1RQIA

Active conformation of farnesyl pyrophosphate synthase bound to isopentyl pyrophosphate and dimethylallyl s-thiolodiphosphate
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
300
structure length
300
Chain Sequence
AMDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTLAFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLDAEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDDARQSLKQLAEQSLDTSALEALADYIIQRNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
pubmed doi rcsb
source organism Escherichia coli
total genus 128
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2003-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 1rqiA00
5ILKA 2AZKA 5DW7A 4JYXA 4F6XA 3M00A 3ICNA 5DGSF 1YYRA 5IK6A 3W7FA 3KB9A 5JV2F 3M9UA 3ZL6A 3DYFA 2ZCSA 3LOMA 1WL1A 4P0VA 3LGKA 5ILHA 1V4HA 4RXEA 4OKMA 3VJAA 4WK5A 2E91A 3WJOA 4ZQ8A 2AZJA 4NFKF 5EASA 5ILYA 1RQJA 4LFGA 3VJ9A 4RNQA 3ICZA 4E9ZA 3ID0A 2AEKA 4GP1A 2PS5A 3NF2A 1VG4A 3AQ0A 5ILIA 4Q23A 4NUAA 1UBWA 3M02A 2PS6A 5IK0A 3WCJA 4F62A 3Q2ZA 3N45F 4P0WA 3EGTA 4EA1A 1HX9A 3QQVA 2ONHA 5JA0F 5JV1F 4K10A 5B00A 1DGPA 2F8CF 2Z52A 5E8HA 4DWBA 2Q58A 2AETA 1YYSA 2E4OA 2Q80A 3RYWA 4H5EF 3OYRA 3LJIA 4JVJF 4E9UA 3WEFA 3AQBB 3IBAA 3PKOA 2E8UA 3EZ3A 4FP4A 4LFEA 3APZA 1N1BA 3N5HF 5DJPF 3SDUA 3OABB 5AYPA 3WE9A 3S4JA 3TC1A 1WL3A 2Z7IA 3P5RA 3ZOUA 2Z78A 4KQ5A 2Z4XA 2OPNA 1N22A 4NKFA 4NFIF 4OMHA 4JXNA 1YJ4A 4NG6A 5HN7A 1VG2A 4LA6A 5I1UA 1YV5A 5HN8A 1VG7A 3Q30A 4LTVA 1N21A 2ONGA 5ERMA 3WCIA 3KRAB 4MC3A 1VG6A 4DHDA 2H8OA 2ZCOA 3ZCDA 5IMIA 1ZW5A 3WEJA 3KRFB 5B02A 3P8RA 4KKMA 2F8ZF 2J1OA 3KROB 1YHKA 4JZBA 5ILDA 3N5JF 2OA6A 4LPGF 4KPDA 3UCAA 3LEEA 3G4FA 1V4IA 5DIQF 2F89F 2ZEVA 4XQSF 3LVSA 4NKEA 5KSXF 2F7MF 1PS1A 2Z4YA 4LPHF 4LZCA 3ASXA 1KIZA 5CG6A 3ACXA 3B7LA 2Z50A 3KRPB 3PYAA 2AZLA 4PVYF 3AQCB 5IL3A 5IMPA 2E95A 2VF6A 4MC8A 3ADZA 2DH4A 3P5PA 4LXWA 3ACWA 2O1OA 5E8KA 4E1EA 4LZ3A 3V66A 3N0GA 4RYPA 4OGUA 3N3LF 5DJRF 3PDEA 3EFQA 3WEGA 1WL0A 3WEIA 5JV0F 3SDQA 5ERNA 4KVWA 4LUUA 5JUZF 3WCMA 1JFAA 3N1VF 5DGMF 5C05A 5B0KA 3WCLA 2FORA 2RAHA 3ICMA 3WSAA 2QISA 3V1XA 5DHIA 3WC9A 3QKCA 4LTZA 4JZXA 2PS7A 5DJVF 5AHUB 2Z4WA 5IN8A 2F9KF 5ER8A 3Q1OA 1HXAA 5B0IA 3S9VA 5IMNA 3OACA 5IL8A 3P8LA 5B0JA 1HXCA 3Q2QA 4UMJA 2E92A 3SDRA 2OGDA 3KRCA 5AELA 4HD1A 1YHMA 3NPKA 3NPRA 4RXAA 4KVDA 3LK5A 3WEKA 2ZCRA 4LA5A 4KVIA 1WL2A 1UBXA 5ILZA 3BNYA 2ZCQA 5IKAA 1FPSA 2Z4VA 2ZEUA 2EWGA 2Z4ZA 4MC0A 4RXCA 1WKZA 2E8TA 3LDWA 3AE0A 5A0IA 3LLWA 5IK9A 3WCEA 4H5DF 4DEMF 3WJNA 2F94F 4QXSF 1V4JA 2P1CA 3NRIA 5EATA 4PVXF 3TS7A 3KRAA 4JXYA 3P41A 2Q9YA 1EZFA 1HM7A 2E8XA 4F6VA 1N20A 3N46F 3VJ8A 4GAXA 4KPJA 5HNAA 1YQ7A 1YYTA 2Q9ZA 4DZWA 3DYHA 3N6KF 4LLTA 2PS4A 2E93A 1KIYA 5A0KA 4GP2A 5HN9A 3WCAA 3CKEA 1WMWA 3RMGA 2E8WA 2J1PA 3TFNA 1HM4A 3KRPA 4DWGA 5B01A 1V4EA 2PS8A 4FJQA 4DXJA 1DI1A 2E94A 3G4DA 3PYBA 4OKZA 3LMDA 3RYEA 4DI5A 5DZ2A 4N9UA 3WEHA 3MAVA 1RTRA 4RXDA 3WCGA 5DHKA 3N1WF 4KK2A 1YHLA 3WCDA 4KUXA 4KVYA 5B0MA 3M01A 2FTZA 5EROA 1WY0A 3VJBA 3N49F 1RQIA 3ICKA 3KBKA 4GA3A 4LZ0A 5IM1A 5CG5A 5B0LA 3LSNA 3V1VA 2J5CA 4EA0A 3CC9A 3PH7A 4LOBA 3ACYA 3RBMA 3WCCA 4QPFA 5ILJA 1HXGA 3BNXA 2I19A 3SAEA 4H5CF 4XQRF 5E8LA 4KQSA 3CP6A 2Z7HA 4XQTF 4KQUA 3LG5A 5EAUA 5A0JA 4N1ZF 1N24A 1N23A 3WSBA 4P0XA 3SDVA 1UBVA 4EA2A 5H9DA 3LZ9A 3VJCA 3OABA 2OPMA 3WCHA 3TFPA 3N0FA 3OACB 1V4KA 4KFAA 1YYUA 5IKHA 3SDTA 4LIXA 1N1ZA 5AFXA 4NFJF 2AELA 3KRCB 3ZMCA 3TFVA 3WJKA 3DYGA 3MZVA 1JFGA 4L2XF 4LLSA 3ZMBA 1YYQA 3IPIA 2F92F 5B03A 3M0GA 3WCBA 3LGZB 3VJDA 5IVGA 3WCFA 4KWDA 3N3DA 2E90A 3KRFA 5DGNF 2E8VA 3KROA 2ZY1A 4OMGA 1UBYA 4LFVF 1VG3A 3VJEA
chains in the Genus database with same CATH superfamily
5ILKA 2AZKA 5DW7A 4JYXA 4F6XA 3M00A 3ICNA 5DGSF 1YYRA 5IK6A 3W7FA 3KB9A 5JV2F 3M9UA 3ZL6A 3DYFA 2ZCSA 3LOMA 1WL1A 4P0VA 3LGKA 5ILHA 1V4HA 4RXEA 4OKMA 3VJAA 4WK5A 2E91A 3WJOA 4ZQ8A 2AZJA 4NFKF 5EASA 5ILYA 1RQJA 4LFGA 3VJ9A 4RNQA 3ICZA 4E9ZA 3ID0A 2AEKA 4GP1A 2PS5A 3NF2A 1VG4A 3AQ0A 5ILIA 4Q23A 4NUAA 1UBWA 3M02A 2PS6A 5IK0A 3WCJA 4F62A 3Q2ZA 3N45F 4P0WA 3EGTA 4EA1A 1HX9A 3QQVA 2ONHA 5JA0F 5JV1F 4K10A 5B00A 1DGPA 2F8CF 2Z52A 5E8HA 4DWBA 2Q58A 2AETA 1YYSA 2E4OA 2Q80A 3RYWA 4H5EF 3OYRA 3LJIA 4JVJF 4E9UA 3WEFA 3AQBB 3IBAA 3PKOA 2E8UA 3EZ3A 4FP4A 4LFEA 3APZA 1N1BA 3N5HF 5DJPF 3SDUA 3OABB 5AYPA 3WE9A 3S4JA 3TC1A 1WL3A 2Z7IA 3P5RA 3ZOUA 2Z78A 4KQ5A 2Z4XA 2OPNA 1N22A 4NKFA 4NFIF 4OMHA 4JXNA 1YJ4A 4NG6A 5HN7A 1VG2A 4LA6A 5I1UA 1YV5A 5HN8A 1VG7A 3Q30A 4LTVA 1N21A 2ONGA 5ERMA 3WCIA 3KRAB 4MC3A 1VG6A 4DHDA 2H8OA 2ZCOA 3ZCDA 5IMIA 1ZW5A 3WEJA 3KRFB 5B02A 3P8RA 4KKMA 2F8ZF 2J1OA 3KROB 1YHKA 4JZBA 5ILDA 3N5JF 2OA6A 4LPGF 4KPDA 3UCAA 3LEEA 3G4FA 1V4IA 5DIQF 2F89F 2ZEVA 4XQSF 3LVSA 4NKEA 5KSXF 2F7MF 1PS1A 2Z4YA 4LPHF 4LZCA 3ASXA 1KIZA 5CG6A 3ACXA 3B7LA 2Z50A 3KRPB 3PYAA 2AZLA 4PVYF 3AQCB 5IL3A 5IMPA 2E95A 2VF6A 4MC8A 3ADZA 2DH4A 3P5PA 4LXWA 3ACWA 2O1OA 5E8KA 4E1EA 4LZ3A 3V66A 3N0GA 4RYPA 4OGUA 3N3LF 5DJRF 3PDEA 3EFQA 3WEGA 1WL0A 3WEIA 5JV0F 3SDQA 5ERNA 4KVWA 4LUUA 5JUZF 3WCMA 1JFAA 3N1VF 5DGMF 5C05A 5B0KA 3WCLA 2FORA 2RAHA 3ICMA 3WSAA 2QISA 3V1XA 5DHIA 3WC9A 3QKCA 4LTZA 4JZXA 2PS7A 5DJVF 5AHUB 2Z4WA 5IN8A 2F9KF 5ER8A 3Q1OA 1HXAA 5B0IA 3S9VA 5IMNA 3OACA 5IL8A 3P8LA 5B0JA 1HXCA 3Q2QA 4UMJA 2E92A 3SDRA 2OGDA 3KRCA 5AELA 4HD1A 1YHMA 3NPKA 3NPRA 4RXAA 4KVDA 3LK5A 3WEKA 2ZCRA 4LA5A 4KVIA 1WL2A 1UBXA 5ILZA 3BNYA 2ZCQA 5IKAA 1FPSA 2Z4VA 2ZEUA 2EWGA 2Z4ZA 4MC0A 4RXCA 1WKZA 2E8TA 3LDWA 3AE0A 5A0IA 3LLWA 5IK9A 3WCEA 4H5DF 4DEMF 3WJNA 2F94F 4QXSF 1V4JA 2P1CA 3NRIA 5EATA 4PVXF 3TS7A 3KRAA 4JXYA 3P41A 2Q9YA 1EZFA 1HM7A 2E8XA 4F6VA 1N20A 3N46F 3VJ8A 4GAXA 4KPJA 5HNAA 1YQ7A 1YYTA 2Q9ZA 4DZWA 3DYHA 3N6KF 4LLTA 2PS4A 2E93A 1KIYA 5A0KA 4GP2A 5HN9A 3WCAA 3CKEA 1WMWA 3RMGA 2E8WA 2J1PA 3TFNA 1HM4A 3KRPA 4DWGA 5B01A 1V4EA 2PS8A 4FJQA 4DXJA 1DI1A 2E94A 3G4DA 3PYBA 4OKZA 3LMDA 3RYEA 4DI5A 5DZ2A 4N9UA 3WEHA 3MAVA 1RTRA 4RXDA 3WCGA 5DHKA 3N1WF 4KK2A 1YHLA 3WCDA 4KUXA 4KVYA 5B0MA 3M01A 2FTZA 5EROA 1WY0A 3VJBA 3N49F 1RQIA 3ICKA 3KBKA 4GA3A 4LZ0A 5IM1A 5CG5A 5B0LA 3LSNA 3V1VA 2J5CA 4EA0A 3CC9A 3PH7A 4LOBA 3ACYA 3RBMA 3WCCA 4QPFA 5ILJA 1HXGA 3BNXA 2I19A 3SAEA 4H5CF 4XQRF 5E8LA 4KQSA 3CP6A 2Z7HA 4XQTF 4KQUA 3LG5A 5EAUA 5A0JA 4N1ZF 1N24A 1N23A 3WSBA 4P0XA 3SDVA 1UBVA 4EA2A 5H9DA 3LZ9A 3VJCA 3OABA 2OPMA 3WCHA 3TFPA 3N0FA 3OACB 1V4KA 4KFAA 1YYUA 5IKHA 3SDTA 4LIXA 1N1ZA 5AFXA 4NFJF 2AELA 3KRCB 3ZMCA 3TFVA 3WJKA 3DYGA 3MZVA 1JFGA 4L2XF 4LLSA 3ZMBA 1YYQA 3IPIA 2F92F 5B03A 3M0GA 3WCBA 3LGZB 3VJDA 5IVGA 3WCFA 4KWDA 3N3DA 2E90A 3KRFA 5DGNF 2E8VA 3KROA 2ZY1A 4OMGA 1UBYA 4LFVF 1VG3A 3VJEA
chains in the Genus database with same CATH topology
5ILKA 2AZKA 5DW7A 4JYXA 4F6XA 3M00A 3ICNA 5DGSF 1YYRA 5IK6A 3W7FA 3KB9A 5JV2F 3M9UA 3ZL6A 3DYFA 2ZCSA 3LOMA 1WL1A 4P0VA 3LGKA 5ILHA 1V4HA 4RXEA 4OKMA 3VJAA 4WK5A 2E91A 3WJOA 4ZQ8A 2AZJA 4NFKF 5EASA 5ILYA 1RQJA 4LFGA 3VJ9A 4RNQA 3ICZA 4E9ZA 3ID0A 2AEKA 4GP1A 2PS5A 3NF2A 1VG4A 3AQ0A 5ILIA 4Q23A 4NUAA 1UBWA 3M02A 2PS6A 5IK0A 3WCJA 4F62A 3Q2ZA 3N45F 4P0WA 3EGTA 4EA1A 1HX9A 3QQVA 2ONHA 5JA0F 5JV1F 4K10A 5B00A 1DGPA 2F8CF 2Z52A 5E8HA 4DWBA 2Q58A 2AETA 1YYSA 2E4OA 2Q80A 3RYWA 4H5EF 3OYRA 3LJIA 4JVJF 4E9UA 3WEFA 3AQBB 3IBAA 3PKOA 2E8UA 3EZ3A 4FP4A 4LFEA 3APZA 1N1BA 3N5HF 5DJPF 3SDUA 3OABB 5AYPA 3WE9A 3S4JA 3TC1A 1WL3A 2Z7IA 3P5RA 3ZOUA 2Z78A 4KQ5A 2Z4XA 2OPNA 1N22A 4NKFA 4NFIF 4OMHA 4JXNA 1YJ4A 4NG6A 5HN7A 1VG2A 4LA6A 5I1UA 1YV5A 5HN8A 1VG7A 3Q30A 4LTVA 1N21A 2ONGA 5ERMA 3WCIA 3KRAB 4MC3A 1VG6A 4DHDA 2H8OA 2ZCOA 3ZCDA 5IMIA 1ZW5A 3WEJA 3KRFB 5B02A 3P8RA 4KKMA 2F8ZF 2J1OA 3KROB 1YHKA 4JZBA 5ILDA 3N5JF 2OA6A 4LPGF 4KPDA 3UCAA 3LEEA 3G4FA 1V4IA 5DIQF 2F89F 2ZEVA 4XQSF 3LVSA 4NKEA 5KSXF 2F7MF 1PS1A 2Z4YA 4LPHF 4LZCA 3ASXA 1KIZA 5CG6A 3ACXA 3B7LA 2Z50A 3KRPB 3PYAA 2AZLA 4PVYF 3AQCB 5IL3A 5IMPA 2E95A 2VF6A 4MC8A 3ADZA 2DH4A 3P5PA 4LXWA 3ACWA 2O1OA 5E8KA 4E1EA 4LZ3A 3V66A 3N0GA 4RYPA 4OGUA 3N3LF 5DJRF 3PDEA 3EFQA 3WEGA 1WL0A 3WEIA 5JV0F 3SDQA 5ERNA 4KVWA 4LUUA 5JUZF 3WCMA 1JFAA 3N1VF 5DGMF 5C05A 5B0KA 3WCLA 2FORA 2RAHA 3ICMA 3WSAA 2QISA 3V1XA 5DHIA 3WC9A 3QKCA 4LTZA 4JZXA 2PS7A 5DJVF 5AHUB 2Z4WA 5IN8A 2F9KF 5ER8A 3Q1OA 1HXAA 5B0IA 3S9VA 5IMNA 3OACA 5IL8A 3P8LA 5B0JA 1HXCA 3Q2QA 4UMJA 2E92A 3SDRA 2OGDA 3KRCA 5AELA 4HD1A 1YHMA 3NPKA 3NPRA 4RXAA 4KVDA 3LK5A 3WEKA 2ZCRA 4LA5A 4KVIA 1WL2A 1UBXA 5ILZA 3BNYA 2ZCQA 5IKAA 1FPSA 2Z4VA 2ZEUA 2EWGA 2Z4ZA 4MC0A 4RXCA 1WKZA 2E8TA 3LDWA 3AE0A 5A0IA 3LLWA 5IK9A 3WCEA 4H5DF 4DEMF 3WJNA 2F94F 4QXSF 1V4JA 2P1CA 3NRIA 5EATA 4PVXF 3TS7A 3KRAA 4JXYA 3P41A 2Q9YA 1EZFA 1HM7A 2E8XA 4F6VA 1N20A 3N46F 3VJ8A 4GAXA 4KPJA 5HNAA 1YQ7A 1YYTA 2Q9ZA 4DZWA 3DYHA 3N6KF 4LLTA 2PS4A 2E93A 1KIYA 5A0KA 4GP2A 5HN9A 3WCAA 3CKEA 1WMWA 3RMGA 2E8WA 2J1PA 3TFNA 1HM4A 3KRPA 4DWGA 5B01A 1V4EA 2PS8A 4FJQA 4DXJA 1DI1A 2E94A 3G4DA 3PYBA 4OKZA 3LMDA 3RYEA 4DI5A 5DZ2A 4N9UA 3WEHA 3MAVA 1RTRA 4RXDA 3WCGA 5DHKA 3N1WF 4KK2A 1YHLA 3WCDA 4KUXA 4KVYA 5B0MA 3M01A 2FTZA 5EROA 1WY0A 3VJBA 3N49F 1RQIA 3ICKA 3KBKA 4GA3A 4LZ0A 5IM1A 5CG5A 5B0LA 3LSNA 3V1VA 2J5CA 4EA0A 3CC9A 3PH7A 4LOBA 3ACYA 3RBMA 3WCCA 4QPFA 5ILJA 1HXGA 3BNXA 2I19A 3SAEA 4H5CF 4XQRF 5E8LA 4KQSA 3CP6A 2Z7HA 4XQTF 4KQUA 3LG5A 5EAUA 5A0JA 4N1ZF 1N24A 1N23A 3WSBA 4P0XA 3SDVA 1UBVA 4EA2A 5H9DA 3LZ9A 3VJCA 3OABA 2OPMA 3WCHA 3TFPA 3N0FA 3OACB 1V4KA 4KFAA 1YYUA 5IKHA 3SDTA 4LIXA 1N1ZA 5AFXA 4NFJF 2AELA 3KRCB 3ZMCA 3TFVA 3WJKA 3DYGA 3MZVA 1JFGA 4L2XF 4LLSA 3ZMBA 1YYQA 3IPIA 2F92F 5B03A 3M0GA 3WCBA 3LGZB 3VJDA 5IVGA 3WCFA 4KWDA 3N3DA 2E90A 3KRFA 5DGNF 2E8VA 3KROA 2ZY1A 4OMGA 1UBYA 4LFVF 1VG3A 3VJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILK A;  2AZK A;  5DW7 A;  4JYX A;  4F6X A;  3M00 A;  3ICN A;  5DGS F;  1YYR A;  5IK6 A;  3W7F A;  3KB9 A;  5JV2 F;  3M9U A;  3ZL6 A;  3DYF A;  2ZCS A;  3LOM A;  1WL1 A;  4P0V A;  3LGK A;  5ILH A;  1V4H A;  4RXE A;  4OKM A;  3VJA A;  4WK5 A;  2E91 A;  3WJO A;  4ZQ8 A;  2AZJ A;  4NFK F;  5EAS A;  5ILY A;  1RQJ A;  4LFG A;  3VJ9 A;  4RNQ A;  3ICZ A;  4E9Z A;  3ID0 A;  2AEK A;  4GP1 A;  2PS5 A;  3NF2 A;  1VG4 A;  3AQ0 A;  5ILI A;  4Q23 A;  4NUA A;  1UBW A;  3M02 A;  2PS6 A;  5IK0 A;  3WCJ A;  4F62 A;  3Q2Z A;  3N45 F;  4P0W A;  3EGT A;  4EA1 A;  1HX9 A;  3QQV A;  2ONH A;  5JA0 F;  5JV1 F;  4K10 A;  5B00 A;  1DGP A;  2F8C F;  2Z52 A;  5E8H A;  4DWB A;  2Q58 A;  2AET A;  1YYS A;  2E4O A;  2Q80 A;  3RYW A;  4H5E F;  3OYR A;  3LJI A;  4JVJ F;  4E9U A;  3WEF A;  3AQB B;  3IBA A;  3PKO A;  2E8U A;  3EZ3 A;  4FP4 A;  4LFE A;  3APZ A;  1N1B A;  3N5H F;  5DJP F;  3SDU A;  3OAB B;  5AYP A;  3WE9 A;  3S4J A;  3TC1 A;  1WL3 A;  2Z7I A;  3P5R A;  3ZOU A;  2Z78 A;  4KQ5 A;  2Z4X A;  2OPN A;  1N22 A;  4NKF A;  4NFI F;  4OMH A;  4JXN A;  1YJ4 A;  4NG6 A;  5HN7 A;  1VG2 A;  4LA6 A;  5I1U A;  1YV5 A;  5HN8 A;  1VG7 A;  3Q30 A;  4LTV A;  1N21 A;  2ONG A;  5ERM A;  3WCI A;  3KRA B;  4MC3 A;  1VG6 A;  4DHD A;  2H8O A;  2ZCO A;  3ZCD A;  5IMI A;  1ZW5 A;  3WEJ A;  3KRF B;  5B02 A;  3P8R A;  4KKM A;  2F8Z F;  2J1O A;  3KRO B;  1YHK A;  4JZB A;  5ILD A;  3N5J F;  2OA6 A;  4LPG F;  4KPD A;  3UCA A;  3LEE A;  3G4F A;  1V4I A;  5DIQ F;  2F89 F;  2ZEV A;  4XQS F;  3LVS A;  4NKE A;  5KSX F;  2F7M F;  1PS1 A;  2Z4Y A;  4LPH F;  4LZC A;  3ASX A;  1KIZ A;  5CG6 A;  3ACX A;  3B7L A;  2Z50 A;  3KRP B;  3PYA A;  2AZL A;  4PVY F;  3AQC B;  5IL3 A;  5IMP A;  2E95 A;  2VF6 A;  4MC8 A;  3ADZ A;  2DH4 A;  3P5P A;  4LXW A;  3ACW A;  2O1O A;  5E8K A;  4E1E A;  4LZ3 A;  3V66 A;  3N0G A;  4RYP A;  4OGU A;  3N3L F;  5DJR F;  3PDE A;  3EFQ A;  3WEG A;  1WL0 A;  3WEI A;  5JV0 F;  3SDQ A;  5ERN A;  4KVW A;  4LUU A;  5JUZ F;  3WCM A;  1JFA A;  3N1V F;  5DGM F;  5C05 A;  5B0K A;  3WCL A;  2FOR A;  2RAH A;  3ICM A;  3WSA A;  2QIS A;  3V1X A;  5DHI A;  3WC9 A;  3QKC A;  4LTZ A;  4JZX A;  2PS7 A;  5DJV F;  5AHU B;  2Z4W A;  5IN8 A;  2F9K F;  5ER8 A;  3Q1O A;  1HXA A;  5B0I A;  3S9V A;  5IMN A;  3OAC A;  5IL8 A;  3P8L A;  5B0J A;  1HXC A;  3Q2Q A;  4UMJ A;  2E92 A;  3SDR A;  2OGD A;  3KRC A;  5AEL A;  4HD1 A;  1YHM A;  3NPK A;  3NPR A;  4RXA A;  4KVD A;  3LK5 A;  3WEK A;  2ZCR A;  4LA5 A;  4KVI A;  1WL2 A;  1UBX A;  5ILZ A;  3BNY A;  2ZCQ A;  5IKA A;  1FPS A;  2Z4V A;  2ZEU A;  2EWG A;  2Z4Z A;  4MC0 A;  4RXC A;  1WKZ A;  2E8T A;  3LDW A;  3AE0 A;  5A0I A;  3LLW A;  5IK9 A;  3WCE A;  4H5D F;  4DEM F;  3WJN A;  2F94 F;  4QXS F;  1V4J A;  2P1C A;  3NRI A;  5EAT A;  4PVX F;  3TS7 A;  3KRA A;  4JXY A;  3P41 A;  2Q9Y A;  1EZF A;  1HM7 A;  2E8X A;  4F6V A;  1N20 A;  3N46 F;  3VJ8 A;  4GAX A;  4KPJ A;  5HNA A;  1YQ7 A;  1YYT A;  2Q9Z A;  4DZW A;  3DYH A;  3N6K F;  4LLT A;  2PS4 A;  2E93 A;  1KIY A;  5A0K A;  4GP2 A;  5HN9 A;  3WCA A;  3CKE A;  1WMW A;  3RMG A;  2E8W A;  2J1P A;  3TFN A;  1HM4 A;  3KRP A;  4DWG A;  5B01 A;  1V4E A;  2PS8 A;  4FJQ A;  4DXJ A;  1DI1 A;  2E94 A;  3G4D A;  3PYB A;  4OKZ A;  3LMD A;  3RYE A;  4DI5 A;  5DZ2 A;  4N9U A;  3WEH A;  3MAV A;  1RTR A;  4RXD A;  3WCG A;  5DHK A;  3N1W F;  4KK2 A;  1YHL A;  3WCD A;  4KUX A;  4KVY A;  5B0M A;  3M01 A;  2FTZ A;  5ERO A;  1WY0 A;  3VJB A;  3N49 F;  1RQI A;  3ICK A;  3KBK A;  4GA3 A;  4LZ0 A;  5IM1 A;  5CG5 A;  5B0L A;  3LSN A;  3V1V A;  2J5C A;  4EA0 A;  3CC9 A;  3PH7 A;  4LOB A;  3ACY A;  3RBM A;  3WCC A;  4QPF A;  5ILJ A;  1HXG A;  3BNX A;  2I19 A;  3SAE A;  4H5C F;  4XQR F;  5E8L A;  4KQS A;  3CP6 A;  2Z7H A;  4XQT F;  4KQU A;  3LG5 A;  5EAU A;  5A0J A;  4N1Z F;  1N24 A;  1N23 A;  3WSB A;  4P0X A;  3SDV A;  1UBV A;  4EA2 A;  5H9D A;  3LZ9 A;  3VJC A;  3OAB A;  2OPM A;  3WCH A;  3TFP A;  3N0F A;  3OAC B;  1V4K A;  4KFA A;  1YYU A;  5IKH A;  3SDT A;  4LIX A;  1N1Z A;  5AFX A;  4NFJ F;  2AEL A;  3KRC B;  3ZMC A;  3TFV A;  3WJK A;  3DYG A;  3MZV A;  1JFG A;  4L2X F;  4LLS A;  3ZMB A;  1YYQ A;  3IPI A;  2F92 F;  5B03 A;  3M0G A;  3WCB A;  3LGZ B;  3VJD A;  5IVG A;  3WCF A;  4KWD A;  3N3D A;  2E90 A;  3KRF A;  5DGN F;  2E8V A;  3KRO A;  2ZY1 A;  4OMG A;  1UBY A;  4LFV F;  1VG3 A;  3VJE A; 
#chains in the Genus database with same CATH topology
 5ILK A;  2AZK A;  5DW7 A;  4JYX A;  4F6X A;  3M00 A;  3ICN A;  5DGS F;  1YYR A;  5IK6 A;  3W7F A;  3KB9 A;  5JV2 F;  3M9U A;  3ZL6 A;  3DYF A;  2ZCS A;  3LOM A;  1WL1 A;  4P0V A;  3LGK A;  5ILH A;  1V4H A;  4RXE A;  4OKM A;  3VJA A;  4WK5 A;  2E91 A;  3WJO A;  4ZQ8 A;  2AZJ A;  4NFK F;  5EAS A;  5ILY A;  1RQJ A;  4LFG A;  3VJ9 A;  4RNQ A;  3ICZ A;  4E9Z A;  3ID0 A;  2AEK A;  4GP1 A;  2PS5 A;  3NF2 A;  1VG4 A;  3AQ0 A;  5ILI A;  4Q23 A;  4NUA A;  1UBW A;  3M02 A;  2PS6 A;  5IK0 A;  3WCJ A;  4F62 A;  3Q2Z A;  3N45 F;  4P0W A;  3EGT A;  4EA1 A;  1HX9 A;  3QQV A;  2ONH A;  5JA0 F;  5JV1 F;  4K10 A;  5B00 A;  1DGP A;  2F8C F;  2Z52 A;  5E8H A;  4DWB A;  2Q58 A;  2AET A;  1YYS A;  2E4O A;  2Q80 A;  3RYW A;  4H5E F;  3OYR A;  3LJI A;  4JVJ F;  4E9U A;  3WEF A;  3AQB B;  3IBA A;  3PKO A;  2E8U A;  3EZ3 A;  4FP4 A;  4LFE A;  3APZ A;  1N1B A;  3N5H F;  5DJP F;  3SDU A;  3OAB B;  5AYP A;  3WE9 A;  3S4J A;  3TC1 A;  1WL3 A;  2Z7I A;  3P5R A;  3ZOU A;  2Z78 A;  4KQ5 A;  2Z4X A;  2OPN A;  1N22 A;  4NKF A;  4NFI F;  4OMH A;  4JXN A;  1YJ4 A;  4NG6 A;  5HN7 A;  1VG2 A;  4LA6 A;  5I1U A;  1YV5 A;  5HN8 A;  1VG7 A;  3Q30 A;  4LTV A;  1N21 A;  2ONG A;  5ERM A;  3WCI A;  3KRA B;  4MC3 A;  1VG6 A;  4DHD A;  2H8O A;  2ZCO A;  3ZCD A;  5IMI A;  1ZW5 A;  3WEJ A;  3KRF B;  5B02 A;  3P8R A;  4KKM A;  2F8Z F;  2J1O A;  3KRO B;  1YHK A;  4JZB A;  5ILD A;  3N5J F;  2OA6 A;  4LPG F;  4KPD A;  3UCA A;  3LEE A;  3G4F A;  1V4I A;  5DIQ F;  2F89 F;  2ZEV A;  4XQS F;  3LVS A;  4NKE A;  5KSX F;  2F7M F;  1PS1 A;  2Z4Y A;  4LPH F;  4LZC A;  3ASX A;  1KIZ A;  5CG6 A;  3ACX A;  3B7L A;  2Z50 A;  3KRP B;  3PYA A;  2AZL A;  4PVY F;  3AQC B;  5IL3 A;  5IMP A;  2E95 A;  2VF6 A;  4MC8 A;  3ADZ A;  2DH4 A;  3P5P A;  4LXW A;  3ACW A;  2O1O A;  5E8K A;  4E1E A;  4LZ3 A;  3V66 A;  3N0G A;  4RYP A;  4OGU A;  3N3L F;  5DJR F;  3PDE A;  3EFQ A;  3WEG A;  1WL0 A;  3WEI A;  5JV0 F;  3SDQ A;  5ERN A;  4KVW A;  4LUU A;  5JUZ F;  3WCM A;  1JFA A;  3N1V F;  5DGM F;  5C05 A;  5B0K A;  3WCL A;  2FOR A;  2RAH A;  3ICM A;  3WSA A;  2QIS A;  3V1X A;  5DHI A;  3WC9 A;  3QKC A;  4LTZ A;  4JZX A;  2PS7 A;  5DJV F;  5AHU B;  2Z4W A;  5IN8 A;  2F9K F;  5ER8 A;  3Q1O A;  1HXA A;  5B0I A;  3S9V A;  5IMN A;  3OAC A;  5IL8 A;  3P8L A;  5B0J A;  1HXC A;  3Q2Q A;  4UMJ A;  2E92 A;  3SDR A;  2OGD A;  3KRC A;  5AEL A;  4HD1 A;  1YHM A;  3NPK A;  3NPR A;  4RXA A;  4KVD A;  3LK5 A;  3WEK A;  2ZCR A;  4LA5 A;  4KVI A;  1WL2 A;  1UBX A;  5ILZ A;  3BNY A;  2ZCQ A;  5IKA A;  1FPS A;  2Z4V A;  2ZEU A;  2EWG A;  2Z4Z A;  4MC0 A;  4RXC A;  1WKZ A;  2E8T A;  3LDW A;  3AE0 A;  5A0I A;  3LLW A;  5IK9 A;  3WCE A;  4H5D F;  4DEM F;  3WJN A;  2F94 F;  4QXS F;  1V4J A;  2P1C A;  3NRI A;  5EAT A;  4PVX F;  3TS7 A;  3KRA A;  4JXY A;  3P41 A;  2Q9Y A;  1EZF A;  1HM7 A;  2E8X A;  4F6V A;  1N20 A;  3N46 F;  3VJ8 A;  4GAX A;  4KPJ A;  5HNA A;  1YQ7 A;  1YYT A;  2Q9Z A;  4DZW A;  3DYH A;  3N6K F;  4LLT A;  2PS4 A;  2E93 A;  1KIY A;  5A0K A;  4GP2 A;  5HN9 A;  3WCA A;  3CKE A;  1WMW A;  3RMG A;  2E8W A;  2J1P A;  3TFN A;  1HM4 A;  3KRP A;  4DWG A;  5B01 A;  1V4E A;  2PS8 A;  4FJQ A;  4DXJ A;  1DI1 A;  2E94 A;  3G4D A;  3PYB A;  4OKZ A;  3LMD A;  3RYE A;  4DI5 A;  5DZ2 A;  4N9U A;  3WEH A;  3MAV A;  1RTR A;  4RXD A;  3WCG A;  5DHK A;  3N1W F;  4KK2 A;  1YHL A;  3WCD A;  4KUX A;  4KVY A;  5B0M A;  3M01 A;  2FTZ A;  5ERO A;  1WY0 A;  3VJB A;  3N49 F;  1RQI A;  3ICK A;  3KBK A;  4GA3 A;  4LZ0 A;  5IM1 A;  5CG5 A;  5B0L A;  3LSN A;  3V1V A;  2J5C A;  4EA0 A;  3CC9 A;  3PH7 A;  4LOB A;  3ACY A;  3RBM A;  3WCC A;  4QPF A;  5ILJ A;  1HXG A;  3BNX A;  2I19 A;  3SAE A;  4H5C F;  4XQR F;  5E8L A;  4KQS A;  3CP6 A;  2Z7H A;  4XQT F;  4KQU A;  3LG5 A;  5EAU A;  5A0J A;  4N1Z F;  1N24 A;  1N23 A;  3WSB A;  4P0X A;  3SDV A;  1UBV A;  4EA2 A;  5H9D A;  3LZ9 A;  3VJC A;  3OAB A;  2OPM A;  3WCH A;  3TFP A;  3N0F A;  3OAC B;  1V4K A;  4KFA A;  1YYU A;  5IKH A;  3SDT A;  4LIX A;  1N1Z A;  5AFX A;  4NFJ F;  2AEL A;  3KRC B;  3ZMC A;  3TFV A;  3WJK A;  3DYG A;  3MZV A;  1JFG A;  4L2X F;  4LLS A;  3ZMB A;  1YYQ A;  3IPI A;  2F92 F;  5B03 A;  3M0G A;  3WCB A;  3LGZ B;  3VJD A;  5IVG A;  3WCF A;  4KWD A;  3N3D A;  2E90 A;  3KRF A;  5DGN F;  2E8V A;  3KRO A;  2ZY1 A;  4OMG A;  1UBY A;  4LFV F;  1VG3 A;  3VJE A; 
#chains in the Genus database with same CATH homology
 5ILK A;  2AZK A;  5DW7 A;  4JYX A;  4F6X A;  3M00 A;  3ICN A;  5DGS F;  1YYR A;  5IK6 A;  3W7F A;  3KB9 A;  5JV2 F;  3M9U A;  3ZL6 A;  3DYF A;  2ZCS A;  3LOM A;  1WL1 A;  4P0V A;  3LGK A;  5ILH A;  1V4H A;  4RXE A;  4OKM A;  3VJA A;  4WK5 A;  2E91 A;  3WJO A;  4ZQ8 A;  2AZJ A;  4NFK F;  5EAS A;  5ILY A;  1RQJ A;  4LFG A;  3VJ9 A;  4RNQ A;  3ICZ A;  4E9Z A;  3ID0 A;  2AEK A;  4GP1 A;  2PS5 A;  3NF2 A;  1VG4 A;  3AQ0 A;  5ILI A;  4Q23 A;  4NUA A;  1UBW A;  3M02 A;  2PS6 A;  5IK0 A;  3WCJ A;  4F62 A;  3Q2Z A;  3N45 F;  4P0W A;  3EGT A;  4EA1 A;  1HX9 A;  3QQV A;  2ONH A;  5JA0 F;  5JV1 F;  4K10 A;  5B00 A;  1DGP A;  2F8C F;  2Z52 A;  5E8H A;  4DWB A;  2Q58 A;  2AET A;  1YYS A;  2E4O A;  2Q80 A;  3RYW A;  4H5E F;  3OYR A;  3LJI A;  4JVJ F;  4E9U A;  3WEF A;  3AQB B;  3IBA A;  3PKO A;  2E8U A;  3EZ3 A;  4FP4 A;  4LFE A;  3APZ A;  1N1B A;  3N5H F;  5DJP F;  3SDU A;  3OAB B;  5AYP A;  3WE9 A;  3S4J A;  3TC1 A;  1WL3 A;  2Z7I A;  3P5R A;  3ZOU A;  2Z78 A;  4KQ5 A;  2Z4X A;  2OPN A;  1N22 A;  4NKF A;  4NFI F;  4OMH A;  4JXN A;  1YJ4 A;  4NG6 A;  5HN7 A;  1VG2 A;  4LA6 A;  5I1U A;  1YV5 A;  5HN8 A;  1VG7 A;  3Q30 A;  4LTV A;  1N21 A;  2ONG A;  5ERM A;  3WCI A;  3KRA B;  4MC3 A;  1VG6 A;  4DHD A;  2H8O A;  2ZCO A;  3ZCD A;  5IMI A;  1ZW5 A;  3WEJ A;  3KRF B;  5B02 A;  3P8R A;  4KKM A;  2F8Z F;  2J1O A;  3KRO B;  1YHK A;  4JZB A;  5ILD A;  3N5J F;  2OA6 A;  4LPG F;  4KPD A;  3UCA A;  3LEE A;  3G4F A;  1V4I A;  5DIQ F;  2F89 F;  2ZEV A;  4XQS F;  3LVS A;  4NKE A;  5KSX F;  2F7M F;  1PS1 A;  2Z4Y A;  4LPH F;  4LZC A;  3ASX A;  1KIZ A;  5CG6 A;  3ACX A;  3B7L A;  2Z50 A;  3KRP B;  3PYA A;  2AZL A;  4PVY F;  3AQC B;  5IL3 A;  5IMP A;  2E95 A;  2VF6 A;  4MC8 A;  3ADZ A;  2DH4 A;  3P5P A;  4LXW A;  3ACW A;  2O1O A;  5E8K A;  4E1E A;  4LZ3 A;  3V66 A;  3N0G A;  4RYP A;  4OGU A;  3N3L F;  5DJR F;  3PDE A;  3EFQ A;  3WEG A;  1WL0 A;  3WEI A;  5JV0 F;  3SDQ A;  5ERN A;  4KVW A;  4LUU A;  5JUZ F;  3WCM A;  1JFA A;  3N1V F;  5DGM F;  5C05 A;  5B0K A;  3WCL A;  2FOR A;  2RAH A;  3ICM A;  3WSA A;  2QIS A;  3V1X A;  5DHI A;  3WC9 A;  3QKC A;  4LTZ A;  4JZX A;  2PS7 A;  5DJV F;  5AHU B;  2Z4W A;  5IN8 A;  2F9K F;  5ER8 A;  3Q1O A;  1HXA A;  5B0I A;  3S9V A;  5IMN A;  3OAC A;  5IL8 A;  3P8L A;  5B0J A;  1HXC A;  3Q2Q A;  4UMJ A;  2E92 A;  3SDR A;  2OGD A;  3KRC A;  5AEL A;  4HD1 A;  1YHM A;  3NPK A;  3NPR A;  4RXA A;  4KVD A;  3LK5 A;  3WEK A;  2ZCR A;  4LA5 A;  4KVI A;  1WL2 A;  1UBX A;  5ILZ A;  3BNY A;  2ZCQ A;  5IKA A;  1FPS A;  2Z4V A;  2ZEU A;  2EWG A;  2Z4Z A;  4MC0 A;  4RXC A;  1WKZ A;  2E8T A;  3LDW A;  3AE0 A;  5A0I A;  3LLW A;  5IK9 A;  3WCE A;  4H5D F;  4DEM F;  3WJN A;  2F94 F;  4QXS F;  1V4J A;  2P1C A;  3NRI A;  5EAT A;  4PVX F;  3TS7 A;  3KRA A;  4JXY A;  3P41 A;  2Q9Y A;  1EZF A;  1HM7 A;  2E8X A;  4F6V A;  1N20 A;  3N46 F;  3VJ8 A;  4GAX A;  4KPJ A;  5HNA A;  1YQ7 A;  1YYT A;  2Q9Z A;  4DZW A;  3DYH A;  3N6K F;  4LLT A;  2PS4 A;  2E93 A;  1KIY A;  5A0K A;  4GP2 A;  5HN9 A;  3WCA A;  3CKE A;  1WMW A;  3RMG A;  2E8W A;  2J1P A;  3TFN A;  1HM4 A;  3KRP A;  4DWG A;  5B01 A;  1V4E A;  2PS8 A;  4FJQ A;  4DXJ A;  1DI1 A;  2E94 A;  3G4D A;  3PYB A;  4OKZ A;  3LMD A;  3RYE A;  4DI5 A;  5DZ2 A;  4N9U A;  3WEH A;  3MAV A;  1RTR A;  4RXD A;  3WCG A;  5DHK A;  3N1W F;  4KK2 A;  1YHL A;  3WCD A;  4KUX A;  4KVY A;  5B0M A;  3M01 A;  2FTZ A;  5ERO A;  1WY0 A;  3VJB A;  3N49 F;  1RQI A;  3ICK A;  3KBK A;  4GA3 A;  4LZ0 A;  5IM1 A;  5CG5 A;  5B0L A;  3LSN A;  3V1V A;  2J5C A;  4EA0 A;  3CC9 A;  3PH7 A;  4LOB A;  3ACY A;  3RBM A;  3WCC A;  4QPF A;  5ILJ A;  1HXG A;  3BNX A;  2I19 A;  3SAE A;  4H5C F;  4XQR F;  5E8L A;  4KQS A;  3CP6 A;  2Z7H A;  4XQT F;  4KQU A;  3LG5 A;  5EAU A;  5A0J A;  4N1Z F;  1N24 A;  1N23 A;  3WSB A;  4P0X A;  3SDV A;  1UBV A;  4EA2 A;  5H9D A;  3LZ9 A;  3VJC A;  3OAB A;  2OPM A;  3WCH A;  3TFP A;  3N0F A;  3OAC B;  1V4K A;  4KFA A;  1YYU A;  5IKH A;  3SDT A;  4LIX A;  1N1Z A;  5AFX A;  4NFJ F;  2AEL A;  3KRC B;  3ZMC A;  3TFV A;  3WJK A;  3DYG A;  3MZV A;  1JFG A;  4L2X F;  4LLS A;  3ZMB A;  1YYQ A;  3IPI A;  2F92 F;  5B03 A;  3M0G A;  3WCB A;  3LGZ B;  3VJD A;  5IVG A;  3WCF A;  4KWD A;  3N3D A;  2E90 A;  3KRF A;  5DGN F;  2E8V A;  3KRO A;  2ZY1 A;  4OMG A;  1UBY A;  4LFV F;  1VG3 A;  3VJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...