3LSNA

Crystal structure of putative geranyltranstransferase from pseudomonas fluorescens pf-5 complexed with magnesium
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
292
structure length
280
Chain Sequence
SLTAYQASSQARVDAAMHTLFTAPSPELARLYEAMRYSVMNGGKRVRPLLAYAACEALGGKPEQANGAACAVELIHAYSLVHDDLPAMDDDDLRRGQPTTHKAFDEACAILAGDGLQSLAFSALLDPALSDASAEIRLRMVTTLAQAAGPAGMVGGQAIDLGSVGLKLDQQALEYMHRHKTGALIEASVILGALASGRAEKGELKALQTYAQAIGLAFQVQDDILDVESDTATLPTYPALLGLAAAKEYALELRDQALHALRPFDAAAEPLRELARYIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Crystal structure of putative geranyltranstransferase from Pseudomonas fluorescens PF-5 complexed with magnesium
rcsb
source organism Pseudomonas fluorescens
total genus 105
structure length 280
sequence length 292
ec nomenclature
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3lsnA00
5CG5A 5IMPA 3WJKA 1PS1A 2ZEVA 1KIYA 2E8VA 3IPIA 4DHDA 3KRPA 3N3DA 3SDRA 1N1ZA 3N6KF 4LFEA 3DYGA 1WKZA 1V4IA 3ICKA 4MC3A 4MC0A 1V4KA 5KSXF 5B0LA 1WL0A 3KROA 5AHUB 5IVGA 2Z4XA 3B7LA 5H9DA 4ZQ8A 2QISA 2Z50A 2E4OA 5IN8A 1YYQA 4LFGA 5CG6A 1VG2A 2AZJA 5ILZA 4F6XA 4LFVF 2O1OA 3ACWA 4UMJA 1UBYA 3LZ9A 3VJAA 3KRCA 3TFNA 3WCGA 5ER8A 4LLSA 1N20A 3M0GA 3PKOA 2E91A 3KB9A 3ZCDA 5JV2F 4DZWA 3DYHA 3PYBA 5DZ2A 4XQTF 3P5PA 2ZCQA 3G4DA 4RXEA 3RYEA 4LPGF 4LIXA 5IMNA 1UBWA 3N1VF 2PS8A 5ILHA 4PVYF 5DJVF 2Q9YA 1UBVA 2OA6A 4LA6A 4NUAA 2ONHA 1N23A 3EZ3A 3LK5A 3M00A 1V4HA 4OMHA 3SDTA 1N22A 5E8HA 5EROA 5DIQF 2Q58A 4E9UA 2E94A 2ZCRA 4LZCA 3KRAA 2F8ZF 3PH7A 5DGSF 2Z4WA 3KRPB 1RQIA 3M01A 4KFAA 1KIZA 2Z7HA 1N24A 5ILJA 5ERNA 3KROB 4DWBA 1N1BA 5B00A 3LEEA 4JYXA 3KRFA 1HXGA 4HD1A 4RXAA 4EA2A 3LLWA 3WCAA 2AZLA 3ADZA 3ACYA 5E8LA 3VJ9A 1V4EA 4P0VA 3EGTA 3N5HF 2PS7A 4NG6A 4F6VA 3WEGA 3NPRA 4QXSF 3KRCB 1DI1A 3NRIA 3Q30A 3RMGA 4LPHF 4EA1A 3W7FA 2E8WA 3ICNA 3APZA 5IK6A 1V4JA 4N9UA 3PDEA 5DJRF 5HNAA 4OGUA 5JV0F 2OGDA 1JFAA 3AQBB 2J5CA 4EA0A 1YV5A 2Z4ZA 4JVJF 3TS7A 3RYWA 3Q1OA 4NFIF 3SDQA 5DHKA 3OACA 1WMWA 1HXAA 4KUXA 2P1CA 2ZY1A 2ZCSA 5B03A 2PS6A 4KVWA 2Z4YA 5JV1F 2VF6A 2PS5A 1YQ7A 5ILKA 4KVYA 4NKFA 3ACXA 4RXCA 2OPNA 4MC8A 5B0KA 3ICMA 3LJIA 3IBAA 5B0IA 4KWDA 3KRAB 1RQJA 3MAVA 3LGKA 4RYPA 3OABA 4NKEA 3G4FA 5JA0F 3SDVA 2AELA 2E8TA 3N46F 1YJ4A 4KVIA 4KQUA 3M9UA 4K10A 2J1PA 3KRFB 4KQSA 4NFKF 3WCJA 1VG3A 2F9KF 2ONGA 3P41A 4LLTA 3WEJA 2Z4VA 3WEKA 2Z7IA 5EASA 4DWGA 3WCLA 3CKEA 4KVDA 5HN8A 3NPKA 2J1OA 4WK5A 5DGNF 3WEHA 4KPDA 3WEIA 3LOMA 3QQVA 4PVXF 3WCCA 4OKZA 3LMDA 3UCAA 2PS4A 3VJBA 4H5CF 3P5RA 5DJPF 5IKHA 1FPSA 3N0FA 5ERMA 2AEKA 1HXCA 3EFQA 4E9ZA 3ICZA 5B02A 3N0GA 1HX9A 3Q2QA 4GAXA 4JXNA 1DGPA 2DH4A 3OACB 5B01A 5ILYA 3N1WF 3WC9A 4E1EA 3AQ0A 5JUZF 4KKMA 4Q23A 1YHKA 3P8LA 2E93A 2E8UA 4FJQA 5ILIA 3WJNA 1WL1A 1JFGA 4DEMF 3DYFA 5A0IA 5AELA 5E8KA 3WCEA 5EATA 5IKAA 3VJDA 4RXDA 3MZVA 4LTVA 3OABB 3WCHA 5B0JA 4GP2A 4LZ0A 2FTZA 5C05A 3ZOUA 4KK2A 3WJOA 4LZ3A 2ZCOA 2F89F 1YHMA 2E95A 3WEFA 1VG7A 3Q2ZA 4QPFA 4F62A 4JXYA 3RBMA 2OPMA 4DI5A 5IK0A 3N5JF 3N45F 1UBXA 4NFJF 3LGZB 4JZBA 1WL2A 4RNQA 3AQCB 3AE0A 2F92F 1YHLA 3TC1A 5IK9A 4JZXA 4OMGA 4LXWA 3TFPA 5DHIA 3WCDA 5IL8A 2I19A 5IL3A 2AETA 1EZFA 1VG6A 2EWGA 3WCFA 4GP1A 3BNXA 3VJCA 3WCMA 3KBKA 1ZW5A 3VJ8A 1YYSA 3V1VA 2F94F 5AYPA 5EAUA 4KPJA 4XQRF 3V66A 5DW7A 2F8CF 4N1ZF 3P8RA 2FORA 5A0JA 4L2XF 3BNYA 5I1UA 1RTRA 2RAHA 3CC9A 4LUUA 5HN9A 5A0KA 2Q9ZA 3NF2A 3PYAA 4FP4A 4KQ5A 4LOBA 4P0WA 1YYRA 4XQSF 5B0MA 3WCBA 3SAEA 1WY0A 2E8XA 2Z52A 1N21A 1YYUA 3LG5A 3WSAA 2H8OA 2Z78A 4GA3A 2F7MF 3WCIA 1HM7A 3LDWA 3LVSA 1WL3A 3SDUA 5HN7A 1YYTA 4H5DF 3S9VA 1HM4A 3N3LF 4P0XA 3QKCA 5IM1A 2ZEUA 4DXJA 4H5EF 2Q80A 3VJEA 3V1XA 4LA5A 5AFXA 3M02A 4LTZA 3N49F 5DGMF 3ZMBA 1VG4A 2E90A 3ZMCA 2E92A 5ILDA 5IMIA 3ZL6A 3LSNA 3CP6A 3WE9A 3WSBA 4OKMA 3ASXA 3TFVA 3S4JA 2AZKA 3ID0A 3OYRA
chains in the Genus database with same CATH superfamily
5CG5A 5IMPA 3WJKA 1PS1A 2ZEVA 1KIYA 2E8VA 3IPIA 4DHDA 3KRPA 3N3DA 3SDRA 1N1ZA 3N6KF 4LFEA 3DYGA 1WKZA 1V4IA 3ICKA 4MC3A 4MC0A 1V4KA 5KSXF 5B0LA 1WL0A 3KROA 5AHUB 5IVGA 2Z4XA 3B7LA 5H9DA 4ZQ8A 2QISA 2Z50A 2E4OA 5IN8A 1YYQA 4LFGA 5CG6A 1VG2A 2AZJA 5ILZA 4F6XA 4LFVF 2O1OA 3ACWA 4UMJA 1UBYA 3LZ9A 3VJAA 3KRCA 3TFNA 3WCGA 5ER8A 4LLSA 1N20A 3M0GA 3PKOA 2E91A 3KB9A 3ZCDA 5JV2F 4DZWA 3DYHA 3PYBA 5DZ2A 4XQTF 3P5PA 2ZCQA 3G4DA 4RXEA 3RYEA 4LPGF 4LIXA 5IMNA 1UBWA 3N1VF 2PS8A 5ILHA 4PVYF 5DJVF 2Q9YA 1UBVA 2OA6A 4LA6A 4NUAA 2ONHA 1N23A 3EZ3A 3LK5A 3M00A 1V4HA 4OMHA 3SDTA 1N22A 5E8HA 5EROA 5DIQF 2Q58A 4E9UA 2E94A 2ZCRA 4LZCA 3KRAA 2F8ZF 3PH7A 5DGSF 2Z4WA 3KRPB 1RQIA 3M01A 4KFAA 1KIZA 2Z7HA 1N24A 5ILJA 5ERNA 3KROB 4DWBA 1N1BA 5B00A 3LEEA 4JYXA 3KRFA 1HXGA 4HD1A 4RXAA 4EA2A 3LLWA 3WCAA 2AZLA 3ADZA 3ACYA 5E8LA 3VJ9A 1V4EA 4P0VA 3EGTA 3N5HF 2PS7A 4NG6A 4F6VA 3WEGA 3NPRA 4QXSF 3KRCB 1DI1A 3NRIA 3Q30A 3RMGA 4LPHF 4EA1A 3W7FA 2E8WA 3ICNA 3APZA 5IK6A 1V4JA 4N9UA 3PDEA 5DJRF 5HNAA 4OGUA 5JV0F 2OGDA 1JFAA 3AQBB 2J5CA 4EA0A 1YV5A 2Z4ZA 4JVJF 3TS7A 3RYWA 3Q1OA 4NFIF 3SDQA 5DHKA 3OACA 1WMWA 1HXAA 4KUXA 2P1CA 2ZY1A 2ZCSA 5B03A 2PS6A 4KVWA 2Z4YA 5JV1F 2VF6A 2PS5A 1YQ7A 5ILKA 4KVYA 4NKFA 3ACXA 4RXCA 2OPNA 4MC8A 5B0KA 3ICMA 3LJIA 3IBAA 5B0IA 4KWDA 3KRAB 1RQJA 3MAVA 3LGKA 4RYPA 3OABA 4NKEA 3G4FA 5JA0F 3SDVA 2AELA 2E8TA 3N46F 1YJ4A 4KVIA 4KQUA 3M9UA 4K10A 2J1PA 3KRFB 4KQSA 4NFKF 3WCJA 1VG3A 2F9KF 2ONGA 3P41A 4LLTA 3WEJA 2Z4VA 3WEKA 2Z7IA 5EASA 4DWGA 3WCLA 3CKEA 4KVDA 5HN8A 3NPKA 2J1OA 4WK5A 5DGNF 3WEHA 4KPDA 3WEIA 3LOMA 3QQVA 4PVXF 3WCCA 4OKZA 3LMDA 3UCAA 2PS4A 3VJBA 4H5CF 3P5RA 5DJPF 5IKHA 1FPSA 3N0FA 5ERMA 2AEKA 1HXCA 3EFQA 4E9ZA 3ICZA 5B02A 3N0GA 1HX9A 3Q2QA 4GAXA 4JXNA 1DGPA 2DH4A 3OACB 5B01A 5ILYA 3N1WF 3WC9A 4E1EA 3AQ0A 5JUZF 4KKMA 4Q23A 1YHKA 3P8LA 2E93A 2E8UA 4FJQA 5ILIA 3WJNA 1WL1A 1JFGA 4DEMF 3DYFA 5A0IA 5AELA 5E8KA 3WCEA 5EATA 5IKAA 3VJDA 4RXDA 3MZVA 4LTVA 3OABB 3WCHA 5B0JA 4GP2A 4LZ0A 2FTZA 5C05A 3ZOUA 4KK2A 3WJOA 4LZ3A 2ZCOA 2F89F 1YHMA 2E95A 3WEFA 1VG7A 3Q2ZA 4QPFA 4F62A 4JXYA 3RBMA 2OPMA 4DI5A 5IK0A 3N5JF 3N45F 1UBXA 4NFJF 3LGZB 4JZBA 1WL2A 4RNQA 3AQCB 3AE0A 2F92F 1YHLA 3TC1A 5IK9A 4JZXA 4OMGA 4LXWA 3TFPA 5DHIA 3WCDA 5IL8A 2I19A 5IL3A 2AETA 1EZFA 1VG6A 2EWGA 3WCFA 4GP1A 3BNXA 3VJCA 3WCMA 3KBKA 1ZW5A 3VJ8A 1YYSA 3V1VA 2F94F 5AYPA 5EAUA 4KPJA 4XQRF 3V66A 5DW7A 2F8CF 4N1ZF 3P8RA 2FORA 5A0JA 4L2XF 3BNYA 5I1UA 1RTRA 2RAHA 3CC9A 4LUUA 5HN9A 5A0KA 2Q9ZA 3NF2A 3PYAA 4FP4A 4KQ5A 4LOBA 4P0WA 1YYRA 4XQSF 5B0MA 3WCBA 3SAEA 1WY0A 2E8XA 2Z52A 1N21A 1YYUA 3LG5A 3WSAA 2H8OA 2Z78A 4GA3A 2F7MF 3WCIA 1HM7A 3LDWA 3LVSA 1WL3A 3SDUA 5HN7A 1YYTA 4H5DF 3S9VA 1HM4A 3N3LF 4P0XA 3QKCA 5IM1A 2ZEUA 4DXJA 4H5EF 2Q80A 3VJEA 3V1XA 4LA5A 5AFXA 3M02A 4LTZA 3N49F 5DGMF 3ZMBA 1VG4A 2E90A 3ZMCA 2E92A 5ILDA 5IMIA 3ZL6A 3LSNA 3CP6A 3WE9A 3WSBA 4OKMA 3ASXA 3TFVA 3S4JA 2AZKA 3ID0A 3OYRA
chains in the Genus database with same CATH topology
5CG5A 5IMPA 3WJKA 1PS1A 2ZEVA 1KIYA 2E8VA 3IPIA 4DHDA 3KRPA 3N3DA 3SDRA 1N1ZA 3N6KF 4LFEA 3DYGA 1WKZA 1V4IA 3ICKA 4MC3A 4MC0A 1V4KA 5KSXF 5B0LA 1WL0A 3KROA 5AHUB 5IVGA 2Z4XA 3B7LA 5H9DA 4ZQ8A 2QISA 2Z50A 2E4OA 5IN8A 1YYQA 4LFGA 5CG6A 1VG2A 2AZJA 5ILZA 4F6XA 4LFVF 2O1OA 3ACWA 4UMJA 1UBYA 3LZ9A 3VJAA 3KRCA 3TFNA 3WCGA 5ER8A 4LLSA 1N20A 3M0GA 3PKOA 2E91A 3KB9A 3ZCDA 5JV2F 4DZWA 3DYHA 3PYBA 5DZ2A 4XQTF 3P5PA 2ZCQA 3G4DA 4RXEA 3RYEA 4LPGF 4LIXA 5IMNA 1UBWA 3N1VF 2PS8A 5ILHA 4PVYF 5DJVF 2Q9YA 1UBVA 2OA6A 4LA6A 4NUAA 2ONHA 1N23A 3EZ3A 3LK5A 3M00A 1V4HA 4OMHA 3SDTA 1N22A 5E8HA 5EROA 5DIQF 2Q58A 4E9UA 2E94A 2ZCRA 4LZCA 3KRAA 2F8ZF 3PH7A 5DGSF 2Z4WA 3KRPB 1RQIA 3M01A 4KFAA 1KIZA 2Z7HA 1N24A 5ILJA 5ERNA 3KROB 4DWBA 1N1BA 5B00A 3LEEA 4JYXA 3KRFA 1HXGA 4HD1A 4RXAA 4EA2A 3LLWA 3WCAA 2AZLA 3ADZA 3ACYA 5E8LA 3VJ9A 1V4EA 4P0VA 3EGTA 3N5HF 2PS7A 4NG6A 4F6VA 3WEGA 3NPRA 4QXSF 3KRCB 1DI1A 3NRIA 3Q30A 3RMGA 4LPHF 4EA1A 3W7FA 2E8WA 3ICNA 3APZA 5IK6A 1V4JA 4N9UA 3PDEA 5DJRF 5HNAA 4OGUA 5JV0F 2OGDA 1JFAA 3AQBB 2J5CA 4EA0A 1YV5A 2Z4ZA 4JVJF 3TS7A 3RYWA 3Q1OA 4NFIF 3SDQA 5DHKA 3OACA 1WMWA 1HXAA 4KUXA 2P1CA 2ZY1A 2ZCSA 5B03A 2PS6A 4KVWA 2Z4YA 5JV1F 2VF6A 2PS5A 1YQ7A 5ILKA 4KVYA 4NKFA 3ACXA 4RXCA 2OPNA 4MC8A 5B0KA 3ICMA 3LJIA 3IBAA 5B0IA 4KWDA 3KRAB 1RQJA 3MAVA 3LGKA 4RYPA 3OABA 4NKEA 3G4FA 5JA0F 3SDVA 2AELA 2E8TA 3N46F 1YJ4A 4KVIA 4KQUA 3M9UA 4K10A 2J1PA 3KRFB 4KQSA 4NFKF 3WCJA 1VG3A 2F9KF 2ONGA 3P41A 4LLTA 3WEJA 2Z4VA 3WEKA 2Z7IA 5EASA 4DWGA 3WCLA 3CKEA 4KVDA 5HN8A 3NPKA 2J1OA 4WK5A 5DGNF 3WEHA 4KPDA 3WEIA 3LOMA 3QQVA 4PVXF 3WCCA 4OKZA 3LMDA 3UCAA 2PS4A 3VJBA 4H5CF 3P5RA 5DJPF 5IKHA 1FPSA 3N0FA 5ERMA 2AEKA 1HXCA 3EFQA 4E9ZA 3ICZA 5B02A 3N0GA 1HX9A 3Q2QA 4GAXA 4JXNA 1DGPA 2DH4A 3OACB 5B01A 5ILYA 3N1WF 3WC9A 4E1EA 3AQ0A 5JUZF 4KKMA 4Q23A 1YHKA 3P8LA 2E93A 2E8UA 4FJQA 5ILIA 3WJNA 1WL1A 1JFGA 4DEMF 3DYFA 5A0IA 5AELA 5E8KA 3WCEA 5EATA 5IKAA 3VJDA 4RXDA 3MZVA 4LTVA 3OABB 3WCHA 5B0JA 4GP2A 4LZ0A 2FTZA 5C05A 3ZOUA 4KK2A 3WJOA 4LZ3A 2ZCOA 2F89F 1YHMA 2E95A 3WEFA 1VG7A 3Q2ZA 4QPFA 4F62A 4JXYA 3RBMA 2OPMA 4DI5A 5IK0A 3N5JF 3N45F 1UBXA 4NFJF 3LGZB 4JZBA 1WL2A 4RNQA 3AQCB 3AE0A 2F92F 1YHLA 3TC1A 5IK9A 4JZXA 4OMGA 4LXWA 3TFPA 5DHIA 3WCDA 5IL8A 2I19A 5IL3A 2AETA 1EZFA 1VG6A 2EWGA 3WCFA 4GP1A 3BNXA 3VJCA 3WCMA 3KBKA 1ZW5A 3VJ8A 1YYSA 3V1VA 2F94F 5AYPA 5EAUA 4KPJA 4XQRF 3V66A 5DW7A 2F8CF 4N1ZF 3P8RA 2FORA 5A0JA 4L2XF 3BNYA 5I1UA 1RTRA 2RAHA 3CC9A 4LUUA 5HN9A 5A0KA 2Q9ZA 3NF2A 3PYAA 4FP4A 4KQ5A 4LOBA 4P0WA 1YYRA 4XQSF 5B0MA 3WCBA 3SAEA 1WY0A 2E8XA 2Z52A 1N21A 1YYUA 3LG5A 3WSAA 2H8OA 2Z78A 4GA3A 2F7MF 3WCIA 1HM7A 3LDWA 3LVSA 1WL3A 3SDUA 5HN7A 1YYTA 4H5DF 3S9VA 1HM4A 3N3LF 4P0XA 3QKCA 5IM1A 2ZEUA 4DXJA 4H5EF 2Q80A 3VJEA 3V1XA 4LA5A 5AFXA 3M02A 4LTZA 3N49F 5DGMF 3ZMBA 1VG4A 2E90A 3ZMCA 2E92A 5ILDA 5IMIA 3ZL6A 3LSNA 3CP6A 3WE9A 3WSBA 4OKMA 3ASXA 3TFVA 3S4JA 2AZKA 3ID0A 3OYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CG5 A;  5IMP A;  3WJK A;  1PS1 A;  2ZEV A;  1KIY A;  2E8V A;  3IPI A;  4DHD A;  3KRP A;  3N3D A;  3SDR A;  1N1Z A;  3N6K F;  4LFE A;  3DYG A;  1WKZ A;  1V4I A;  3ICK A;  4MC3 A;  4MC0 A;  1V4K A;  5KSX F;  5B0L A;  1WL0 A;  3KRO A;  5AHU B;  5IVG A;  2Z4X A;  3B7L A;  5H9D A;  4ZQ8 A;  2QIS A;  2Z50 A;  2E4O A;  5IN8 A;  1YYQ A;  4LFG A;  5CG6 A;  1VG2 A;  2AZJ A;  5ILZ A;  4F6X A;  4LFV F;  2O1O A;  3ACW A;  4UMJ A;  1UBY A;  3LZ9 A;  3VJA A;  3KRC A;  3TFN A;  3WCG A;  5ER8 A;  4LLS A;  1N20 A;  3M0G A;  3PKO A;  2E91 A;  3KB9 A;  3ZCD A;  5JV2 F;  4DZW A;  3DYH A;  3PYB A;  5DZ2 A;  4XQT F;  3P5P A;  2ZCQ A;  3G4D A;  4RXE A;  3RYE A;  4LPG F;  4LIX A;  5IMN A;  1UBW A;  3N1V F;  2PS8 A;  5ILH A;  4PVY F;  5DJV F;  2Q9Y A;  1UBV A;  2OA6 A;  4LA6 A;  4NUA A;  2ONH A;  1N23 A;  3EZ3 A;  3LK5 A;  3M00 A;  1V4H A;  4OMH A;  3SDT A;  1N22 A;  5E8H A;  5ERO A;  5DIQ F;  2Q58 A;  4E9U A;  2E94 A;  2ZCR A;  4LZC A;  3KRA A;  2F8Z F;  3PH7 A;  5DGS F;  2Z4W A;  3KRP B;  1RQI A;  3M01 A;  4KFA A;  1KIZ A;  2Z7H A;  1N24 A;  5ILJ A;  5ERN A;  3KRO B;  4DWB A;  1N1B A;  5B00 A;  3LEE A;  4JYX A;  3KRF A;  1HXG A;  4HD1 A;  4RXA A;  4EA2 A;  3LLW A;  3WCA A;  2AZL A;  3ADZ A;  3ACY A;  5E8L A;  3VJ9 A;  1V4E A;  4P0V A;  3EGT A;  3N5H F;  2PS7 A;  4NG6 A;  4F6V A;  3WEG A;  3NPR A;  4QXS F;  3KRC B;  1DI1 A;  3NRI A;  3Q30 A;  3RMG A;  4LPH F;  4EA1 A;  3W7F A;  2E8W A;  3ICN A;  3APZ A;  5IK6 A;  1V4J A;  4N9U A;  3PDE A;  5DJR F;  5HNA A;  4OGU A;  5JV0 F;  2OGD A;  1JFA A;  3AQB B;  2J5C A;  4EA0 A;  1YV5 A;  2Z4Z A;  4JVJ F;  3TS7 A;  3RYW A;  3Q1O A;  4NFI F;  3SDQ A;  5DHK A;  3OAC A;  1WMW A;  1HXA A;  4KUX A;  2P1C A;  2ZY1 A;  2ZCS A;  5B03 A;  2PS6 A;  4KVW A;  2Z4Y A;  5JV1 F;  2VF6 A;  2PS5 A;  1YQ7 A;  5ILK A;  4KVY A;  4NKF A;  3ACX A;  4RXC A;  2OPN A;  4MC8 A;  5B0K A;  3ICM A;  3LJI A;  3IBA A;  5B0I A;  4KWD A;  3KRA B;  1RQJ A;  3MAV A;  3LGK A;  4RYP A;  3OAB A;  4NKE A;  3G4F A;  5JA0 F;  3SDV A;  2AEL A;  2E8T A;  3N46 F;  1YJ4 A;  4KVI A;  4KQU A;  3M9U A;  4K10 A;  2J1P A;  3KRF B;  4KQS A;  4NFK F;  3WCJ A;  1VG3 A;  2F9K F;  2ONG A;  3P41 A;  4LLT A;  3WEJ A;  2Z4V A;  3WEK A;  2Z7I A;  5EAS A;  4DWG A;  3WCL A;  3CKE A;  4KVD A;  5HN8 A;  3NPK A;  2J1O A;  4WK5 A;  5DGN F;  3WEH A;  4KPD A;  3WEI A;  3LOM A;  3QQV A;  4PVX F;  3WCC A;  4OKZ A;  3LMD A;  3UCA A;  2PS4 A;  3VJB A;  4H5C F;  3P5R A;  5DJP F;  5IKH A;  1FPS A;  3N0F A;  5ERM A;  2AEK A;  1HXC A;  3EFQ A;  4E9Z A;  3ICZ A;  5B02 A;  3N0G A;  1HX9 A;  3Q2Q A;  4GAX A;  4JXN A;  1DGP A;  2DH4 A;  3OAC B;  5B01 A;  5ILY A;  3N1W F;  3WC9 A;  4E1E A;  3AQ0 A;  5JUZ F;  4KKM A;  4Q23 A;  1YHK A;  3P8L A;  2E93 A;  2E8U A;  4FJQ A;  5ILI A;  3WJN A;  1WL1 A;  1JFG A;  4DEM F;  3DYF A;  5A0I A;  5AEL A;  5E8K A;  3WCE A;  5EAT A;  5IKA A;  3VJD A;  4RXD A;  3MZV A;  4LTV A;  3OAB B;  3WCH A;  5B0J A;  4GP2 A;  4LZ0 A;  2FTZ A;  5C05 A;  3ZOU A;  4KK2 A;  3WJO A;  4LZ3 A;  2ZCO A;  2F89 F;  1YHM A;  2E95 A;  3WEF A;  1VG7 A;  3Q2Z A;  4QPF A;  4F62 A;  4JXY A;  3RBM A;  2OPM A;  4DI5 A;  5IK0 A;  3N5J F;  3N45 F;  1UBX A;  4NFJ F;  3LGZ B;  4JZB A;  1WL2 A;  4RNQ A;  3AQC B;  3AE0 A;  2F92 F;  1YHL A;  3TC1 A;  5IK9 A;  4JZX A;  4OMG A;  4LXW A;  3TFP A;  5DHI A;  3WCD A;  5IL8 A;  2I19 A;  5IL3 A;  2AET A;  1EZF A;  1VG6 A;  2EWG A;  3WCF A;  4GP1 A;  3BNX A;  3VJC A;  3WCM A;  3KBK A;  1ZW5 A;  3VJ8 A;  1YYS A;  3V1V A;  2F94 F;  5AYP A;  5EAU A;  4KPJ A;  4XQR F;  3V66 A;  5DW7 A;  2F8C F;  4N1Z F;  3P8R A;  2FOR A;  5A0J A;  4L2X F;  3BNY A;  5I1U A;  1RTR A;  2RAH A;  3CC9 A;  4LUU A;  5HN9 A;  5A0K A;  2Q9Z A;  3NF2 A;  3PYA A;  4FP4 A;  4KQ5 A;  4LOB A;  4P0W A;  1YYR A;  4XQS F;  5B0M A;  3WCB A;  3SAE A;  1WY0 A;  2E8X A;  2Z52 A;  1N21 A;  1YYU A;  3LG5 A;  3WSA A;  2H8O A;  2Z78 A;  4GA3 A;  2F7M F;  3WCI A;  1HM7 A;  3LDW A;  3LVS A;  1WL3 A;  3SDU A;  5HN7 A;  1YYT A;  4H5D F;  3S9V A;  1HM4 A;  3N3L F;  4P0X A;  3QKC A;  5IM1 A;  2ZEU A;  4DXJ A;  4H5E F;  2Q80 A;  3VJE A;  3V1X A;  4LA5 A;  5AFX A;  3M02 A;  4LTZ A;  3N49 F;  5DGM F;  3ZMB A;  1VG4 A;  2E90 A;  3ZMC A;  2E92 A;  5ILD A;  5IMI A;  3ZL6 A;  3LSN A;  3CP6 A;  3WE9 A;  3WSB A;  4OKM A;  3ASX A;  3TFV A;  3S4J A;  2AZK A;  3ID0 A;  3OYR A; 
#chains in the Genus database with same CATH topology
 5CG5 A;  5IMP A;  3WJK A;  1PS1 A;  2ZEV A;  1KIY A;  2E8V A;  3IPI A;  4DHD A;  3KRP A;  3N3D A;  3SDR A;  1N1Z A;  3N6K F;  4LFE A;  3DYG A;  1WKZ A;  1V4I A;  3ICK A;  4MC3 A;  4MC0 A;  1V4K A;  5KSX F;  5B0L A;  1WL0 A;  3KRO A;  5AHU B;  5IVG A;  2Z4X A;  3B7L A;  5H9D A;  4ZQ8 A;  2QIS A;  2Z50 A;  2E4O A;  5IN8 A;  1YYQ A;  4LFG A;  5CG6 A;  1VG2 A;  2AZJ A;  5ILZ A;  4F6X A;  4LFV F;  2O1O A;  3ACW A;  4UMJ A;  1UBY A;  3LZ9 A;  3VJA A;  3KRC A;  3TFN A;  3WCG A;  5ER8 A;  4LLS A;  1N20 A;  3M0G A;  3PKO A;  2E91 A;  3KB9 A;  3ZCD A;  5JV2 F;  4DZW A;  3DYH A;  3PYB A;  5DZ2 A;  4XQT F;  3P5P A;  2ZCQ A;  3G4D A;  4RXE A;  3RYE A;  4LPG F;  4LIX A;  5IMN A;  1UBW A;  3N1V F;  2PS8 A;  5ILH A;  4PVY F;  5DJV F;  2Q9Y A;  1UBV A;  2OA6 A;  4LA6 A;  4NUA A;  2ONH A;  1N23 A;  3EZ3 A;  3LK5 A;  3M00 A;  1V4H A;  4OMH A;  3SDT A;  1N22 A;  5E8H A;  5ERO A;  5DIQ F;  2Q58 A;  4E9U A;  2E94 A;  2ZCR A;  4LZC A;  3KRA A;  2F8Z F;  3PH7 A;  5DGS F;  2Z4W A;  3KRP B;  1RQI A;  3M01 A;  4KFA A;  1KIZ A;  2Z7H A;  1N24 A;  5ILJ A;  5ERN A;  3KRO B;  4DWB A;  1N1B A;  5B00 A;  3LEE A;  4JYX A;  3KRF A;  1HXG A;  4HD1 A;  4RXA A;  4EA2 A;  3LLW A;  3WCA A;  2AZL A;  3ADZ A;  3ACY A;  5E8L A;  3VJ9 A;  1V4E A;  4P0V A;  3EGT A;  3N5H F;  2PS7 A;  4NG6 A;  4F6V A;  3WEG A;  3NPR A;  4QXS F;  3KRC B;  1DI1 A;  3NRI A;  3Q30 A;  3RMG A;  4LPH F;  4EA1 A;  3W7F A;  2E8W A;  3ICN A;  3APZ A;  5IK6 A;  1V4J A;  4N9U A;  3PDE A;  5DJR F;  5HNA A;  4OGU A;  5JV0 F;  2OGD A;  1JFA A;  3AQB B;  2J5C A;  4EA0 A;  1YV5 A;  2Z4Z A;  4JVJ F;  3TS7 A;  3RYW A;  3Q1O A;  4NFI F;  3SDQ A;  5DHK A;  3OAC A;  1WMW A;  1HXA A;  4KUX A;  2P1C A;  2ZY1 A;  2ZCS A;  5B03 A;  2PS6 A;  4KVW A;  2Z4Y A;  5JV1 F;  2VF6 A;  2PS5 A;  1YQ7 A;  5ILK A;  4KVY A;  4NKF A;  3ACX A;  4RXC A;  2OPN A;  4MC8 A;  5B0K A;  3ICM A;  3LJI A;  3IBA A;  5B0I A;  4KWD A;  3KRA B;  1RQJ A;  3MAV A;  3LGK A;  4RYP A;  3OAB A;  4NKE A;  3G4F A;  5JA0 F;  3SDV A;  2AEL A;  2E8T A;  3N46 F;  1YJ4 A;  4KVI A;  4KQU A;  3M9U A;  4K10 A;  2J1P A;  3KRF B;  4KQS A;  4NFK F;  3WCJ A;  1VG3 A;  2F9K F;  2ONG A;  3P41 A;  4LLT A;  3WEJ A;  2Z4V A;  3WEK A;  2Z7I A;  5EAS A;  4DWG A;  3WCL A;  3CKE A;  4KVD A;  5HN8 A;  3NPK A;  2J1O A;  4WK5 A;  5DGN F;  3WEH A;  4KPD A;  3WEI A;  3LOM A;  3QQV A;  4PVX F;  3WCC A;  4OKZ A;  3LMD A;  3UCA A;  2PS4 A;  3VJB A;  4H5C F;  3P5R A;  5DJP F;  5IKH A;  1FPS A;  3N0F A;  5ERM A;  2AEK A;  1HXC A;  3EFQ A;  4E9Z A;  3ICZ A;  5B02 A;  3N0G A;  1HX9 A;  3Q2Q A;  4GAX A;  4JXN A;  1DGP A;  2DH4 A;  3OAC B;  5B01 A;  5ILY A;  3N1W F;  3WC9 A;  4E1E A;  3AQ0 A;  5JUZ F;  4KKM A;  4Q23 A;  1YHK A;  3P8L A;  2E93 A;  2E8U A;  4FJQ A;  5ILI A;  3WJN A;  1WL1 A;  1JFG A;  4DEM F;  3DYF A;  5A0I A;  5AEL A;  5E8K A;  3WCE A;  5EAT A;  5IKA A;  3VJD A;  4RXD A;  3MZV A;  4LTV A;  3OAB B;  3WCH A;  5B0J A;  4GP2 A;  4LZ0 A;  2FTZ A;  5C05 A;  3ZOU A;  4KK2 A;  3WJO A;  4LZ3 A;  2ZCO A;  2F89 F;  1YHM A;  2E95 A;  3WEF A;  1VG7 A;  3Q2Z A;  4QPF A;  4F62 A;  4JXY A;  3RBM A;  2OPM A;  4DI5 A;  5IK0 A;  3N5J F;  3N45 F;  1UBX A;  4NFJ F;  3LGZ B;  4JZB A;  1WL2 A;  4RNQ A;  3AQC B;  3AE0 A;  2F92 F;  1YHL A;  3TC1 A;  5IK9 A;  4JZX A;  4OMG A;  4LXW A;  3TFP A;  5DHI A;  3WCD A;  5IL8 A;  2I19 A;  5IL3 A;  2AET A;  1EZF A;  1VG6 A;  2EWG A;  3WCF A;  4GP1 A;  3BNX A;  3VJC A;  3WCM A;  3KBK A;  1ZW5 A;  3VJ8 A;  1YYS A;  3V1V A;  2F94 F;  5AYP A;  5EAU A;  4KPJ A;  4XQR F;  3V66 A;  5DW7 A;  2F8C F;  4N1Z F;  3P8R A;  2FOR A;  5A0J A;  4L2X F;  3BNY A;  5I1U A;  1RTR A;  2RAH A;  3CC9 A;  4LUU A;  5HN9 A;  5A0K A;  2Q9Z A;  3NF2 A;  3PYA A;  4FP4 A;  4KQ5 A;  4LOB A;  4P0W A;  1YYR A;  4XQS F;  5B0M A;  3WCB A;  3SAE A;  1WY0 A;  2E8X A;  2Z52 A;  1N21 A;  1YYU A;  3LG5 A;  3WSA A;  2H8O A;  2Z78 A;  4GA3 A;  2F7M F;  3WCI A;  1HM7 A;  3LDW A;  3LVS A;  1WL3 A;  3SDU A;  5HN7 A;  1YYT A;  4H5D F;  3S9V A;  1HM4 A;  3N3L F;  4P0X A;  3QKC A;  5IM1 A;  2ZEU A;  4DXJ A;  4H5E F;  2Q80 A;  3VJE A;  3V1X A;  4LA5 A;  5AFX A;  3M02 A;  4LTZ A;  3N49 F;  5DGM F;  3ZMB A;  1VG4 A;  2E90 A;  3ZMC A;  2E92 A;  5ILD A;  5IMI A;  3ZL6 A;  3LSN A;  3CP6 A;  3WE9 A;  3WSB A;  4OKM A;  3ASX A;  3TFV A;  3S4J A;  2AZK A;  3ID0 A;  3OYR A; 
#chains in the Genus database with same CATH homology
 5CG5 A;  5IMP A;  3WJK A;  1PS1 A;  2ZEV A;  1KIY A;  2E8V A;  3IPI A;  4DHD A;  3KRP A;  3N3D A;  3SDR A;  1N1Z A;  3N6K F;  4LFE A;  3DYG A;  1WKZ A;  1V4I A;  3ICK A;  4MC3 A;  4MC0 A;  1V4K A;  5KSX F;  5B0L A;  1WL0 A;  3KRO A;  5AHU B;  5IVG A;  2Z4X A;  3B7L A;  5H9D A;  4ZQ8 A;  2QIS A;  2Z50 A;  2E4O A;  5IN8 A;  1YYQ A;  4LFG A;  5CG6 A;  1VG2 A;  2AZJ A;  5ILZ A;  4F6X A;  4LFV F;  2O1O A;  3ACW A;  4UMJ A;  1UBY A;  3LZ9 A;  3VJA A;  3KRC A;  3TFN A;  3WCG A;  5ER8 A;  4LLS A;  1N20 A;  3M0G A;  3PKO A;  2E91 A;  3KB9 A;  3ZCD A;  5JV2 F;  4DZW A;  3DYH A;  3PYB A;  5DZ2 A;  4XQT F;  3P5P A;  2ZCQ A;  3G4D A;  4RXE A;  3RYE A;  4LPG F;  4LIX A;  5IMN A;  1UBW A;  3N1V F;  2PS8 A;  5ILH A;  4PVY F;  5DJV F;  2Q9Y A;  1UBV A;  2OA6 A;  4LA6 A;  4NUA A;  2ONH A;  1N23 A;  3EZ3 A;  3LK5 A;  3M00 A;  1V4H A;  4OMH A;  3SDT A;  1N22 A;  5E8H A;  5ERO A;  5DIQ F;  2Q58 A;  4E9U A;  2E94 A;  2ZCR A;  4LZC A;  3KRA A;  2F8Z F;  3PH7 A;  5DGS F;  2Z4W A;  3KRP B;  1RQI A;  3M01 A;  4KFA A;  1KIZ A;  2Z7H A;  1N24 A;  5ILJ A;  5ERN A;  3KRO B;  4DWB A;  1N1B A;  5B00 A;  3LEE A;  4JYX A;  3KRF A;  1HXG A;  4HD1 A;  4RXA A;  4EA2 A;  3LLW A;  3WCA A;  2AZL A;  3ADZ A;  3ACY A;  5E8L A;  3VJ9 A;  1V4E A;  4P0V A;  3EGT A;  3N5H F;  2PS7 A;  4NG6 A;  4F6V A;  3WEG A;  3NPR A;  4QXS F;  3KRC B;  1DI1 A;  3NRI A;  3Q30 A;  3RMG A;  4LPH F;  4EA1 A;  3W7F A;  2E8W A;  3ICN A;  3APZ A;  5IK6 A;  1V4J A;  4N9U A;  3PDE A;  5DJR F;  5HNA A;  4OGU A;  5JV0 F;  2OGD A;  1JFA A;  3AQB B;  2J5C A;  4EA0 A;  1YV5 A;  2Z4Z A;  4JVJ F;  3TS7 A;  3RYW A;  3Q1O A;  4NFI F;  3SDQ A;  5DHK A;  3OAC A;  1WMW A;  1HXA A;  4KUX A;  2P1C A;  2ZY1 A;  2ZCS A;  5B03 A;  2PS6 A;  4KVW A;  2Z4Y A;  5JV1 F;  2VF6 A;  2PS5 A;  1YQ7 A;  5ILK A;  4KVY A;  4NKF A;  3ACX A;  4RXC A;  2OPN A;  4MC8 A;  5B0K A;  3ICM A;  3LJI A;  3IBA A;  5B0I A;  4KWD A;  3KRA B;  1RQJ A;  3MAV A;  3LGK A;  4RYP A;  3OAB A;  4NKE A;  3G4F A;  5JA0 F;  3SDV A;  2AEL A;  2E8T A;  3N46 F;  1YJ4 A;  4KVI A;  4KQU A;  3M9U A;  4K10 A;  2J1P A;  3KRF B;  4KQS A;  4NFK F;  3WCJ A;  1VG3 A;  2F9K F;  2ONG A;  3P41 A;  4LLT A;  3WEJ A;  2Z4V A;  3WEK A;  2Z7I A;  5EAS A;  4DWG A;  3WCL A;  3CKE A;  4KVD A;  5HN8 A;  3NPK A;  2J1O A;  4WK5 A;  5DGN F;  3WEH A;  4KPD A;  3WEI A;  3LOM A;  3QQV A;  4PVX F;  3WCC A;  4OKZ A;  3LMD A;  3UCA A;  2PS4 A;  3VJB A;  4H5C F;  3P5R A;  5DJP F;  5IKH A;  1FPS A;  3N0F A;  5ERM A;  2AEK A;  1HXC A;  3EFQ A;  4E9Z A;  3ICZ A;  5B02 A;  3N0G A;  1HX9 A;  3Q2Q A;  4GAX A;  4JXN A;  1DGP A;  2DH4 A;  3OAC B;  5B01 A;  5ILY A;  3N1W F;  3WC9 A;  4E1E A;  3AQ0 A;  5JUZ F;  4KKM A;  4Q23 A;  1YHK A;  3P8L A;  2E93 A;  2E8U A;  4FJQ A;  5ILI A;  3WJN A;  1WL1 A;  1JFG A;  4DEM F;  3DYF A;  5A0I A;  5AEL A;  5E8K A;  3WCE A;  5EAT A;  5IKA A;  3VJD A;  4RXD A;  3MZV A;  4LTV A;  3OAB B;  3WCH A;  5B0J A;  4GP2 A;  4LZ0 A;  2FTZ A;  5C05 A;  3ZOU A;  4KK2 A;  3WJO A;  4LZ3 A;  2ZCO A;  2F89 F;  1YHM A;  2E95 A;  3WEF A;  1VG7 A;  3Q2Z A;  4QPF A;  4F62 A;  4JXY A;  3RBM A;  2OPM A;  4DI5 A;  5IK0 A;  3N5J F;  3N45 F;  1UBX A;  4NFJ F;  3LGZ B;  4JZB A;  1WL2 A;  4RNQ A;  3AQC B;  3AE0 A;  2F92 F;  1YHL A;  3TC1 A;  5IK9 A;  4JZX A;  4OMG A;  4LXW A;  3TFP A;  5DHI A;  3WCD A;  5IL8 A;  2I19 A;  5IL3 A;  2AET A;  1EZF A;  1VG6 A;  2EWG A;  3WCF A;  4GP1 A;  3BNX A;  3VJC A;  3WCM A;  3KBK A;  1ZW5 A;  3VJ8 A;  1YYS A;  3V1V A;  2F94 F;  5AYP A;  5EAU A;  4KPJ A;  4XQR F;  3V66 A;  5DW7 A;  2F8C F;  4N1Z F;  3P8R A;  2FOR A;  5A0J A;  4L2X F;  3BNY A;  5I1U A;  1RTR A;  2RAH A;  3CC9 A;  4LUU A;  5HN9 A;  5A0K A;  2Q9Z A;  3NF2 A;  3PYA A;  4FP4 A;  4KQ5 A;  4LOB A;  4P0W A;  1YYR A;  4XQS F;  5B0M A;  3WCB A;  3SAE A;  1WY0 A;  2E8X A;  2Z52 A;  1N21 A;  1YYU A;  3LG5 A;  3WSA A;  2H8O A;  2Z78 A;  4GA3 A;  2F7M F;  3WCI A;  1HM7 A;  3LDW A;  3LVS A;  1WL3 A;  3SDU A;  5HN7 A;  1YYT A;  4H5D F;  3S9V A;  1HM4 A;  3N3L F;  4P0X A;  3QKC A;  5IM1 A;  2ZEU A;  4DXJ A;  4H5E F;  2Q80 A;  3VJE A;  3V1X A;  4LA5 A;  5AFX A;  3M02 A;  4LTZ A;  3N49 F;  5DGM F;  3ZMB A;  1VG4 A;  2E90 A;  3ZMC A;  2E92 A;  5ILD A;  5IMI A;  3ZL6 A;  3LSN A;  3CP6 A;  3WE9 A;  3WSB A;  4OKM A;  3ASX A;  3TFV A;  3S4J A;  2AZK A;  3ID0 A;  3OYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...