1RQIA

Active conformation of farnesyl pyrophosphate synthase bound to isopentyl pyrophosphate and dimethylallyl s-thiolodiphosphate
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
300
structure length
300
Chain Sequence
AMDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTLAFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLDAEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDDARQSLKQLAEQSLDTSALEALADYIIQRNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranyltranstransferase
publication title Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 128
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2003-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 1rqiA00
4GA3A 4OKZA 3EFQA 5IK0A 1VG3A 5HNAA 3Q2ZA 4KQSA 4KWDA 3CKEA 3M00A 1PS1A 1WL2A 3DYHA 3LZ9A 4KUXA 3N5JF 1RTRA 3M02A 1WMWA 1YJ4A 4JZXA 1WL1A 1YYQA 2I19A 3PYAA 1UBVA 3N0FA 3VJAA 4GAXA 3NPKA 4DZWA 5B02A 1VG7A 3BNXA 4NFJF 3WCCA 4RYPA 3N6KF 2Z4ZA 4NFKF 5DJRF 5JV0F 3MAVA 1DGPA 4OGUA 5DGMF 3N3LF 4H5DF 4LOBA 3G4DA 1YYTA 4LTVA 5IK9A 4E9ZA 2OPNA 4JYXA 5A0IA 5B03A 3LK5A 3VJ9A 3WCHA 4MC0A 4L2XF 2Q58A 3KRAB 2F94F 4LA5A 2Z4YA 5IK6A 3M9UA 5ILIA 1VG6A 5DGSF 5KSXF 4LPHF 3ZOUA 2EWGA 5IM1A 4RXCA 1WKZA 2F92F 3S9VA 5IMIA 1WY0A 3WEFA 3KRFA 4NUAA 1YYUA 2PS4A 4P0VA 3V66A 5ERNA 4LFEA 5CG6A 2RAHA 3WEGA 4KK2A 4XQRF 3QQVA 4KVIA 4MC3A 5DGNF 1UBWA 3P8RA 5AYPA 4DI5A 2E8UA 1HXGA 3DYGA 3WCGA 2Z4VA 4RNQA 5ILDA 1JFGA 3WEIA 1N24A 2FORA 4LZCA 2AELA 3N1VF 3VJBA 3KRCA 3AE0A 3NPRA 4KPJA 3KRFB 5JV2F 2F8ZF 3N49F 4EA2A 3PKOA 4HD1A 1VG4A 5HN9A 3QKCA 2Z4WA 3S4JA 3TFNA 2OA6A 3AQ0A 4NKFA 3LGKA 3OABA 4LPGF 3KRCB 3N5HF 1RQIA 5EAUA 3LLWA 5CG5A 3WCIA 3WEKA 4QXSF 4JZBA 5HN8A 3LG5A 3PYBA 4GP1A 1HXAA 1V4HA 4OMGA 4XQTF 3KRPB 4KVDA 2F89F 3LMDA 1YV5A 3Q30A 5ILHA 1YYRA 3OYRA 4LZ0A 3ADZA 4H5CF 5DHIA 3BNYA 3N3DA 3Q2QA 3OABB 4DEMF 3WCLA 4LLTA 4N1ZF 3WCBA 4XQSF 5B0MA 5E8KA 1DI1A 4FJQA 3N46F 4MC8A 4RXAA 3KROA 2PS8A 4QPFA 5ILKA 5DW7A 3G4FA 1N23A 3SDRA 3ICZA 5DHKA 3RBMA 4DXJA 4E1EA 4DWGA 4KVYA 5IKAA 5H9DA 3TFPA 3SDQA 5E8LA 3N0GA 4LFGA 4ZQ8A 3VJ8A 4Q23A 1HM4A 1YHMA 3TFVA 2DH4A 3LVSA 2Z7HA 5A0KA 3SDVA 3TC1A 3VJDA 2Q9ZA 3IPIA 3ICKA 3EZ3A 2Z7IA 4UMJA 2AZLA 3B7LA 1HXCA 2J5CA 3M0GA 5EASA 3WC9A 4LTZA 3WEJA 4RXDA 1YHLA 2J1OA 5IN8A 4N9UA 4F62A 3OACA 2Z52A 5ER8A 3WJOA 2F7MF 1HX9A 2E93A 4KVWA 4OKMA 3ZMBA 1YYSA 5HN7A 4LFVF 2AEKA 3KBKA 5DJPF 5B01A 2E8XA 2J1PA 4P0XA 2P1CA 3TS7A 3WE9A 1WL3A 2Q9YA 2O1OA 4EA1A 3VJEA 3PH7A 3LDWA 3MZVA 5A0JA 4JXNA 2E94A 3ICNA 2AZJA 5AELA 5EATA 3ACYA 3RMGA 5B0KA 1YQ7A 1EZFA 5IMPA 5EROA 3SDTA 3SDUA 4JVJF 3WCFA 2ZCQA 2E91A 2PS7A 3AQCB 1YHKA 3LEEA 4LZ3A 1V4KA 3NRIA 3LGZB 1FPSA 3IBAA 3WEHA 4KKMA 4GP2A 1V4JA 5IL8A 1V4IA 2E8VA 3ZCDA 2E95A 3ACWA 3ZMCA 3WSAA 4KPDA 4NG6A 2E4OA 1WL0A 4E9UA 3LJIA 3WJKA 5ILZA 5IVGA 5I1UA 5E8HA 2OPMA 3RYWA 1JFAA 3N1WF 3W7FA 5DJVF 2FTZA 5B0JA 4DHDA 4RXEA 1RQJA 5DIQF 3P5RA 3VJCA 3CC9A 2F9KF 3ACXA 3KRAA 2QISA 3WCAA 5B0IA 2Z50A 3NF2A 1N22A 4NFIF 5IKHA 5IMNA 1HM7A 1V4EA 4KQ5A 2ZEUA 4WK5A 4F6XA 2E8WA 2ZY1A 2F8CF 3V1XA 3WCMA 3KROB 3KB9A 3ID0A 2ZCRA 5ILYA 4P0WA 4LA6A 4KQUA 5IL3A 2E92A 5B0LA 3RYEA 4PVYF 5ERMA 3LOMA 3CP6A 5AHUB 5JV1F 5ILJA 3P5PA 4K10A 4KFAA 4JXYA 5AFXA 3WCDA 3P41A 2AZKA 4PVXF 4LIXA 1N1ZA 2PS5A 2ONGA 1N20A 2VF6A 4OMHA 3Q1OA 1KIZA 2ZCOA 4H5EF 2E90A 3EGTA 4LLSA 2H8OA 3LSNA 3ICMA 1N21A 3ASXA 3V1VA 4LXWA 4NKEA 3OACB 3WCJA 5DZ2A 1N1BA 2ZEVA 2Z78A 4FP4A 5JA0F 3AQBB 4F6VA 1VG2A 5C05A 3APZA 4DWBA 2Q80A 2Z4XA 3WCEA 3KRPA 3N45F 3WJNA 1KIYA 5B00A 4EA0A 3UCAA 2PS6A 5JUZF 2OGDA 2AETA 3PDEA 1UBXA 1ZW5A 3ZL6A 3DYFA 3WSBA 2E8TA 2ZCSA 1UBYA 2ONHA 3SAEA 3M01A 3P8LA 4LUUA
chains in the Genus database with same CATH superfamily
4GA3A 4OKZA 3EFQA 5IK0A 1VG3A 5HNAA 3Q2ZA 4KQSA 4KWDA 3CKEA 3M00A 1PS1A 1WL2A 3DYHA 3LZ9A 4KUXA 3N5JF 1RTRA 3M02A 1WMWA 1YJ4A 4JZXA 1WL1A 1YYQA 2I19A 3PYAA 1UBVA 3N0FA 3VJAA 4GAXA 3NPKA 4DZWA 5B02A 1VG7A 3BNXA 4NFJF 3WCCA 4RYPA 3N6KF 2Z4ZA 4NFKF 5DJRF 5JV0F 3MAVA 1DGPA 4OGUA 5DGMF 3N3LF 4H5DF 4LOBA 3G4DA 1YYTA 4LTVA 5IK9A 4E9ZA 2OPNA 4JYXA 5A0IA 5B03A 3LK5A 3VJ9A 3WCHA 4MC0A 4L2XF 2Q58A 3KRAB 2F94F 4LA5A 2Z4YA 5IK6A 3M9UA 5ILIA 1VG6A 5DGSF 5KSXF 4LPHF 3ZOUA 2EWGA 5IM1A 4RXCA 1WKZA 2F92F 3S9VA 5IMIA 1WY0A 3WEFA 3KRFA 4NUAA 1YYUA 2PS4A 4P0VA 3V66A 5ERNA 4LFEA 5CG6A 2RAHA 3WEGA 4KK2A 4XQRF 3QQVA 4KVIA 4MC3A 5DGNF 1UBWA 3P8RA 5AYPA 4DI5A 2E8UA 1HXGA 3DYGA 3WCGA 2Z4VA 4RNQA 5ILDA 1JFGA 3WEIA 1N24A 2FORA 4LZCA 2AELA 3N1VF 3VJBA 3KRCA 3AE0A 3NPRA 4KPJA 3KRFB 5JV2F 2F8ZF 3N49F 4EA2A 3PKOA 4HD1A 1VG4A 5HN9A 3QKCA 2Z4WA 3S4JA 3TFNA 2OA6A 3AQ0A 4NKFA 3LGKA 3OABA 4LPGF 3KRCB 3N5HF 1RQIA 5EAUA 3LLWA 5CG5A 3WCIA 3WEKA 4QXSF 4JZBA 5HN8A 3LG5A 3PYBA 4GP1A 1HXAA 1V4HA 4OMGA 4XQTF 3KRPB 4KVDA 2F89F 3LMDA 1YV5A 3Q30A 5ILHA 1YYRA 3OYRA 4LZ0A 3ADZA 4H5CF 5DHIA 3BNYA 3N3DA 3Q2QA 3OABB 4DEMF 3WCLA 4LLTA 4N1ZF 3WCBA 4XQSF 5B0MA 5E8KA 1DI1A 4FJQA 3N46F 4MC8A 4RXAA 3KROA 2PS8A 4QPFA 5ILKA 5DW7A 3G4FA 1N23A 3SDRA 3ICZA 5DHKA 3RBMA 4DXJA 4E1EA 4DWGA 4KVYA 5IKAA 5H9DA 3TFPA 3SDQA 5E8LA 3N0GA 4LFGA 4ZQ8A 3VJ8A 4Q23A 1HM4A 1YHMA 3TFVA 2DH4A 3LVSA 2Z7HA 5A0KA 3SDVA 3TC1A 3VJDA 2Q9ZA 3IPIA 3ICKA 3EZ3A 2Z7IA 4UMJA 2AZLA 3B7LA 1HXCA 2J5CA 3M0GA 5EASA 3WC9A 4LTZA 3WEJA 4RXDA 1YHLA 2J1OA 5IN8A 4N9UA 4F62A 3OACA 2Z52A 5ER8A 3WJOA 2F7MF 1HX9A 2E93A 4KVWA 4OKMA 3ZMBA 1YYSA 5HN7A 4LFVF 2AEKA 3KBKA 5DJPF 5B01A 2E8XA 2J1PA 4P0XA 2P1CA 3TS7A 3WE9A 1WL3A 2Q9YA 2O1OA 4EA1A 3VJEA 3PH7A 3LDWA 3MZVA 5A0JA 4JXNA 2E94A 3ICNA 2AZJA 5AELA 5EATA 3ACYA 3RMGA 5B0KA 1YQ7A 1EZFA 5IMPA 5EROA 3SDTA 3SDUA 4JVJF 3WCFA 2ZCQA 2E91A 2PS7A 3AQCB 1YHKA 3LEEA 4LZ3A 1V4KA 3NRIA 3LGZB 1FPSA 3IBAA 3WEHA 4KKMA 4GP2A 1V4JA 5IL8A 1V4IA 2E8VA 3ZCDA 2E95A 3ACWA 3ZMCA 3WSAA 4KPDA 4NG6A 2E4OA 1WL0A 4E9UA 3LJIA 3WJKA 5ILZA 5IVGA 5I1UA 5E8HA 2OPMA 3RYWA 1JFAA 3N1WF 3W7FA 5DJVF 2FTZA 5B0JA 4DHDA 4RXEA 1RQJA 5DIQF 3P5RA 3VJCA 3CC9A 2F9KF 3ACXA 3KRAA 2QISA 3WCAA 5B0IA 2Z50A 3NF2A 1N22A 4NFIF 5IKHA 5IMNA 1HM7A 1V4EA 4KQ5A 2ZEUA 4WK5A 4F6XA 2E8WA 2ZY1A 2F8CF 3V1XA 3WCMA 3KROB 3KB9A 3ID0A 2ZCRA 5ILYA 4P0WA 4LA6A 4KQUA 5IL3A 2E92A 5B0LA 3RYEA 4PVYF 5ERMA 3LOMA 3CP6A 5AHUB 5JV1F 5ILJA 3P5PA 4K10A 4KFAA 4JXYA 5AFXA 3WCDA 3P41A 2AZKA 4PVXF 4LIXA 1N1ZA 2PS5A 2ONGA 1N20A 2VF6A 4OMHA 3Q1OA 1KIZA 2ZCOA 4H5EF 2E90A 3EGTA 4LLSA 2H8OA 3LSNA 3ICMA 1N21A 3ASXA 3V1VA 4LXWA 4NKEA 3OACB 3WCJA 5DZ2A 1N1BA 2ZEVA 2Z78A 4FP4A 5JA0F 3AQBB 4F6VA 1VG2A 5C05A 3APZA 4DWBA 2Q80A 2Z4XA 3WCEA 3KRPA 3N45F 3WJNA 1KIYA 5B00A 4EA0A 3UCAA 2PS6A 5JUZF 2OGDA 2AETA 3PDEA 1UBXA 1ZW5A 3ZL6A 3DYFA 3WSBA 2E8TA 2ZCSA 1UBYA 2ONHA 3SAEA 3M01A 3P8LA 4LUUA
chains in the Genus database with same CATH topology
4GA3A 4OKZA 3EFQA 5IK0A 1VG3A 5HNAA 3Q2ZA 4KQSA 4KWDA 3CKEA 3M00A 1PS1A 1WL2A 3DYHA 3LZ9A 4KUXA 3N5JF 1RTRA 3M02A 1WMWA 1YJ4A 4JZXA 1WL1A 1YYQA 2I19A 3PYAA 1UBVA 3N0FA 3VJAA 4GAXA 3NPKA 4DZWA 5B02A 1VG7A 3BNXA 4NFJF 3WCCA 4RYPA 3N6KF 2Z4ZA 4NFKF 5DJRF 5JV0F 3MAVA 1DGPA 4OGUA 5DGMF 3N3LF 4H5DF 4LOBA 3G4DA 1YYTA 4LTVA 5IK9A 4E9ZA 2OPNA 4JYXA 5A0IA 5B03A 3LK5A 3VJ9A 3WCHA 4MC0A 4L2XF 2Q58A 3KRAB 2F94F 4LA5A 2Z4YA 5IK6A 3M9UA 5ILIA 1VG6A 5DGSF 5KSXF 4LPHF 3ZOUA 2EWGA 5IM1A 4RXCA 1WKZA 2F92F 3S9VA 5IMIA 1WY0A 3WEFA 3KRFA 4NUAA 1YYUA 2PS4A 4P0VA 3V66A 5ERNA 4LFEA 5CG6A 2RAHA 3WEGA 4KK2A 4XQRF 3QQVA 4KVIA 4MC3A 5DGNF 1UBWA 3P8RA 5AYPA 4DI5A 2E8UA 1HXGA 3DYGA 3WCGA 2Z4VA 4RNQA 5ILDA 1JFGA 3WEIA 1N24A 2FORA 4LZCA 2AELA 3N1VF 3VJBA 3KRCA 3AE0A 3NPRA 4KPJA 3KRFB 5JV2F 2F8ZF 3N49F 4EA2A 3PKOA 4HD1A 1VG4A 5HN9A 3QKCA 2Z4WA 3S4JA 3TFNA 2OA6A 3AQ0A 4NKFA 3LGKA 3OABA 4LPGF 3KRCB 3N5HF 1RQIA 5EAUA 3LLWA 5CG5A 3WCIA 3WEKA 4QXSF 4JZBA 5HN8A 3LG5A 3PYBA 4GP1A 1HXAA 1V4HA 4OMGA 4XQTF 3KRPB 4KVDA 2F89F 3LMDA 1YV5A 3Q30A 5ILHA 1YYRA 3OYRA 4LZ0A 3ADZA 4H5CF 5DHIA 3BNYA 3N3DA 3Q2QA 3OABB 4DEMF 3WCLA 4LLTA 4N1ZF 3WCBA 4XQSF 5B0MA 5E8KA 1DI1A 4FJQA 3N46F 4MC8A 4RXAA 3KROA 2PS8A 4QPFA 5ILKA 5DW7A 3G4FA 1N23A 3SDRA 3ICZA 5DHKA 3RBMA 4DXJA 4E1EA 4DWGA 4KVYA 5IKAA 5H9DA 3TFPA 3SDQA 5E8LA 3N0GA 4LFGA 4ZQ8A 3VJ8A 4Q23A 1HM4A 1YHMA 3TFVA 2DH4A 3LVSA 2Z7HA 5A0KA 3SDVA 3TC1A 3VJDA 2Q9ZA 3IPIA 3ICKA 3EZ3A 2Z7IA 4UMJA 2AZLA 3B7LA 1HXCA 2J5CA 3M0GA 5EASA 3WC9A 4LTZA 3WEJA 4RXDA 1YHLA 2J1OA 5IN8A 4N9UA 4F62A 3OACA 2Z52A 5ER8A 3WJOA 2F7MF 1HX9A 2E93A 4KVWA 4OKMA 3ZMBA 1YYSA 5HN7A 4LFVF 2AEKA 3KBKA 5DJPF 5B01A 2E8XA 2J1PA 4P0XA 2P1CA 3TS7A 3WE9A 1WL3A 2Q9YA 2O1OA 4EA1A 3VJEA 3PH7A 3LDWA 3MZVA 5A0JA 4JXNA 2E94A 3ICNA 2AZJA 5AELA 5EATA 3ACYA 3RMGA 5B0KA 1YQ7A 1EZFA 5IMPA 5EROA 3SDTA 3SDUA 4JVJF 3WCFA 2ZCQA 2E91A 2PS7A 3AQCB 1YHKA 3LEEA 4LZ3A 1V4KA 3NRIA 3LGZB 1FPSA 3IBAA 3WEHA 4KKMA 4GP2A 1V4JA 5IL8A 1V4IA 2E8VA 3ZCDA 2E95A 3ACWA 3ZMCA 3WSAA 4KPDA 4NG6A 2E4OA 1WL0A 4E9UA 3LJIA 3WJKA 5ILZA 5IVGA 5I1UA 5E8HA 2OPMA 3RYWA 1JFAA 3N1WF 3W7FA 5DJVF 2FTZA 5B0JA 4DHDA 4RXEA 1RQJA 5DIQF 3P5RA 3VJCA 3CC9A 2F9KF 3ACXA 3KRAA 2QISA 3WCAA 5B0IA 2Z50A 3NF2A 1N22A 4NFIF 5IKHA 5IMNA 1HM7A 1V4EA 4KQ5A 2ZEUA 4WK5A 4F6XA 2E8WA 2ZY1A 2F8CF 3V1XA 3WCMA 3KROB 3KB9A 3ID0A 2ZCRA 5ILYA 4P0WA 4LA6A 4KQUA 5IL3A 2E92A 5B0LA 3RYEA 4PVYF 5ERMA 3LOMA 3CP6A 5AHUB 5JV1F 5ILJA 3P5PA 4K10A 4KFAA 4JXYA 5AFXA 3WCDA 3P41A 2AZKA 4PVXF 4LIXA 1N1ZA 2PS5A 2ONGA 1N20A 2VF6A 4OMHA 3Q1OA 1KIZA 2ZCOA 4H5EF 2E90A 3EGTA 4LLSA 2H8OA 3LSNA 3ICMA 1N21A 3ASXA 3V1VA 4LXWA 4NKEA 3OACB 3WCJA 5DZ2A 1N1BA 2ZEVA 2Z78A 4FP4A 5JA0F 3AQBB 4F6VA 1VG2A 5C05A 3APZA 4DWBA 2Q80A 2Z4XA 3WCEA 3KRPA 3N45F 3WJNA 1KIYA 5B00A 4EA0A 3UCAA 2PS6A 5JUZF 2OGDA 2AETA 3PDEA 1UBXA 1ZW5A 3ZL6A 3DYFA 3WSBA 2E8TA 2ZCSA 1UBYA 2ONHA 3SAEA 3M01A 3P8LA 4LUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GA3 A;  4OKZ A;  3EFQ A;  5IK0 A;  1VG3 A;  5HNA A;  3Q2Z A;  4KQS A;  4KWD A;  3CKE A;  3M00 A;  1PS1 A;  1WL2 A;  3DYH A;  3LZ9 A;  4KUX A;  3N5J F;  1RTR A;  3M02 A;  1WMW A;  1YJ4 A;  4JZX A;  1WL1 A;  1YYQ A;  2I19 A;  3PYA A;  1UBV A;  3N0F A;  3VJA A;  4GAX A;  3NPK A;  4DZW A;  5B02 A;  1VG7 A;  3BNX A;  4NFJ F;  3WCC A;  4RYP A;  3N6K F;  2Z4Z A;  4NFK F;  5DJR F;  5JV0 F;  3MAV A;  1DGP A;  4OGU A;  5DGM F;  3N3L F;  4H5D F;  4LOB A;  3G4D A;  1YYT A;  4LTV A;  5IK9 A;  4E9Z A;  2OPN A;  4JYX A;  5A0I A;  5B03 A;  3LK5 A;  3VJ9 A;  3WCH A;  4MC0 A;  4L2X F;  2Q58 A;  3KRA B;  2F94 F;  4LA5 A;  2Z4Y A;  5IK6 A;  3M9U A;  5ILI A;  1VG6 A;  5DGS F;  5KSX F;  4LPH F;  3ZOU A;  2EWG A;  5IM1 A;  4RXC A;  1WKZ A;  2F92 F;  3S9V A;  5IMI A;  1WY0 A;  3WEF A;  3KRF A;  4NUA A;  1YYU A;  2PS4 A;  4P0V A;  3V66 A;  5ERN A;  4LFE A;  5CG6 A;  2RAH A;  3WEG A;  4KK2 A;  4XQR F;  3QQV A;  4KVI A;  4MC3 A;  5DGN F;  1UBW A;  3P8R A;  5AYP A;  4DI5 A;  2E8U A;  1HXG A;  3DYG A;  3WCG A;  2Z4V A;  4RNQ A;  5ILD A;  1JFG A;  3WEI A;  1N24 A;  2FOR A;  4LZC A;  2AEL A;  3N1V F;  3VJB A;  3KRC A;  3AE0 A;  3NPR A;  4KPJ A;  3KRF B;  5JV2 F;  2F8Z F;  3N49 F;  4EA2 A;  3PKO A;  4HD1 A;  1VG4 A;  5HN9 A;  3QKC A;  2Z4W A;  3S4J A;  3TFN A;  2OA6 A;  3AQ0 A;  4NKF A;  3LGK A;  3OAB A;  4LPG F;  3KRC B;  3N5H F;  1RQI A;  5EAU A;  3LLW A;  5CG5 A;  3WCI A;  3WEK A;  4QXS F;  4JZB A;  5HN8 A;  3LG5 A;  3PYB A;  4GP1 A;  1HXA A;  1V4H A;  4OMG A;  4XQT F;  3KRP B;  4KVD A;  2F89 F;  3LMD A;  1YV5 A;  3Q30 A;  5ILH A;  1YYR A;  3OYR A;  4LZ0 A;  3ADZ A;  4H5C F;  5DHI A;  3BNY A;  3N3D A;  3Q2Q A;  3OAB B;  4DEM F;  3WCL A;  4LLT A;  4N1Z F;  3WCB A;  4XQS F;  5B0M A;  5E8K A;  1DI1 A;  4FJQ A;  3N46 F;  4MC8 A;  4RXA A;  3KRO A;  2PS8 A;  4QPF A;  5ILK A;  5DW7 A;  3G4F A;  1N23 A;  3SDR A;  3ICZ A;  5DHK A;  3RBM A;  4DXJ A;  4E1E A;  4DWG A;  4KVY A;  5IKA A;  5H9D A;  3TFP A;  3SDQ A;  5E8L A;  3N0G A;  4LFG A;  4ZQ8 A;  3VJ8 A;  4Q23 A;  1HM4 A;  1YHM A;  3TFV A;  2DH4 A;  3LVS A;  2Z7H A;  5A0K A;  3SDV A;  3TC1 A;  3VJD A;  2Q9Z A;  3IPI A;  3ICK A;  3EZ3 A;  2Z7I A;  4UMJ A;  2AZL A;  3B7L A;  1HXC A;  2J5C A;  3M0G A;  5EAS A;  3WC9 A;  4LTZ A;  3WEJ A;  4RXD A;  1YHL A;  2J1O A;  5IN8 A;  4N9U A;  4F62 A;  3OAC A;  2Z52 A;  5ER8 A;  3WJO A;  2F7M F;  1HX9 A;  2E93 A;  4KVW A;  4OKM A;  3ZMB A;  1YYS A;  5HN7 A;  4LFV F;  2AEK A;  3KBK A;  5DJP F;  5B01 A;  2E8X A;  2J1P A;  4P0X A;  2P1C A;  3TS7 A;  3WE9 A;  1WL3 A;  2Q9Y A;  2O1O A;  4EA1 A;  3VJE A;  3PH7 A;  3LDW A;  3MZV A;  5A0J A;  4JXN A;  2E94 A;  3ICN A;  2AZJ A;  5AEL A;  5EAT A;  3ACY A;  3RMG A;  5B0K A;  1YQ7 A;  1EZF A;  5IMP A;  5ERO A;  3SDT A;  3SDU A;  4JVJ F;  3WCF A;  2ZCQ A;  2E91 A;  2PS7 A;  3AQC B;  1YHK A;  3LEE A;  4LZ3 A;  1V4K A;  3NRI A;  3LGZ B;  1FPS A;  3IBA A;  3WEH A;  4KKM A;  4GP2 A;  1V4J A;  5IL8 A;  1V4I A;  2E8V A;  3ZCD A;  2E95 A;  3ACW A;  3ZMC A;  3WSA A;  4KPD A;  4NG6 A;  2E4O A;  1WL0 A;  4E9U A;  3LJI A;  3WJK A;  5ILZ A;  5IVG A;  5I1U A;  5E8H A;  2OPM A;  3RYW A;  1JFA A;  3N1W F;  3W7F A;  5DJV F;  2FTZ A;  5B0J A;  4DHD A;  4RXE A;  1RQJ A;  5DIQ F;  3P5R A;  3VJC A;  3CC9 A;  2F9K F;  3ACX A;  3KRA A;  2QIS A;  3WCA A;  5B0I A;  2Z50 A;  3NF2 A;  1N22 A;  4NFI F;  5IKH A;  5IMN A;  1HM7 A;  1V4E A;  4KQ5 A;  2ZEU A;  4WK5 A;  4F6X A;  2E8W A;  2ZY1 A;  2F8C F;  3V1X A;  3WCM A;  3KRO B;  3KB9 A;  3ID0 A;  2ZCR A;  5ILY A;  4P0W A;  4LA6 A;  4KQU A;  5IL3 A;  2E92 A;  5B0L A;  3RYE A;  4PVY F;  5ERM A;  3LOM A;  3CP6 A;  5AHU B;  5JV1 F;  5ILJ A;  3P5P A;  4K10 A;  4KFA A;  4JXY A;  5AFX A;  3WCD A;  3P41 A;  2AZK A;  4PVX F;  4LIX A;  1N1Z A;  2PS5 A;  2ONG A;  1N20 A;  2VF6 A;  4OMH A;  3Q1O A;  1KIZ A;  2ZCO A;  4H5E F;  2E90 A;  3EGT A;  4LLS A;  2H8O A;  3LSN A;  3ICM A;  1N21 A;  3ASX A;  3V1V A;  4LXW A;  4NKE A;  3OAC B;  3WCJ A;  5DZ2 A;  1N1B A;  2ZEV A;  2Z78 A;  4FP4 A;  5JA0 F;  3AQB B;  4F6V A;  1VG2 A;  5C05 A;  3APZ A;  4DWB A;  2Q80 A;  2Z4X A;  3WCE A;  3KRP A;  3N45 F;  3WJN A;  1KIY A;  5B00 A;  4EA0 A;  3UCA A;  2PS6 A;  5JUZ F;  2OGD A;  2AET A;  3PDE A;  1UBX A;  1ZW5 A;  3ZL6 A;  3DYF A;  3WSB A;  2E8T A;  2ZCS A;  1UBY A;  2ONH A;  3SAE A;  3M01 A;  3P8L A;  4LUU A; 
#chains in the Genus database with same CATH topology
 4GA3 A;  4OKZ A;  3EFQ A;  5IK0 A;  1VG3 A;  5HNA A;  3Q2Z A;  4KQS A;  4KWD A;  3CKE A;  3M00 A;  1PS1 A;  1WL2 A;  3DYH A;  3LZ9 A;  4KUX A;  3N5J F;  1RTR A;  3M02 A;  1WMW A;  1YJ4 A;  4JZX A;  1WL1 A;  1YYQ A;  2I19 A;  3PYA A;  1UBV A;  3N0F A;  3VJA A;  4GAX A;  3NPK A;  4DZW A;  5B02 A;  1VG7 A;  3BNX A;  4NFJ F;  3WCC A;  4RYP A;  3N6K F;  2Z4Z A;  4NFK F;  5DJR F;  5JV0 F;  3MAV A;  1DGP A;  4OGU A;  5DGM F;  3N3L F;  4H5D F;  4LOB A;  3G4D A;  1YYT A;  4LTV A;  5IK9 A;  4E9Z A;  2OPN A;  4JYX A;  5A0I A;  5B03 A;  3LK5 A;  3VJ9 A;  3WCH A;  4MC0 A;  4L2X F;  2Q58 A;  3KRA B;  2F94 F;  4LA5 A;  2Z4Y A;  5IK6 A;  3M9U A;  5ILI A;  1VG6 A;  5DGS F;  5KSX F;  4LPH F;  3ZOU A;  2EWG A;  5IM1 A;  4RXC A;  1WKZ A;  2F92 F;  3S9V A;  5IMI A;  1WY0 A;  3WEF A;  3KRF A;  4NUA A;  1YYU A;  2PS4 A;  4P0V A;  3V66 A;  5ERN A;  4LFE A;  5CG6 A;  2RAH A;  3WEG A;  4KK2 A;  4XQR F;  3QQV A;  4KVI A;  4MC3 A;  5DGN F;  1UBW A;  3P8R A;  5AYP A;  4DI5 A;  2E8U A;  1HXG A;  3DYG A;  3WCG A;  2Z4V A;  4RNQ A;  5ILD A;  1JFG A;  3WEI A;  1N24 A;  2FOR A;  4LZC A;  2AEL A;  3N1V F;  3VJB A;  3KRC A;  3AE0 A;  3NPR A;  4KPJ A;  3KRF B;  5JV2 F;  2F8Z F;  3N49 F;  4EA2 A;  3PKO A;  4HD1 A;  1VG4 A;  5HN9 A;  3QKC A;  2Z4W A;  3S4J A;  3TFN A;  2OA6 A;  3AQ0 A;  4NKF A;  3LGK A;  3OAB A;  4LPG F;  3KRC B;  3N5H F;  1RQI A;  5EAU A;  3LLW A;  5CG5 A;  3WCI A;  3WEK A;  4QXS F;  4JZB A;  5HN8 A;  3LG5 A;  3PYB A;  4GP1 A;  1HXA A;  1V4H A;  4OMG A;  4XQT F;  3KRP B;  4KVD A;  2F89 F;  3LMD A;  1YV5 A;  3Q30 A;  5ILH A;  1YYR A;  3OYR A;  4LZ0 A;  3ADZ A;  4H5C F;  5DHI A;  3BNY A;  3N3D A;  3Q2Q A;  3OAB B;  4DEM F;  3WCL A;  4LLT A;  4N1Z F;  3WCB A;  4XQS F;  5B0M A;  5E8K A;  1DI1 A;  4FJQ A;  3N46 F;  4MC8 A;  4RXA A;  3KRO A;  2PS8 A;  4QPF A;  5ILK A;  5DW7 A;  3G4F A;  1N23 A;  3SDR A;  3ICZ A;  5DHK A;  3RBM A;  4DXJ A;  4E1E A;  4DWG A;  4KVY A;  5IKA A;  5H9D A;  3TFP A;  3SDQ A;  5E8L A;  3N0G A;  4LFG A;  4ZQ8 A;  3VJ8 A;  4Q23 A;  1HM4 A;  1YHM A;  3TFV A;  2DH4 A;  3LVS A;  2Z7H A;  5A0K A;  3SDV A;  3TC1 A;  3VJD A;  2Q9Z A;  3IPI A;  3ICK A;  3EZ3 A;  2Z7I A;  4UMJ A;  2AZL A;  3B7L A;  1HXC A;  2J5C A;  3M0G A;  5EAS A;  3WC9 A;  4LTZ A;  3WEJ A;  4RXD A;  1YHL A;  2J1O A;  5IN8 A;  4N9U A;  4F62 A;  3OAC A;  2Z52 A;  5ER8 A;  3WJO A;  2F7M F;  1HX9 A;  2E93 A;  4KVW A;  4OKM A;  3ZMB A;  1YYS A;  5HN7 A;  4LFV F;  2AEK A;  3KBK A;  5DJP F;  5B01 A;  2E8X A;  2J1P A;  4P0X A;  2P1C A;  3TS7 A;  3WE9 A;  1WL3 A;  2Q9Y A;  2O1O A;  4EA1 A;  3VJE A;  3PH7 A;  3LDW A;  3MZV A;  5A0J A;  4JXN A;  2E94 A;  3ICN A;  2AZJ A;  5AEL A;  5EAT A;  3ACY A;  3RMG A;  5B0K A;  1YQ7 A;  1EZF A;  5IMP A;  5ERO A;  3SDT A;  3SDU A;  4JVJ F;  3WCF A;  2ZCQ A;  2E91 A;  2PS7 A;  3AQC B;  1YHK A;  3LEE A;  4LZ3 A;  1V4K A;  3NRI A;  3LGZ B;  1FPS A;  3IBA A;  3WEH A;  4KKM A;  4GP2 A;  1V4J A;  5IL8 A;  1V4I A;  2E8V A;  3ZCD A;  2E95 A;  3ACW A;  3ZMC A;  3WSA A;  4KPD A;  4NG6 A;  2E4O A;  1WL0 A;  4E9U A;  3LJI A;  3WJK A;  5ILZ A;  5IVG A;  5I1U A;  5E8H A;  2OPM A;  3RYW A;  1JFA A;  3N1W F;  3W7F A;  5DJV F;  2FTZ A;  5B0J A;  4DHD A;  4RXE A;  1RQJ A;  5DIQ F;  3P5R A;  3VJC A;  3CC9 A;  2F9K F;  3ACX A;  3KRA A;  2QIS A;  3WCA A;  5B0I A;  2Z50 A;  3NF2 A;  1N22 A;  4NFI F;  5IKH A;  5IMN A;  1HM7 A;  1V4E A;  4KQ5 A;  2ZEU A;  4WK5 A;  4F6X A;  2E8W A;  2ZY1 A;  2F8C F;  3V1X A;  3WCM A;  3KRO B;  3KB9 A;  3ID0 A;  2ZCR A;  5ILY A;  4P0W A;  4LA6 A;  4KQU A;  5IL3 A;  2E92 A;  5B0L A;  3RYE A;  4PVY F;  5ERM A;  3LOM A;  3CP6 A;  5AHU B;  5JV1 F;  5ILJ A;  3P5P A;  4K10 A;  4KFA A;  4JXY A;  5AFX A;  3WCD A;  3P41 A;  2AZK A;  4PVX F;  4LIX A;  1N1Z A;  2PS5 A;  2ONG A;  1N20 A;  2VF6 A;  4OMH A;  3Q1O A;  1KIZ A;  2ZCO A;  4H5E F;  2E90 A;  3EGT A;  4LLS A;  2H8O A;  3LSN A;  3ICM A;  1N21 A;  3ASX A;  3V1V A;  4LXW A;  4NKE A;  3OAC B;  3WCJ A;  5DZ2 A;  1N1B A;  2ZEV A;  2Z78 A;  4FP4 A;  5JA0 F;  3AQB B;  4F6V A;  1VG2 A;  5C05 A;  3APZ A;  4DWB A;  2Q80 A;  2Z4X A;  3WCE A;  3KRP A;  3N45 F;  3WJN A;  1KIY A;  5B00 A;  4EA0 A;  3UCA A;  2PS6 A;  5JUZ F;  2OGD A;  2AET A;  3PDE A;  1UBX A;  1ZW5 A;  3ZL6 A;  3DYF A;  3WSB A;  2E8T A;  2ZCS A;  1UBY A;  2ONH A;  3SAE A;  3M01 A;  3P8L A;  4LUU A; 
#chains in the Genus database with same CATH homology
 4GA3 A;  4OKZ A;  3EFQ A;  5IK0 A;  1VG3 A;  5HNA A;  3Q2Z A;  4KQS A;  4KWD A;  3CKE A;  3M00 A;  1PS1 A;  1WL2 A;  3DYH A;  3LZ9 A;  4KUX A;  3N5J F;  1RTR A;  3M02 A;  1WMW A;  1YJ4 A;  4JZX A;  1WL1 A;  1YYQ A;  2I19 A;  3PYA A;  1UBV A;  3N0F A;  3VJA A;  4GAX A;  3NPK A;  4DZW A;  5B02 A;  1VG7 A;  3BNX A;  4NFJ F;  3WCC A;  4RYP A;  3N6K F;  2Z4Z A;  4NFK F;  5DJR F;  5JV0 F;  3MAV A;  1DGP A;  4OGU A;  5DGM F;  3N3L F;  4H5D F;  4LOB A;  3G4D A;  1YYT A;  4LTV A;  5IK9 A;  4E9Z A;  2OPN A;  4JYX A;  5A0I A;  5B03 A;  3LK5 A;  3VJ9 A;  3WCH A;  4MC0 A;  4L2X F;  2Q58 A;  3KRA B;  2F94 F;  4LA5 A;  2Z4Y A;  5IK6 A;  3M9U A;  5ILI A;  1VG6 A;  5DGS F;  5KSX F;  4LPH F;  3ZOU A;  2EWG A;  5IM1 A;  4RXC A;  1WKZ A;  2F92 F;  3S9V A;  5IMI A;  1WY0 A;  3WEF A;  3KRF A;  4NUA A;  1YYU A;  2PS4 A;  4P0V A;  3V66 A;  5ERN A;  4LFE A;  5CG6 A;  2RAH A;  3WEG A;  4KK2 A;  4XQR F;  3QQV A;  4KVI A;  4MC3 A;  5DGN F;  1UBW A;  3P8R A;  5AYP A;  4DI5 A;  2E8U A;  1HXG A;  3DYG A;  3WCG A;  2Z4V A;  4RNQ A;  5ILD A;  1JFG A;  3WEI A;  1N24 A;  2FOR A;  4LZC A;  2AEL A;  3N1V F;  3VJB A;  3KRC A;  3AE0 A;  3NPR A;  4KPJ A;  3KRF B;  5JV2 F;  2F8Z F;  3N49 F;  4EA2 A;  3PKO A;  4HD1 A;  1VG4 A;  5HN9 A;  3QKC A;  2Z4W A;  3S4J A;  3TFN A;  2OA6 A;  3AQ0 A;  4NKF A;  3LGK A;  3OAB A;  4LPG F;  3KRC B;  3N5H F;  1RQI A;  5EAU A;  3LLW A;  5CG5 A;  3WCI A;  3WEK A;  4QXS F;  4JZB A;  5HN8 A;  3LG5 A;  3PYB A;  4GP1 A;  1HXA A;  1V4H A;  4OMG A;  4XQT F;  3KRP B;  4KVD A;  2F89 F;  3LMD A;  1YV5 A;  3Q30 A;  5ILH A;  1YYR A;  3OYR A;  4LZ0 A;  3ADZ A;  4H5C F;  5DHI A;  3BNY A;  3N3D A;  3Q2Q A;  3OAB B;  4DEM F;  3WCL A;  4LLT A;  4N1Z F;  3WCB A;  4XQS F;  5B0M A;  5E8K A;  1DI1 A;  4FJQ A;  3N46 F;  4MC8 A;  4RXA A;  3KRO A;  2PS8 A;  4QPF A;  5ILK A;  5DW7 A;  3G4F A;  1N23 A;  3SDR A;  3ICZ A;  5DHK A;  3RBM A;  4DXJ A;  4E1E A;  4DWG A;  4KVY A;  5IKA A;  5H9D A;  3TFP A;  3SDQ A;  5E8L A;  3N0G A;  4LFG A;  4ZQ8 A;  3VJ8 A;  4Q23 A;  1HM4 A;  1YHM A;  3TFV A;  2DH4 A;  3LVS A;  2Z7H A;  5A0K A;  3SDV A;  3TC1 A;  3VJD A;  2Q9Z A;  3IPI A;  3ICK A;  3EZ3 A;  2Z7I A;  4UMJ A;  2AZL A;  3B7L A;  1HXC A;  2J5C A;  3M0G A;  5EAS A;  3WC9 A;  4LTZ A;  3WEJ A;  4RXD A;  1YHL A;  2J1O A;  5IN8 A;  4N9U A;  4F62 A;  3OAC A;  2Z52 A;  5ER8 A;  3WJO A;  2F7M F;  1HX9 A;  2E93 A;  4KVW A;  4OKM A;  3ZMB A;  1YYS A;  5HN7 A;  4LFV F;  2AEK A;  3KBK A;  5DJP F;  5B01 A;  2E8X A;  2J1P A;  4P0X A;  2P1C A;  3TS7 A;  3WE9 A;  1WL3 A;  2Q9Y A;  2O1O A;  4EA1 A;  3VJE A;  3PH7 A;  3LDW A;  3MZV A;  5A0J A;  4JXN A;  2E94 A;  3ICN A;  2AZJ A;  5AEL A;  5EAT A;  3ACY A;  3RMG A;  5B0K A;  1YQ7 A;  1EZF A;  5IMP A;  5ERO A;  3SDT A;  3SDU A;  4JVJ F;  3WCF A;  2ZCQ A;  2E91 A;  2PS7 A;  3AQC B;  1YHK A;  3LEE A;  4LZ3 A;  1V4K A;  3NRI A;  3LGZ B;  1FPS A;  3IBA A;  3WEH A;  4KKM A;  4GP2 A;  1V4J A;  5IL8 A;  1V4I A;  2E8V A;  3ZCD A;  2E95 A;  3ACW A;  3ZMC A;  3WSA A;  4KPD A;  4NG6 A;  2E4O A;  1WL0 A;  4E9U A;  3LJI A;  3WJK A;  5ILZ A;  5IVG A;  5I1U A;  5E8H A;  2OPM A;  3RYW A;  1JFA A;  3N1W F;  3W7F A;  5DJV F;  2FTZ A;  5B0J A;  4DHD A;  4RXE A;  1RQJ A;  5DIQ F;  3P5R A;  3VJC A;  3CC9 A;  2F9K F;  3ACX A;  3KRA A;  2QIS A;  3WCA A;  5B0I A;  2Z50 A;  3NF2 A;  1N22 A;  4NFI F;  5IKH A;  5IMN A;  1HM7 A;  1V4E A;  4KQ5 A;  2ZEU A;  4WK5 A;  4F6X A;  2E8W A;  2ZY1 A;  2F8C F;  3V1X A;  3WCM A;  3KRO B;  3KB9 A;  3ID0 A;  2ZCR A;  5ILY A;  4P0W A;  4LA6 A;  4KQU A;  5IL3 A;  2E92 A;  5B0L A;  3RYE A;  4PVY F;  5ERM A;  3LOM A;  3CP6 A;  5AHU B;  5JV1 F;  5ILJ A;  3P5P A;  4K10 A;  4KFA A;  4JXY A;  5AFX A;  3WCD A;  3P41 A;  2AZK A;  4PVX F;  4LIX A;  1N1Z A;  2PS5 A;  2ONG A;  1N20 A;  2VF6 A;  4OMH A;  3Q1O A;  1KIZ A;  2ZCO A;  4H5E F;  2E90 A;  3EGT A;  4LLS A;  2H8O A;  3LSN A;  3ICM A;  1N21 A;  3ASX A;  3V1V A;  4LXW A;  4NKE A;  3OAC B;  3WCJ A;  5DZ2 A;  1N1B A;  2ZEV A;  2Z78 A;  4FP4 A;  5JA0 F;  3AQB B;  4F6V A;  1VG2 A;  5C05 A;  3APZ A;  4DWB A;  2Q80 A;  2Z4X A;  3WCE A;  3KRP A;  3N45 F;  3WJN A;  1KIY A;  5B00 A;  4EA0 A;  3UCA A;  2PS6 A;  5JUZ F;  2OGD A;  2AET A;  3PDE A;  1UBX A;  1ZW5 A;  3ZL6 A;  3DYF A;  3WSB A;  2E8T A;  2ZCS A;  1UBY A;  2ONH A;  3SAE A;  3M01 A;  3P8L A;  4LUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...