MA 3Q2QA 1HM7A 5ERNA 3N5JF 2F8ZF 5JV1F 1N22A 4KFAA 4OGUA 1WL1A 4NFIF 5E8KA 3WEGA 3RMGA 2Z4VA 5DJRF 5HN7A 3ADZA 3KRFA 5DJVF 1N1BA 4OKMA 1HXCA 2FTZA 3OABB 3PDEA 2Z4ZA 3WEKA 4JXNA 3Q2ZA 5KSXF 3NPKA 2E8TA 4DZWA 4F6VA 3G4FA 5ILHA 4LZ0A 4KWDA 1YV5A 3S9VA 1KIYA 4MC8A 4LZCA 3VJ9A 3TFPA 2ZEUA 4FP4A 1WY0A 3WEIA 4XQSF 3PYBA 1VG6A 3N46F 3ID0A 3LGKA 3WCLA 3OABA 3P8RA 5ILKA 2Z4YA 3M02A 4LZ3A 4OMHA 5AELA 1V4EA 1WKZA 4H5DF 4LTVA 3ZMBA 1YYQA 4GA3A 5IM1A 3ACXA 5ILDA 5DHKA 3P5PA 3LGZB 5C05A 3N3DA 3RYEA 5EROA 5DGMF 5B02A 1KIZA 4LFEA 1UBWA 4OMGA 1WL2A 4F62A 3MAVA 2O1OA 3Q1OA 5IVGA 2Z52A 3KRCB 2OPMA 5JV0F 1YYTA 1WL3A 4RYPA 3LK5A 4E1EA 5A0JA 4DXJA 3KRAA 2F92F 2I19A 4OKZA 1N23A 3WE9A 5DZ2A 1JFGA 3EFQA 3LVSA 3N1VF 3P8LA 4EA1A 3VJBA 1N21A 3M01A 2PS5A 5EATA 2OA6A 5A0KA 4DI5A 2E95A 1WL0A 4KVWA 2Z7IA 3N49F 3WCEA 1UBYA 4E9UA 1RQJA 2ZCOA 1V4HA 3IBAA 3KRCA 5HN8A 2F89F 2ZY1A 1YYUA 3LG5A 4RXDA 3EGTA 4JYXA 3NF2A 4HD1A 1N20A 1YHLA 2ZCRA 2E90A 3KROA 2E93A 3BNXA 4JZBA 4JXYA 2AETA 5B0KA 4NKFA 3ZOUA 3LLWA 3DYFA 4DWBA 4EA2A 5IMPA 4P0XA 2F9KF 5IK9A 3VJEA 2FORA 3V1VA 1RTRA 1YJ4A 5A0IA 5JV2F 1VG3A 3NPRA 3W7FA 2Z78A 3VJCA 4LA5A 3M0GA 3OYRA 4KUXA 3KRPB 5AHUB 4LLSA 3SDRA 1PS1A 5E8LA 3V1XA 5CG5A 3ZCDA 1YQ7A 3LEEA 3P5RA 4MC3A 2E8VA 3G4DA 3PH7A 4N9UA 4NFJF 3BNYA 2VF6A 4MC0A 5IKHA 3WCBA 3WCHA 4KVIA 3WJOA 2AZKA 3SDTA 3OACB 2J1PA 3LZ9A 4P0VA 4P0WA 3CP6A 5CG6A 3TFVA 3CKEA 4LXWA 2Z4XA 3AQ0A 3AQBB 3V66A 1VG7A 5HN9A 4KQ5A 4EA0A 5IKAA 4RXAA 3M00A 4XQRF 2OGDA 3ACYA 3LSNA 3ACWA 3PYAA 2QISA 2ZEVA 4L2XF 3KBKA 4LUUA 2Q58A 5B01A 3WC9A 5E8HA 3AQCB 2PS8A 4LPGF 5IMIA 5ILJA 1HX9A 4GP1A 3QQVA 4QXSF 5ERMA 3AE0A 3DYHA 5IMNA 2AELA 2E8XA 3WEFA 4KPDA 4GP2A 3WCAA
chains in the Genus database with same CATH superfamily
2Z7HA 2J1OA 4NG6A 4NKEA 3S4JA 3ICMA 3TC1A 4NUAA 2E91A 3WJNA 3N6KF 3ICZA 1YHKA 4LFGA 4LOBA 3KRFB 2H8OA 3VJAA 2PS6A 4RXCA 4KKMA 1YHMA 1UBXA 3VJ8A 4LLTA 3ZMCA 1JFAA 3PKOA 4Q23A 3N3LF 3WEHA 3ZL6A 1HXGA 3N0FA 3M9UA 1HXAA 5IK6A 1VG4A 3LMDA 4LFVF 3N5HF 3N1WF 3UCAA 3ASXA 2ONGA 4E9ZA 3WCGA 1DGPA 5JUZF 5DJPF 4DHDA 2E8WA 5DGNF 5I1UA 5ER8A 4JZXA 5B0LA 1EZFA 3N0GA 2OPNA 2E92A 4UMJA 5IL8A 5HNAA 1YYSA 2J5CA 4DEMF 2RAHA 3N45F 2E4OA 4ZQ8A 3WCCA 3Q30A 2E94A 3TFNA 3TS7A 4KQUA 5IL3A 1WMWA 4N1ZF 2PS4A 5EAUA 4KVDA 3SDQA 3RBMA 2ONHA 2F7MF 3WCDA 5AFXA 3LDWA 3WCJA 4PVXF 5EASA 3APZA 1HM4A 2AZJA 3WJKA 2ZCSA 2AEKA 1YYRA 3P41A 3WSAA 3SAEA 5B0IA 3SDVA 4DWGA 5H9DA 3QKCA 4PVYF 1RQIA 2PS7A 5B00A 4JVJF 1N1ZA 3KRAB 2Z4WA 1DI1A 3VJDA 4RXEA 2Z50A 3NRIA 4KVYA 5ILYA 1V4KA 4WK5A 3WEJA 3ICKA 3B7LA 3KRPA 5AYPA 3MZVA 5DW7A 4LPHF 4LIXA 4K10A 2DH4A 4GAXA 5IK0A 4KPJA 3WCMA 3WSBA 3LOMA 1ZW5A 2Q80A 5DIQF 4LA6A 3OACA 5IN8A 2Q9YA 4LTZA 4RNQA 2E8UA 3LJIA 5ILIA 2F94F 5DGSF 4XQTF 5DHIA 1UBVA 2AZLA 3WCFA 3KROB 2ZCQA 2Q9ZA 2P1CA 3ICNA 5ILZA 1VG2A 4KK2A 3RYWA 3IPIA 4H5CF 4H5EF 1N24A 4FJQA 4NFKF 1V4JA 1FPSA 5JA0F 1V4IA 3WCIA 3DYGA 5B03A 4KQSA 5B0JA 3CC9A 2EWGA 3EZ3A 4QPFA 3SDUA 4F6XA 3KB9A 2F8CF 5B0MA 3Q2QA 1HM7A 5ERNA 3N5JF 2F8ZF 5JV1F 1N22A 4KFAA 4OGUA 1WL1A 4NFIF 5E8KA 3WEGA 3RMGA 2Z4VA 5DJRF 5HN7A 3ADZA 3KRFA 5DJVF 1N1BA 4OKMA 1HXCA 2FTZA 3OABB 3PDEA 2Z4ZA 3WEKA 4JXNA 3Q2ZA 5KSXF 3NPKA 2E8TA 4DZWA 4F6VA 3G4FA 5ILHA 4LZ0A 4KWDA 1YV5A 3S9VA 1KIYA 4MC8A 4LZCA 3VJ9A 3TFPA 2ZEUA 4FP4A 1WY0A 3WEIA 4XQSF 3PYBA 1VG6A 3N46F 3ID0A 3LGKA 3WCLA 3OABA 3P8RA 5ILKA 2Z4YA 3M02A 4LZ3A 4OMHA 5AELA 1V4EA 1WKZA 4H5DF 4LTVA 3ZMBA 1YYQA 4GA3A 5IM1A 3ACXA 5ILDA 5DHKA 3P5PA 3LGZB 5C05A 3N3DA 3RYEA 5EROA 5DGMF 5B02A 1KIZA 4LFEA 1UBWA 4OMGA 1WL2A 4F62A 3MAVA 2O1OA 3Q1OA 5IVGA 2Z52A 3KRCB 2OPMA 5JV0F 1YYTA 1WL3A 4RYPA 3LK5A 4E1EA 5A0JA 4DXJA 3KRAA 2F92F 2I19A 4OKZA 1N23A 3WE9A 5DZ2A 1JFGA 3EFQA 3LVSA 3N1VF 3P8LA 4EA1A 3VJBA 1N21A 3M01A 2PS5A 5EATA 2OA6A 5A0KA 4DI5A 2E95A 1WL0A 4KVWA 2Z7IA 3N49F 3WCEA 1UBYA 4E9UA 1RQJA 2ZCOA 1V4HA 3IBAA 3KRCA 5HN8A 2F89F 2ZY1A 1YYUA 3LG5A 4RXDA 3EGTA 4JYXA 3NF2A 4HD1A 1N20A 1YHLA 2ZCRA 2E90A 3KROA 2E93A 3BNXA 4JZBA 4JXYA 2AETA 5B0KA 4NKFA 3ZOUA 3LLWA 3DYFA 4DWBA 4EA2A 5IMPA 4P0XA 2F9KF 5IK9A 3VJEA 2FORA 3V1VA 1RTRA 1YJ4A 5A0IA 5JV2F 1VG3A 3NPRA 3W7FA 2Z78A 3VJCA 4LA5A 3M0GA 3OYRA 4KUXA 3KRPB 5AHUB 4LLSA 3SDRA 1PS1A 5E8LA 3V1XA 5CG5A 3ZCDA 1YQ7A 3LEEA 3P5RA 4MC3A 2E8VA 3G4DA 3PH7A 4N9UA 4NFJF 3BNYA 2VF6A 4MC0A 5IKHA 3WCBA 3WCHA 4KVIA 3WJOA 2AZKA 3SDTA 3OACB 2J1PA 3LZ9A 4P0VA 4P0WA 3CP6A 5CG6A 3TFVA 3CKEA 4LXWA 2Z4XA 3AQ0A 3AQBB 3V66A 1VG7A 5HN9A 4KQ5A 4EA0A 5IKAA 4RXAA 3M00A 4XQRF 2OGDA 3ACYA 3LSNA 3ACWA 3PYAA 2QISA 2ZEVA 4L2XF 3KBKA 4LUUA 2Q58A 5B01A 3WC9A 5E8HA 3AQCB 2PS8A 4LPGF 5IMIA 5ILJA 1HX9A 4GP1A 3QQVA 4QXSF 5ERMA 3AE0A 3DYHA 5IMNA 2AELA 2E8XA 3WEFA 4KPDA 4GP2A 3WCAA
chains in the Genus database with same CATH topology
2Z7HA 2J1OA 4NG6A 4NKEA 3S4JA 3ICMA 3TC1A 4NUAA 2E91A 3WJNA 3N6KF 3ICZA 1YHKA 4LFGA 4LOBA 3KRFB 2H8OA 3VJAA 2PS6A 4RXCA 4KKMA 1YHMA 1UBXA 3VJ8A 4LLTA 3ZMCA 1JFAA 3PKOA 4Q23A 3N3LF 3WEHA 3ZL6A 1HXGA 3N0FA 3M9UA 1HXAA 5IK6A 1VG4A 3LMDA 4LFVF 3N5HF 3N1WF 3UCAA 3ASXA 2ONGA 4E9ZA 3WCGA 1DGPA 5JUZF 5DJPF 4DHDA 2E8WA 5DGNF 5I1UA 5ER8A 4JZXA 5B0LA 1EZFA 3N0GA 2OPNA 2E92A 4UMJA 5IL8A 5HNAA 1YYSA 2J5CA 4DEMF 2RAHA 3N45F 2E4OA 4ZQ8A 3WCCA 3Q30A 2E94A 3TFNA 3TS7A 4KQUA 5IL3A 1WMWA 4N1ZF 2PS4A 5EAUA 4KVDA 3SDQA 3RBMA 2ONHA 2F7MF 3WCDA 5AFXA 3LDWA 3WCJA 4PVXF 5EASA 3APZA 1HM4A 2AZJA 3WJKA 2ZCSA 2AEKA 1YYRA 3P41A 3WSAA 3SAEA 5B0IA 3SDVA 4DWGA 5H9DA 3QKCA 4PVYF 1RQIA 2PS7A 5B00A 4JVJF 1N1ZA 3KRAB 2Z4WA 1DI1A 3VJDA 4RXEA 2Z50A 3NRIA 4KVYA 5ILYA 1V4KA 4WK5A 3WEJA 3ICKA 3B7LA 3KRPA 5AYPA 3MZVA 5DW7A 4LPHF 4LIXA 4K10A 2DH4A 4GAXA 5IK0A 4KPJA 3WCMA 3WSBA 3LOMA 1ZW5A 2Q80A 5DIQF 4LA6A 3OACA 5IN8A 2Q9YA 4LTZA 4RNQA 2E8UA 3LJIA 5ILIA 2F94F 5DGSF 4XQTF 5DHIA 1UBVA 2AZLA 3WCFA 3KROB 2ZCQA 2Q9ZA 2P1CA 3ICNA 5ILZA 1VG2A 4KK2A 3RYWA 3IPIA 4H5CF 4H5EF 1N24A 4FJQA 4NFKF 1V4JA 1FPSA 5JA0F 1V4IA 3WCIA 3DYGA 5B03A 4KQSA 5B0JA 3CC9A 2EWGA 3EZ3A 4QPFA 3SDUA 4F6XA 3KB9A 2F8CF 5B0MA 3Q2QA 1HM7A 5ERNA 3N5JF 2F8ZF 5JV1F 1N22A 4KFAA 4OGUA 1WL1A 4NFIF 5E8KA 3WEGA 3RMGA 2Z4VA 5DJRF 5HN7A 3ADZA 3KRFA 5DJVF 1N1BA 4OKMA 1HXCA 2FTZA 3OABB 3PDEA 2Z4ZA 3WEKA 4JXNA 3Q2ZA 5KSXF 3NPKA 2E8TA 4DZWA 4F6VA 3G4FA 5ILHA 4LZ0A 4KWDA 1YV5A 3S9VA 1KIYA 4MC8A 4LZCA 3VJ9A 3TFPA 2ZEUA 4FP4A 1WY0A 3WEIA 4XQSF 3PYBA 1VG6A 3N46F 3ID0A 3LGKA 3WCLA 3OABA 3P8RA 5ILKA 2Z4YA 3M02A 4LZ3A 4OMHA 5AELA 1V4EA 1WKZA 4H5DF 4LTVA 3ZMBA 1YYQA 4GA3A 5IM1A 3ACXA 5ILDA 5DHKA 3P5PA 3LGZB 5C05A 3N3DA 3RYEA 5EROA 5DGMF 5B02A 1KIZA 4LFEA 1UBWA 4OMGA 1WL2A 4F62A 3MAVA 2O1OA 3Q1OA 5IVGA 2Z52A 3KRCB 2OPMA 5JV0F 1YYTA 1WL3A 4RYPA 3LK5A 4E1EA 5A0JA 4DXJA 3KRAA 2F92F 2I19A 4OKZA 1N23A 3WE9A 5DZ2A 1JFGA 3EFQA 3LVSA 3N1VF 3P8LA 4EA1A 3VJBA 1N21A 3M01A 2PS5A 5EATA 2OA6A 5A0KA 4DI5A 2E95A 1WL0A 4KVWA 2Z7IA 3N49F 3WCEA 1UBYA 4E9UA 1RQJA 2ZCOA 1V4HA 3IBAA 3KRCA 5HN8A 2F89F 2ZY1A 1YYUA 3LG5A 4RXDA 3EGTA 4JYXA 3NF2A 4HD1A 1N20A 1YHLA 2ZCRA 2E90A 3KROA 2E93A 3BNXA 4JZBA 4JXYA 2AETA 5B0KA 4NKFA 3ZOUA 3LLWA 3DYFA 4DWBA 4EA2A 5IMPA 4P0XA 2F9KF 5IK9A 3VJEA 2FORA 3V1VA 1RTRA 1YJ4A 5A0IA 5JV2F 1VG3A 3NPRA 3W7FA 2Z78A 3VJCA 4LA5A 3M0GA 3OYRA 4KUXA 3KRPB 5AHUB 4LLSA 3SDRA 1PS1A 5E8LA 3V1XA 5CG5A 3ZCDA 1YQ7A 3LEEA 3P5RA 4MC3A 2E8VA 3G4DA 3PH7A 4N9UA 4NFJF 3BNYA 2VF6A 4MC0A 5IKHA 3WCBA 3WCHA 4KVIA 3WJOA 2AZKA 3SDTA 3OACB 2J1PA 3LZ9A 4P0VA 4P0WA 3CP6A 5CG6A 3TFVA 3CKEA 4LXWA 2Z4XA 3AQ0A 3AQBB 3V66A 1VG7A 5HN9A 4KQ5A 4EA0A 5IKAA 4RXAA 3M00A 4XQRF 2OGDA 3ACYA 3LSNA 3ACWA 3PYAA 2QISA 2ZEVA 4L2XF 3KBKA 4LUUA 2Q58A 5B01A 3WC9A 5E8HA 3AQCB 2PS8A 4LPGF 5IMIA 5ILJA 1HX9A 4GP1A 3QQVA 4QXSF 5ERMA 3AE0A 3DYHA 5IMNA 2AELA 2E8XA 3WEFA 4KPDA 4GP2A 3WCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z7H A;  2J1O A;  4NG6 A;  4NKE A;  3S4J A;  3ICM A;  3TC1 A;  4NUA A;  2E91 A;  3WJN A;  3N6K F;  3ICZ A;  1YHK A;  4LFG A;  4LOB A;  3KRF B;  2H8O A;  3VJA A;  2PS6 A;  4RXC A;  4KKM A;  1YHM A;  1UBX A;  3VJ8 A;  4LLT A;  3ZMC A;  1JFA A;  3PKO A;  4Q23 A;  3N3L F;  3WEH A;  3ZL6 A;  1HXG A;  3N0F A;  3M9U A;  1HXA A;  5IK6 A;  1VG4 A;  3LMD A;  4LFV F;  3N5H F;  3N1W F;  3UCA A;  3ASX A;  2ONG A;  4E9Z A;  3WCG A;  1DGP A;  5JUZ F;  5DJP F;  4DHD A;  2E8W A;  5DGN F;  5I1U A;  5ER8 A;  4JZX A;  5B0L A;  1EZF A;  3N0G A;  2OPN A;  2E92 A;  4UMJ A;  5IL8 A;  5HNA A;  1YYS A;  2J5C A;  4DEM F;  2RAH A;  3N45 F;  2E4O A;  4ZQ8 A;  3WCC A;  3Q30 A;  2E94 A;  3TFN A;  3TS7 A;  4KQU A;  5IL3 A;  1WMW A;  4N1Z F;  2PS4 A;  5EAU A;  4KVD A;  3SDQ A;  3RBM A;  2ONH A;  2F7M F;  3WCD A;  5AFX A;  3LDW A;  3WCJ A;  4PVX F;  5EAS A;  3APZ A;  1HM4 A;  2AZJ A;  3WJK A;  2ZCS A;  2AEK A;  1YYR A;  3P41 A;  3WSA A;  3SAE A;  5B0I A;  3SDV A;  4DWG A;  5H9D A;  3QKC A;  4PVY F;  1RQI A;  2PS7 A;  5B00 A;  4JVJ F;  1N1Z A;  3KRA B;  2Z4W A;  1DI1 A;  3VJD A;  4RXE A;  2Z50 A;  3NRI A;  4KVY A;  5ILY A;  1V4K A;  4WK5 A;  3WEJ A;  3ICK A;  3B7L A;  3KRP A;  5AYP A;  3MZV A;  5DW7 A;  4LPH F;  4LIX A;  4K10 A;  2DH4 A;  4GAX A;  5IK0 A;  4KPJ A;  3WCM A;  3WSB A;  3LOM A;  1ZW5 A;  2Q80 A;  5DIQ F;  4LA6 A;  3OAC A;  5IN8 A;  2Q9Y A;  4LTZ A;  4RNQ A;  2E8U A;  3LJI A;  5ILI A;  2F94 F;  5DGS F;  4XQT F;  5DHI A;  1UBV A;  2AZL A;  3WCF A;  3KRO B;  2ZCQ A;  2Q9Z A;  2P1C A;  3ICN A;  5ILZ A;  1VG2 A;  4KK2 A;  3RYW A;  3IPI A;  4H5C F;  4H5E F;  1N24 A;  4FJQ A;  4NFK F;  1V4J A;  1FPS A;  5JA0 F;  1V4I A;  3WCI A;  3DYG A;  5B03 A;  4KQS A;  5B0J A;  3CC9 A;  2EWG A;  3EZ3 A;  4QPF A;  3SDU A;  4F6X A;  3KB9 A;  2F8C F;  5B0M A;  3Q2Q A;  1HM7 A;  5ERN A;  3N5J F;  2F8Z F;  5JV1 F;  1N22 A;  4KFA A;  4OGU A;  1WL1 A;  4NFI F;  5E8K A;  3WEG A;  3RMG A;  2Z4V A;  5DJR F;  5HN7 A;  3ADZ A;  3KRF A;  5DJV F;  1N1B A;  4OKM A;  1HXC A;  2FTZ A;  3OAB B;  3PDE A;  2Z4Z A;  3WEK A;  4JXN A;  3Q2Z A;  5KSX F;  3NPK A;  2E8T A;  4DZW A;  4F6V A;  3G4F A;  5ILH A;  4LZ0 A;  4KWD A;  1YV5 A;  3S9V A;  1KIY A;  4MC8 A;  4LZC A;  3VJ9 A;  3TFP A;  2ZEU A;  4FP4 A;  1WY0 A;  3WEI A;  4XQS F;  3PYB A;  1VG6 A;  3N46 F;  3ID0 A;  3LGK A;  3WCL A;  3OAB A;  3P8R A;  5ILK A;  2Z4Y A;  3M02 A;  4LZ3 A;  4OMH A;  5AEL A;  1V4E A;  1WKZ A;  4H5D F;  4LTV A;  3ZMB A;  1YYQ A;  4GA3 A;  5IM1 A;  3ACX A;  5ILD A;  5DHK A;  3P5P A;  3LGZ B;  5C05 A;  3N3D A;  3RYE A;  5ERO A;  5DGM F;  5B02 A;  1KIZ A;  4LFE A;  1UBW A;  4OMG A;  1WL2 A;  4F62 A;  3MAV A;  2O1O A;  3Q1O A;  5IVG A;  2Z52 A;  3KRC B;  2OPM A;  5JV0 F;  1YYT A;  1WL3 A;  4RYP A;  3LK5 A;  4E1E A;  5A0J A;  4DXJ A;  3KRA A;  2F92 F;  2I19 A;  4OKZ A;  1N23 A;  3WE9 A;  5DZ2 A;  1JFG A;  3EFQ A;  3LVS A;  3N1V F;  3P8L A;  4EA1 A;  3VJB A;  1N21 A;  3M01 A;  2PS5 A;  5EAT A;  2OA6 A;  5A0K A;  4DI5 A;  2E95 A;  1WL0 A;  4KVW A;  2Z7I A;  3N49 F;  3WCE A;  1UBY A;  4E9U A;  1RQJ A;  2ZCO A;  1V4H A;  3IBA A;  3KRC A;  5HN8 A;  2F89 F;  2ZY1 A;  1YYU A;  3LG5 A;  4RXD A;  3EGT A;  4JYX A;  3NF2 A;  4HD1 A;  1N20 A;  1YHL A;  2ZCR A;  2E90 A;  3KRO A;  2E93 A;  3BNX A;  4JZB A;  4JXY A;  2AET A;  5B0K A;  4NKF A;  3ZOU A;  3LLW A;  3DYF A;  4DWB A;  4EA2 A;  5IMP A;  4P0X A;  2F9K F;  5IK9 A;  3VJE A;  2FOR A;  3V1V A;  1RTR A;  1YJ4 A;  5A0I A;  5JV2 F;  1VG3 A;  3NPR A;  3W7F A;  2Z78 A;  3VJC A;  4LA5 A;  3M0G A;  3OYR A;  4KUX A;  3KRP B;  5AHU B;  4LLS A;  3SDR A;  1PS1 A;  5E8L A;  3V1X A;  5CG5 A;  3ZCD A;  1YQ7 A;  3LEE A;  3P5R A;  4MC3 A;  2E8V A;  3G4D A;  3PH7 A;  4N9U A;  4NFJ F;  3BNY A;  2VF6 A;  4MC0 A;  5IKH A;  3WCB A;  3WCH A;  4KVI A;  3WJO A;  2AZK A;  3SDT A;  3OAC B;  2J1P A;  3LZ9 A;  4P0V A;  4P0W A;  3CP6 A;  5CG6 A;  3TFV A;  3CKE A;  4LXW A;  2Z4X A;  3AQ0 A;  3AQB B;  3V66 A;  1VG7 A;  5HN9 A;  4KQ5 A;  4EA0 A;  5IKA A;  4RXA A;  3M00 A;  4XQR F;  2OGD A;  3ACY A;  3LSN A;  3ACW A;  3PYA A;  2QIS A;  2ZEV A;  4L2X F;  3KBK A;  4LUU A;  2Q58 A;  5B01 A;  3WC9 A;  5E8H A;  3AQC B;  2PS8 A;  4LPG F;  5IMI A;  5ILJ A;  1HX9 A;  4GP1 A;  3QQV A;  4QXS F;  5ERM A;  3AE0 A;  3DYH A;  5IMN A;  2AEL A;  2E8X A;  3WEF A;  4KPD A;  4GP2 A;  3WCA A; 
#chains in the Genus database with same CATH topology
 2Z7H A;  2J1O A;  4NG6 A;  4NKE A;  3S4J A;  3ICM A;  3TC1 A;  4NUA A;  2E91 A;  3WJN A;  3N6K F;  3ICZ A;  1YHK A;  4LFG A;  4LOB A;  3KRF B;  2H8O A;  3VJA A;  2PS6 A;  4RXC A;  4KKM A;  1YHM A;  1UBX A;  3VJ8 A;  4LLT A;  3ZMC A;  1JFA A;  3PKO A;  4Q23 A;  3N3L F;  3WEH A;  3ZL6 A;  1HXG A;  3N0F A;  3M9U A;  1HXA A;  5IK6 A;  1VG4 A;  3LMD A;  4LFV F;  3N5H F;  3N1W F;  3UCA A;  3ASX A;  2ONG A;  4E9Z A;  3WCG A;  1DGP A;  5JUZ F;  5DJP F;  4DHD A;  2E8W A;  5DGN F;  5I1U A;  5ER8 A;  4JZX A;  5B0L A;  1EZF A;  3N0G A;  2OPN A;  2E92 A;  4UMJ A;  5IL8 A;  5HNA A;  1YYS A;  2J5C A;  4DEM F;  2RAH A;  3N45 F;  2E4O A;  4ZQ8 A;  3WCC A;  3Q30 A;  2E94 A;  3TFN A;  3TS7 A;  4KQU A;  5IL3 A;  1WMW A;  4N1Z F;  2PS4 A;  5EAU A;  4KVD A;  3SDQ A;  3RBM A;  2ONH A;  2F7M F;  3WCD A;  5AFX A;  3LDW A;  3WCJ A;  4PVX F;  5EAS A;  3APZ A;  1HM4 A;  2AZJ A;  3WJK A;  2ZCS A;  2AEK A;  1YYR A;  3P41 A;  3WSA A;  3SAE A;  5B0I A;  3SDV A;  4DWG A;  5H9D A;  3QKC A;  4PVY F;  1RQI A;  2PS7 A;  5B00 A;  4JVJ F;  1N1Z A;  3KRA B;  2Z4W A;  1DI1 A;  3VJD A;  4RXE A;  2Z50 A;  3NRI A;  4KVY A;  5ILY A;  1V4K A;  4WK5 A;  3WEJ A;  3ICK A;  3B7L A;  3KRP A;  5AYP A;  3MZV A;  5DW7 A;  4LPH F;  4LIX A;  4K10 A;  2DH4 A;  4GAX A;  5IK0 A;  4KPJ A;  3WCM A;  3WSB A;  3LOM A;  1ZW5 A;  2Q80 A;  5DIQ F;  4LA6 A;  3OAC A;  5IN8 A;  2Q9Y A;  4LTZ A;  4RNQ A;  2E8U A;  3LJI A;  5ILI A;  2F94 F;  5DGS F;  4XQT F;  5DHI A;  1UBV A;  2AZL A;  3WCF A;  3KRO B;  2ZCQ A;  2Q9Z A;  2P1C A;  3ICN A;  5ILZ A;  1VG2 A;  4KK2 A;  3RYW A;  3IPI A;  4H5C F;  4H5E F;  1N24 A;  4FJQ A;  4NFK F;  1V4J A;  1FPS A;  5JA0 F;  1V4I A;  3WCI A;  3DYG A;  5B03 A;  4KQS A;  5B0J A;  3CC9 A;  2EWG A;  3EZ3 A;  4QPF A;  3SDU A;  4F6X A;  3KB9 A;  2F8C F;  5B0M A;  3Q2Q A;  1HM7 A;  5ERN A;  3N5J F;  2F8Z F;  5JV1 F;  1N22 A;  4KFA A;  4OGU A;  1WL1 A;  4NFI F;  5E8K A;  3WEG A;  3RMG A;  2Z4V A;  5DJR F;  5HN7 A;  3ADZ A;  3KRF A;  5DJV F;  1N1B A;  4OKM A;  1HXC A;  2FTZ A;  3OAB B;  3PDE A;  2Z4Z A;  3WEK A;  4JXN A;  3Q2Z A;  5KSX F;  3NPK A;  2E8T A;  4DZW A;  4F6V A;  3G4F A;  5ILH A;  4LZ0 A;  4KWD A;  1YV5 A;  3S9V A;  1KIY A;  4MC8 A;  4LZC A;  3VJ9 A;  3TFP A;  2ZEU A;  4FP4 A;  1WY0 A;  3WEI A;  4XQS F;  3PYB A;  1VG6 A;  3N46 F;  3ID0 A;  3LGK A;  3WCL A;  3OAB A;  3P8R A;  5ILK A;  2Z4Y A;  3M02 A;  4LZ3 A;  4OMH A;  5AEL A;  1V4E A;  1WKZ A;  4H5D F;  4LTV A;  3ZMB A;  1YYQ A;  4GA3 A;  5IM1 A;  3ACX A;  5ILD A;  5DHK A;  3P5P A;  3LGZ B;  5C05 A;  3N3D A;  3RYE A;  5ERO A;  5DGM F;  5B02 A;  1KIZ A;  4LFE A;  1UBW A;  4OMG A;  1WL2 A;  4F62 A;  3MAV A;  2O1O A;  3Q1O A;  5IVG A;  2Z52 A;  3KRC B;  2OPM A;  5JV0 F;  1YYT A;  1WL3 A;  4RYP A;  3LK5 A;  4E1E A;  5A0J A;  4DXJ A;  3KRA A;  2F92 F;  2I19 A;  4OKZ A;  1N23 A;  3WE9 A;  5DZ2 A;  1JFG A;  3EFQ A;  3LVS A;  3N1V F;  3P8L A;  4EA1 A;  3VJB A;  1N21 A;  3M01 A;  2PS5 A;  5EAT A;  2OA6 A;  5A0K A;  4DI5 A;  2E95 A;  1WL0 A;  4KVW A;  2Z7I A;  3N49 F;  3WCE A;  1UBY A;  4E9U A;  1RQJ A;  2ZCO A;  1V4H A;  3IBA A;  3KRC A;  5HN8 A;  2F89 F;  2ZY1 A;  1YYU A;  3LG5 A;  4RXD A;  3EGT A;  4JYX A;  3NF2 A;  4HD1 A;  1N20 A;  1YHL A;  2ZCR A;  2E90 A;  3KRO A;  2E93 A;  3BNX A;  4JZB A;  4JXY A;  2AET A;  5B0K A;  4NKF A;  3ZOU A;  3LLW A;  3DYF A;  4DWB A;  4EA2 A;  5IMP A;  4P0X A;  2F9K F;  5IK9 A;  3VJE A;  2FOR A;  3V1V A;  1RTR A;  1YJ4 A;  5A0I A;  5JV2 F;  1VG3 A;  3NPR A;  3W7F A;  2Z78 A;  3VJC A;  4LA5 A;  3M0G A;  3OYR A;  4KUX A;  3KRP B;  5AHU B;  4LLS A;  3SDR A;  1PS1 A;  5E8L A;  3V1X A;  5CG5 A;  3ZCD A;  1YQ7 A;  3LEE A;  3P5R A;  4MC3 A;  2E8V A;  3G4D A;  3PH7 A;  4N9U A;  4NFJ F;  3BNY A;  2VF6 A;  4MC0 A;  5IKH A;  3WCB A;  3WCH A;  4KVI A;  3WJO A;  2AZK A;  3SDT A;  3OAC B;  2J1P A;  3LZ9 A;  4P0V A;  4P0W A;  3CP6 A;  5CG6 A;  3TFV A;  3CKE A;  4LXW A;  2Z4X A;  3AQ0 A;  3AQB B;  3V66 A;  1VG7 A;  5HN9 A;  4KQ5 A;  4EA0 A;  5IKA A;  4RXA A;  3M00 A;  4XQR F;  2OGD A;  3ACY A;  3LSN A;  3ACW A;  3PYA A;  2QIS A;  2ZEV A;  4L2X F;  3KBK A;  4LUU A;  2Q58 A;  5B01 A;  3WC9 A;  5E8H A;  3AQC B;  2PS8 A;  4LPG F;  5IMI A;  5ILJ A;  1HX9 A;  4GP1 A;  3QQV A;  4QXS F;  5ERM A;  3AE0 A;  3DYH A;  5IMN A;  2AEL A;  2E8X A;  3WEF A;  4KPD A;  4GP2 A;  3WCA A; 
#chains in the Genus database with same CATH homology
 2Z7H A;  2J1O A;  4NG6 A;  4NKE A;  3S4J A;  3ICM A;  3TC1 A;  4NUA A;  2E91 A;  3WJN A;  3N6K F;  3ICZ A;  1YHK A;  4LFG A;  4LOB A;  3KRF B;  2H8O A;  3VJA A;  2PS6 A;  4RXC A;  4KKM A;  1YHM A;  1UBX A;  3VJ8 A;  4LLT A;  3ZMC A;  1JFA A;  3PKO A;  4Q23 A;  3N3L F;  3WEH A;  3ZL6 A;  1HXG A;  3N0F A;  3M9U A;  1HXA A;  5IK6 A;  1VG4 A;  3LMD A;  4LFV F;  3N5H F;  3N1W F;  3UCA A;  3ASX A;  2ONG A;  4E9Z A;  3WCG A;  1DGP A;  5JUZ F;  5DJP F;  4DHD A;  2E8W A;  5DGN F;  5I1U A;  5ER8 A;  4JZX A;  5B0L A;  1EZF A;  3N0G A;  2OPN A;  2E92 A;  4UMJ A;  5IL8 A;  5HNA A;  1YYS A;  2J5C A;  4DEM F;  2RAH A;  3N45 F;  2E4O A;  4ZQ8 A;  3WCC A;  3Q30 A;  2E94 A;  3TFN A;  3TS7 A;  4KQU A;  5IL3 A;  1WMW A;  4N1Z F;  2PS4 A;  5EAU A;  4KVD A;  3SDQ A;  3RBM A;  2ONH A;  2F7M F;  3WCD A;  5AFX A;  3LDW A;  3WCJ A;  4PVX F;  5EAS A;  3APZ A;  1HM4 A;  2AZJ A;  3WJK A;  2ZCS A;  2AEK A;  1YYR A;  3P41 A;  3WSA A;  3SAE A;  5B0I A;  3SDV A;  4DWG A;  5H9D A;  3QKC A;  4PVY F;  1RQI A;  2PS7 A;  5B00 A;  4JVJ F;  1N1Z A;  3KRA B;  2Z4W A;  1DI1 A;  3VJD A;  4RXE A;  2Z50 A;  3NRI A;  4KVY A;  5ILY A;  1V4K A;  4WK5 A;  3WEJ A;  3ICK A;  3B7L A;  3KRP A;  5AYP A;  3MZV A;  5DW7 A;  4LPH F;  4LIX A;  4K10 A;  2DH4 A;  4GAX A;  5IK0 A;  4KPJ A;  3WCM A;  3WSB A;  3LOM A;  1ZW5 A;  2Q80 A;  5DIQ F;  4LA6 A;  3OAC A;  5IN8 A;  2Q9Y A;  4LTZ A;  4RNQ A;  2E8U A;  3LJI A;  5ILI A;  2F94 F;  5DGS F;  4XQT F;  5DHI A;  1UBV A;  2AZL A;  3WCF A;  3KRO B;  2ZCQ A;  2Q9Z A;  2P1C A;  3ICN A;  5ILZ A;  1VG2 A;  4KK2 A;  3RYW A;  3IPI A;  4H5C F;  4H5E F;  1N24 A;  4FJQ A;  4NFK F;  1V4J A;  1FPS A;  5JA0 F;  1V4I A;  3WCI A;  3DYG A;  5B03 A;  4KQS A;  5B0J A;  3CC9 A;  2EWG A;  3EZ3 A;  4QPF A;  3SDU A;  4F6X A;  3KB9 A;  2F8C F;  5B0M A;  3Q2Q A;  1HM7 A;  5ERN A;  3N5J F;  2F8Z F;  5JV1 F;  1N22 A;  4KFA A;  4OGU A;  1WL1 A;  4NFI F;  5E8K A;  3WEG A;  3RMG A;  2Z4V A;  5DJR F;  5HN7 A;  3ADZ A;  3KRF A;  5DJV F;  1N1B A;  4OKM A;  1HXC A;  2FTZ A;  3OAB B;  3PDE A;  2Z4Z A;  3WEK A;  4JXN A;  3Q2Z A;  5KSX F;  3NPK A;  2E8T A;  4DZW A;  4F6V A;  3G4F A;  5ILH A;  4LZ0 A;  4KWD A;  1YV5 A;  3S9V A;  1KIY A;  4MC8 A;  4LZC A;  3VJ9 A;  3TFP A;  2ZEU A;  4FP4 A;  1WY0 A;  3WEI A;  4XQS F;  3PYB A;  1VG6 A;  3N46 F;  3ID0 A;  3LGK A;  3WCL A;  3OAB A;  3P8R A;  5ILK A;  2Z4Y A;  3M02 A;  4LZ3 A;  4OMH A;  5AEL A;  1V4E A;  1WKZ A;  4H5D F;  4LTV A;  3ZMB A;  1YYQ A;  4GA3 A;  5IM1 A;  3ACX A;  5ILD A;  5DHK A;  3P5P A;  3LGZ B;  5C05 A;  3N3D A;  3RYE A;  5ERO A;  5DGM F;  5B02 A;  1KIZ A;  4LFE A;  1UBW A;  4OMG A;  1WL2 A;  4F62 A;  3MAV A;  2O1O A;  3Q1O A;  5IVG A;  2Z52 A;  3KRC B;  2OPM A;  5JV0 F;  1YYT A;  1WL3 A;  4RYP A;  3LK5 A;  4E1E A;  5A0J A;  4DXJ A;  3KRA A;  2F92 F;  2I19 A;  4OKZ A;  1N23 A;  3WE9 A;  5DZ2 A;  1JFG A;  3EFQ A;  3LVS A;  3N1V F;  3P8L A;  4EA1 A;  3VJB A;  1N21 A;  3M01 A;  2PS5 A;  5EAT A;  2OA6 A;  5A0K A;  4DI5 A;  2E95 A;  1WL0 A;  4KVW A;  2Z7I A;  3N49 F;  3WCE A;  1UBY A;  4E9U A;  1RQJ A;  2ZCO A;  1V4H A;  3IBA A;  3KRC A;  5HN8 A;  2F89 F;  2ZY1 A;  1YYU A;  3LG5 A;  4RXD A;  3EGT A;  4JYX A;  3NF2 A;  4HD1 A;  1N20 A;  1YHL A;  2ZCR A;  2E90 A;  3KRO A;  2E93 A;  3BNX A;  4JZB A;  4JXY A;  2AET A;  5B0K A;  4NKF A;  3ZOU A;  3LLW A;  3DYF A;  4DWB A;  4EA2 A;  5IMP A;  4P0X A;  2F9K F;  5IK9 A;  3VJE A;  2FOR A;  3V1V A;  1RTR A;  1YJ4 A;  5A0I A;  5JV2 F;  1VG3 A;  3NPR A;  3W7F A;  2Z78 A;  3VJC A;  4LA5 A;  3M0G A;  3OYR A;  4KUX A;  3KRP B;  5AHU B;  4LLS A;  3SDR A;  1PS1 A;  5E8L A;  3V1X A;  5CG5 A;  3ZCD A;  1YQ7 A;  3LEE A;  3P5R A;  4MC3 A;  2E8V A;  3G4D A;  3PH7 A;  4N9U A;  4NFJ F;  3BNY A;  2VF6 A;  4MC0 A;  5IKH A;  3WCB A;  3WCH A;  4KVI A;  3WJO A;  2AZK A;  3SDT A;  3OAC B;  2J1P A;  3LZ9 A;  4P0V A;  4P0W A;  3CP6 A;  5CG6 A;  3TFV A;  3CKE A;  4LXW A;  2Z4X A;  3AQ0 A;  3AQB B;  3V66 A;  1VG7 A;  5HN9 A;  4KQ5 A;  4EA0 A;  5IKA A;  4RXA A;  3M00 A;  4XQR F;  2OGD A;  3ACY A;  3LSN A;  3ACW A;  3PYA A;  2QIS A;  2ZEV A;  4L2X F;  3KBK A;  4LUU A;  2Q58 A;  5B01 A;  3WC9 A;  5E8H A;  3AQC B;  2PS8 A;  4LPG F;  5IMI A;  5ILJ A;  1HX9 A;  4GP1 A;  3QQV A;  4QXS F;  5ERM A;  3AE0 A;  3DYH A;  5IMN A;  2AEL A;  2E8X A;  3WEF A;  4KPD A;  4GP2 A;  3WCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...