5B03A

Structure of moen5-sso7d fusion protein in complex with geranyl pyrophosphate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
264
structure length
264
Chain Sequence
VDDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MoeN5,DNA-binding protein 7d
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
molecule tags Transferase, dna binding protein
total genus 115
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b03A00
2Q9ZA 3SDUA 4K10A 3Q2ZA 3KRFB 4GA3A 5B02A 3RMGA 3N45F 3M01A 4RXEA 5E8LA 5JUZF 4F6VA 3WEFA 2ZEVA 3W7FA 4LLSA 2EWGA 5IVGA 2Z4ZA 5AYPA 3ACYA 3OYRA 1N21A 1HX9A 2E91A 4LIXA 3AE0A 3WJNA 3N0FA 5IMNA 4LA5A 5B0MA 4DXJA 3PH7A 2Z50A 1ZW5A 1RTRA 3M02A 3G4FA 1VG3A 3WEHA 2E4OA 3ZL6A 4P0XA 5DW7A 2E93A 3WSBA 3UCAA 4LXWA 4FP4A 5IK0A 4P0VA 1N1ZA 5DHIA 4KQUA 3WCGA 5DJRF 5C05A 4KQ5A 4KVWA 3IPIA 5HN8A 3LMDA 3MZVA 3WJKA 3DYFA 4QPFA 2FORA 5ILYA 4NFKF 1N22A 3EFQA 5ILDA 3PDEA 4GAXA 4OKZA 3LZ9A 3P5PA 5A0JA 3TS7A 1RQIA 1N1BA 3P41A 2F9KF 5JV2F 2ZY1A 3CKEA 1YYUA 3SDQA 2E92A 3V66A 2OGDA 5IL8A 3QKCA 4MC3A 3KRAB 4XQRF 1KIZA 3N46F 5DZ2A 2AZLA 4LUUA 2ONHA 4OGUA 2Z4YA 3WC9A 1YHMA 2Z52A 3NPKA 4N1ZF 2AEKA 3KRCA 5ILJA 3TC1A 3VJEA 2OPNA 2Z4WA 1PS1A 4HD1A 4LTVA 5HN9A 2F89F 4XQTF 5ER8A 3KRPA 3MAVA 2OA6A 4Q23A 5IKHA 5IN8A 4RXCA 4GP2A 1HM4A 1YYRA 3LK5A 3B7LA 2QISA 5DJVF 2PS7A 5AELA 3PYBA 4JXNA 4NKFA 3CP6A 4LA6A 3N6KF 2AZKA 3LDWA 5E8HA 3CC9A 4E9UA 1VG4A 3WEGA 2F92F 3TFNA 3WCCA 5E8KA 1YV5A 3M00A 1YYQA 4XQSF 1WKZA 1V4IA 5DJPF 3BNXA 3WJOA 4JVJF 5ILIA 1YHLA 3V1XA 3KRFA 2E8UA 5KSXF 4KPDA 5ERMA 3WCIA 2Q80A 2AZJA 4KQSA 3WCJA 1YYSA 4RXAA 2J5CA 1WMWA 4P0WA 2RAHA 2ZEUA 1HXGA 3WE9A 4L2XF 3ACWA 3OABB 2Z78A 4LPHF 4LLTA 5IMPA 3NRIA 3WCAA 4N9UA 4QXSF 4NKEA 3LJIA 1UBXA 4PVYF 3N5HF 2PS8A 3WCLA 4DWGA 3Q30A 4GP1A 1UBYA 2DH4A 3G4DA 5CG5A 3KROB 3RBMA 2FTZA 5IM1A 1FPSA 1V4HA 4MC8A 2F8ZF 1VG2A 5DHKA 1WL0A 4H5DF 3N5JF 5IK9A 5EAUA 2E94A 4H5CF 3N3LF 3WCBA 4DI5A 3KROA 2AELA 1DGPA 4ZQ8A 5HN7A 3ICKA 3LVSA 1UBWA 3ZMCA 3ZOUA 3N1WF 4LFVF 1UBVA 5A0KA 3P8LA 3N3DA 3SDRA 1N20A 3LGZB 3PYAA 5H9DA 5JV1F 3LSNA 3LEEA 3VJBA 5ILZA 2I19A 2E95A 2O1OA 4PVXF 4FJQA 3VJ8A 5DIQF 4RNQA 3M9UA 3DYGA 3DYHA 5DGNF 5B0KA 5I1UA 3ICZA 4KPJA 4LZCA 5B0IA 2F94F 5B01A 3LG5A 5EROA 4MC0A 4OMGA 3KRAA 5IKAA 3KBKA 1V4EA 4LFEA 4NUAA 1YHKA 3S4JA 2VF6A 2Z7HA 5A0IA 4LPGF 4NG6A 2ZCOA 3TFVA 1N24A 4RXDA 5B0LA 2Q9YA 4UMJA 1YQ7A 3Q2QA 3Q1OA 3ZMBA 1HXAA 4E9ZA 2ZCRA 1HXCA 3LGKA 5AFXA 3WEIA 5ILKA 1HM7A 1DI1A 4KVDA 3AQBB 3AQCB 3IBAA 3WCFA 5DGMF 2F7MF 4KVIA 3P5RA 3EGTA 3QQVA 4JZBA 3N1VF 2J1OA 3N0GA 4KWDA 4H5EF 5B00A 1JFAA 4LTZA 4LOBA 3ASXA 4EA1A 4JYXA 2J1PA 5CG6A 3ICMA 3WEJA 5ERNA 4EA2A 1N23A 4JZXA 4OKMA 4LZ3A 1WL3A 2Q58A 3RYWA 3P8RA 5JA0F 4E1EA 2E90A 3SDVA 4EA0A 2E8WA 4F6XA 5EASA 3V1VA 1YJ4A 1RQJA 1EZFA 3EZ3A 3S9VA 3AQ0A 1YYTA 4DEMF 3RYEA 3OACB 3LLWA 3OABA 5DGSF 1WY0A 5IL3A 4LFGA 3ICNA 3VJAA 1VG6A 2PS4A 3WCDA 3SAEA 5IMIA 3TFPA 3WSAA 5B03A 2ONGA 2PS5A 3ID0A 2ZCSA 2E8VA 3ADZA 3M0GA 1WL1A 1KIYA 3PKOA 1JFGA 2AETA 3APZA 2ZCQA 3WCMA 4F62A 3KB9A 4NFIF 2OPMA 4RYPA 3WCEA 3OACA 1WL2A 1V4KA 2F8CF 3VJ9A 5EATA 4JXYA 2E8XA 2E8TA 3N49F 5JV0F 4KK2A 3WEKA 3KRCB 3NPRA 5AHUB 2Z4VA 3KRPB 4DHDA 4LZ0A 2PS6A 3BNYA 2Z7IA 3VJCA 4WK5A 1V4JA 3ZCDA 5IK6A 3VJDA 5ILHA 3LOMA 5HNAA 4OMHA 2Z4XA 4KFAA 4KVYA 5B0JA 3WCHA 2H8OA 4KKMA 4DWBA 3ACXA 2P1CA 3SDTA 4NFJF 4KUXA 1VG7A 3NF2A 4DZWA
chains in the Genus database with same CATH superfamily
2Q9ZA 3SDUA 4K10A 3Q2ZA 3KRFB 4GA3A 5B02A 3RMGA 3N45F 3M01A 4RXEA 5E8LA 5JUZF 4F6VA 3WEFA 2ZEVA 3W7FA 4LLSA 2EWGA 5IVGA 2Z4ZA 5AYPA 3ACYA 3OYRA 1N21A 1HX9A 2E91A 4LIXA 3AE0A 3WJNA 3N0FA 5IMNA 4LA5A 5B0MA 4DXJA 3PH7A 2Z50A 1ZW5A 1RTRA 3M02A 3G4FA 1VG3A 3WEHA 2E4OA 3ZL6A 4P0XA 5DW7A 2E93A 3WSBA 3UCAA 4LXWA 4FP4A 5IK0A 4P0VA 1N1ZA 5DHIA 4KQUA 3WCGA 5DJRF 5C05A 4KQ5A 4KVWA 3IPIA 5HN8A 3LMDA 3MZVA 3WJKA 3DYFA 4QPFA 2FORA 5ILYA 4NFKF 1N22A 3EFQA 5ILDA 3PDEA 4GAXA 4OKZA 3LZ9A 3P5PA 5A0JA 3TS7A 1RQIA 1N1BA 3P41A 2F9KF 5JV2F 2ZY1A 3CKEA 1YYUA 3SDQA 2E92A 3V66A 2OGDA 5IL8A 3QKCA 4MC3A 3KRAB 4XQRF 1KIZA 3N46F 5DZ2A 2AZLA 4LUUA 2ONHA 4OGUA 2Z4YA 3WC9A 1YHMA 2Z52A 3NPKA 4N1ZF 2AEKA 3KRCA 5ILJA 3TC1A 3VJEA 2OPNA 2Z4WA 1PS1A 4HD1A 4LTVA 5HN9A 2F89F 4XQTF 5ER8A 3KRPA 3MAVA 2OA6A 4Q23A 5IKHA 5IN8A 4RXCA 4GP2A 1HM4A 1YYRA 3LK5A 3B7LA 2QISA 5DJVF 2PS7A 5AELA 3PYBA 4JXNA 4NKFA 3CP6A 4LA6A 3N6KF 2AZKA 3LDWA 5E8HA 3CC9A 4E9UA 1VG4A 3WEGA 2F92F 3TFNA 3WCCA 5E8KA 1YV5A 3M00A 1YYQA 4XQSF 1WKZA 1V4IA 5DJPF 3BNXA 3WJOA 4JVJF 5ILIA 1YHLA 3V1XA 3KRFA 2E8UA 5KSXF 4KPDA 5ERMA 3WCIA 2Q80A 2AZJA 4KQSA 3WCJA 1YYSA 4RXAA 2J5CA 1WMWA 4P0WA 2RAHA 2ZEUA 1HXGA 3WE9A 4L2XF 3ACWA 3OABB 2Z78A 4LPHF 4LLTA 5IMPA 3NRIA 3WCAA 4N9UA 4QXSF 4NKEA 3LJIA 1UBXA 4PVYF 3N5HF 2PS8A 3WCLA 4DWGA 3Q30A 4GP1A 1UBYA 2DH4A 3G4DA 5CG5A 3KROB 3RBMA 2FTZA 5IM1A 1FPSA 1V4HA 4MC8A 2F8ZF 1VG2A 5DHKA 1WL0A 4H5DF 3N5JF 5IK9A 5EAUA 2E94A 4H5CF 3N3LF 3WCBA 4DI5A 3KROA 2AELA 1DGPA 4ZQ8A 5HN7A 3ICKA 3LVSA 1UBWA 3ZMCA 3ZOUA 3N1WF 4LFVF 1UBVA 5A0KA 3P8LA 3N3DA 3SDRA 1N20A 3LGZB 3PYAA 5H9DA 5JV1F 3LSNA 3LEEA 3VJBA 5ILZA 2I19A 2E95A 2O1OA 4PVXF 4FJQA 3VJ8A 5DIQF 4RNQA 3M9UA 3DYGA 3DYHA 5DGNF 5B0KA 5I1UA 3ICZA 4KPJA 4LZCA 5B0IA 2F94F 5B01A 3LG5A 5EROA 4MC0A 4OMGA 3KRAA 5IKAA 3KBKA 1V4EA 4LFEA 4NUAA 1YHKA 3S4JA 2VF6A 2Z7HA 5A0IA 4LPGF 4NG6A 2ZCOA 3TFVA 1N24A 4RXDA 5B0LA 2Q9YA 4UMJA 1YQ7A 3Q2QA 3Q1OA 3ZMBA 1HXAA 4E9ZA 2ZCRA 1HXCA 3LGKA 5AFXA 3WEIA 5ILKA 1HM7A 1DI1A 4KVDA 3AQBB 3AQCB 3IBAA 3WCFA 5DGMF 2F7MF 4KVIA 3P5RA 3EGTA 3QQVA 4JZBA 3N1VF 2J1OA 3N0GA 4KWDA 4H5EF 5B00A 1JFAA 4LTZA 4LOBA 3ASXA 4EA1A 4JYXA 2J1PA 5CG6A 3ICMA 3WEJA 5ERNA 4EA2A 1N23A 4JZXA 4OKMA 4LZ3A 1WL3A 2Q58A 3RYWA 3P8RA 5JA0F 4E1EA 2E90A 3SDVA 4EA0A 2E8WA 4F6XA 5EASA 3V1VA 1YJ4A 1RQJA 1EZFA 3EZ3A 3S9VA 3AQ0A 1YYTA 4DEMF 3RYEA 3OACB 3LLWA 3OABA 5DGSF 1WY0A 5IL3A 4LFGA 3ICNA 3VJAA 1VG6A 2PS4A 3WCDA 3SAEA 5IMIA 3TFPA 3WSAA 5B03A 2ONGA 2PS5A 3ID0A 2ZCSA 2E8VA 3ADZA 3M0GA 1WL1A 1KIYA 3PKOA 1JFGA 2AETA 3APZA 2ZCQA 3WCMA 4F62A 3KB9A 4NFIF 2OPMA 4RYPA 3WCEA 3OACA 1WL2A 1V4KA 2F8CF 3VJ9A 5EATA 4JXYA 2E8XA 2E8TA 3N49F 5JV0F 4KK2A 3WEKA 3KRCB 3NPRA 5AHUB 2Z4VA 3KRPB 4DHDA 4LZ0A 2PS6A 3BNYA 2Z7IA 3VJCA 4WK5A 1V4JA 3ZCDA 5IK6A 3VJDA 5ILHA 3LOMA 5HNAA 4OMHA 2Z4XA 4KFAA 4KVYA 5B0JA 3WCHA 2H8OA 4KKMA 4DWBA 3ACXA 2P1CA 3SDTA 4NFJF 4KUXA 1VG7A 3NF2A 4DZWA
chains in the Genus database with same CATH topology
2Q9ZA 3SDUA 4K10A 3Q2ZA 3KRFB 4GA3A 5B02A 3RMGA 3N45F 3M01A 4RXEA 5E8LA 5JUZF 4F6VA 3WEFA 2ZEVA 3W7FA 4LLSA 2EWGA 5IVGA 2Z4ZA 5AYPA 3ACYA 3OYRA 1N21A 1HX9A 2E91A 4LIXA 3AE0A 3WJNA 3N0FA 5IMNA 4LA5A 5B0MA 4DXJA 3PH7A 2Z50A 1ZW5A 1RTRA 3M02A 3G4FA 1VG3A 3WEHA 2E4OA 3ZL6A 4P0XA 5DW7A 2E93A 3WSBA 3UCAA 4LXWA 4FP4A 5IK0A 4P0VA 1N1ZA 5DHIA 4KQUA 3WCGA 5DJRF 5C05A 4KQ5A 4KVWA 3IPIA 5HN8A 3LMDA 3MZVA 3WJKA 3DYFA 4QPFA 2FORA 5ILYA 4NFKF 1N22A 3EFQA 5ILDA 3PDEA 4GAXA 4OKZA 3LZ9A 3P5PA 5A0JA 3TS7A 1RQIA 1N1BA 3P41A 2F9KF 5JV2F 2ZY1A 3CKEA 1YYUA 3SDQA 2E92A 3V66A 2OGDA 5IL8A 3QKCA 4MC3A 3KRAB 4XQRF 1KIZA 3N46F 5DZ2A 2AZLA 4LUUA 2ONHA 4OGUA 2Z4YA 3WC9A 1YHMA 2Z52A 3NPKA 4N1ZF 2AEKA 3KRCA 5ILJA 3TC1A 3VJEA 2OPNA 2Z4WA 1PS1A 4HD1A 4LTVA 5HN9A 2F89F 4XQTF 5ER8A 3KRPA 3MAVA 2OA6A 4Q23A 5IKHA 5IN8A 4RXCA 4GP2A 1HM4A 1YYRA 3LK5A 3B7LA 2QISA 5DJVF 2PS7A 5AELA 3PYBA 4JXNA 4NKFA 3CP6A 4LA6A 3N6KF 2AZKA 3LDWA 5E8HA 3CC9A 4E9UA 1VG4A 3WEGA 2F92F 3TFNA 3WCCA 5E8KA 1YV5A 3M00A 1YYQA 4XQSF 1WKZA 1V4IA 5DJPF 3BNXA 3WJOA 4JVJF 5ILIA 1YHLA 3V1XA 3KRFA 2E8UA 5KSXF 4KPDA 5ERMA 3WCIA 2Q80A 2AZJA 4KQSA 3WCJA 1YYSA 4RXAA 2J5CA 1WMWA 4P0WA 2RAHA 2ZEUA 1HXGA 3WE9A 4L2XF 3ACWA 3OABB 2Z78A 4LPHF 4LLTA 5IMPA 3NRIA 3WCAA 4N9UA 4QXSF 4NKEA 3LJIA 1UBXA 4PVYF 3N5HF 2PS8A 3WCLA 4DWGA 3Q30A 4GP1A 1UBYA 2DH4A 3G4DA 5CG5A 3KROB 3RBMA 2FTZA 5IM1A 1FPSA 1V4HA 4MC8A 2F8ZF 1VG2A 5DHKA 1WL0A 4H5DF 3N5JF 5IK9A 5EAUA 2E94A 4H5CF 3N3LF 3WCBA 4DI5A 3KROA 2AELA 1DGPA 4ZQ8A 5HN7A 3ICKA 3LVSA 1UBWA 3ZMCA 3ZOUA 3N1WF 4LFVF 1UBVA 5A0KA 3P8LA 3N3DA 3SDRA 1N20A 3LGZB 3PYAA 5H9DA 5JV1F 3LSNA 3LEEA 3VJBA 5ILZA 2I19A 2E95A 2O1OA 4PVXF 4FJQA 3VJ8A 5DIQF 4RNQA 3M9UA 3DYGA 3DYHA 5DGNF 5B0KA 5I1UA 3ICZA 4KPJA 4LZCA 5B0IA 2F94F 5B01A 3LG5A 5EROA 4MC0A 4OMGA 3KRAA 5IKAA 3KBKA 1V4EA 4LFEA 4NUAA 1YHKA 3S4JA 2VF6A 2Z7HA 5A0IA 4LPGF 4NG6A 2ZCOA 3TFVA 1N24A 4RXDA 5B0LA 2Q9YA 4UMJA 1YQ7A 3Q2QA 3Q1OA 3ZMBA 1HXAA 4E9ZA 2ZCRA 1HXCA 3LGKA 5AFXA 3WEIA 5ILKA 1HM7A 1DI1A 4KVDA 3AQBB 3AQCB 3IBAA 3WCFA 5DGMF 2F7MF 4KVIA 3P5RA 3EGTA 3QQVA 4JZBA 3N1VF 2J1OA 3N0GA 4KWDA 4H5EF 5B00A 1JFAA 4LTZA 4LOBA 3ASXA 4EA1A 4JYXA 2J1PA 5CG6A 3ICMA 3WEJA 5ERNA 4EA2A 1N23A 4JZXA 4OKMA 4LZ3A 1WL3A 2Q58A 3RYWA 3P8RA 5JA0F 4E1EA 2E90A 3SDVA 4EA0A 2E8WA 4F6XA 5EASA 3V1VA 1YJ4A 1RQJA 1EZFA 3EZ3A 3S9VA 3AQ0A 1YYTA 4DEMF 3RYEA 3OACB 3LLWA 3OABA 5DGSF 1WY0A 5IL3A 4LFGA 3ICNA 3VJAA 1VG6A 2PS4A 3WCDA 3SAEA 5IMIA 3TFPA 3WSAA 5B03A 2ONGA 2PS5A 3ID0A 2ZCSA 2E8VA 3ADZA 3M0GA 1WL1A 1KIYA 3PKOA 1JFGA 2AETA 3APZA 2ZCQA 3WCMA 4F62A 3KB9A 4NFIF 2OPMA 4RYPA 3WCEA 3OACA 1WL2A 1V4KA 2F8CF 3VJ9A 5EATA 4JXYA 2E8XA 2E8TA 3N49F 5JV0F 4KK2A 3WEKA 3KRCB 3NPRA 5AHUB 2Z4VA 3KRPB 4DHDA 4LZ0A 2PS6A 3BNYA 2Z7IA 3VJCA 4WK5A 1V4JA 3ZCDA 5IK6A 3VJDA 5ILHA 3LOMA 5HNAA 4OMHA 2Z4XA 4KFAA 4KVYA 5B0JA 3WCHA 2H8OA 4KKMA 4DWBA 3ACXA 2P1CA 3SDTA 4NFJF 4KUXA 1VG7A 3NF2A 4DZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9Z A;  3SDU A;  4K10 A;  3Q2Z A;  3KRF B;  4GA3 A;  5B02 A;  3RMG A;  3N45 F;  3M01 A;  4RXE A;  5E8L A;  5JUZ F;  4F6V A;  3WEF A;  2ZEV A;  3W7F A;  4LLS A;  2EWG A;  5IVG A;  2Z4Z A;  5AYP A;  3ACY A;  3OYR A;  1N21 A;  1HX9 A;  2E91 A;  4LIX A;  3AE0 A;  3WJN A;  3N0F A;  5IMN A;  4LA5 A;  5B0M A;  4DXJ A;  3PH7 A;  2Z50 A;  1ZW5 A;  1RTR A;  3M02 A;  3G4F A;  1VG3 A;  3WEH A;  2E4O A;  3ZL6 A;  4P0X A;  5DW7 A;  2E93 A;  3WSB A;  3UCA A;  4LXW A;  4FP4 A;  5IK0 A;  4P0V A;  1N1Z A;  5DHI A;  4KQU A;  3WCG A;  5DJR F;  5C05 A;  4KQ5 A;  4KVW A;  3IPI A;  5HN8 A;  3LMD A;  3MZV A;  3WJK A;  3DYF A;  4QPF A;  2FOR A;  5ILY A;  4NFK F;  1N22 A;  3EFQ A;  5ILD A;  3PDE A;  4GAX A;  4OKZ A;  3LZ9 A;  3P5P A;  5A0J A;  3TS7 A;  1RQI A;  1N1B A;  3P41 A;  2F9K F;  5JV2 F;  2ZY1 A;  3CKE A;  1YYU A;  3SDQ A;  2E92 A;  3V66 A;  2OGD A;  5IL8 A;  3QKC A;  4MC3 A;  3KRA B;  4XQR F;  1KIZ A;  3N46 F;  5DZ2 A;  2AZL A;  4LUU A;  2ONH A;  4OGU A;  2Z4Y A;  3WC9 A;  1YHM A;  2Z52 A;  3NPK A;  4N1Z F;  2AEK A;  3KRC A;  5ILJ A;  3TC1 A;  3VJE A;  2OPN A;  2Z4W A;  1PS1 A;  4HD1 A;  4LTV A;  5HN9 A;  2F89 F;  4XQT F;  5ER8 A;  3KRP A;  3MAV A;  2OA6 A;  4Q23 A;  5IKH A;  5IN8 A;  4RXC A;  4GP2 A;  1HM4 A;  1YYR A;  3LK5 A;  3B7L A;  2QIS A;  5DJV F;  2PS7 A;  5AEL A;  3PYB A;  4JXN A;  4NKF A;  3CP6 A;  4LA6 A;  3N6K F;  2AZK A;  3LDW A;  5E8H A;  3CC9 A;  4E9U A;  1VG4 A;  3WEG A;  2F92 F;  3TFN A;  3WCC A;  5E8K A;  1YV5 A;  3M00 A;  1YYQ A;  4XQS F;  1WKZ A;  1V4I A;  5DJP F;  3BNX A;  3WJO A;  4JVJ F;  5ILI A;  1YHL A;  3V1X A;  3KRF A;  2E8U A;  5KSX F;  4KPD A;  5ERM A;  3WCI A;  2Q80 A;  2AZJ A;  4KQS A;  3WCJ A;  1YYS A;  4RXA A;  2J5C A;  1WMW A;  4P0W A;  2RAH A;  2ZEU A;  1HXG A;  3WE9 A;  4L2X F;  3ACW A;  3OAB B;  2Z78 A;  4LPH F;  4LLT A;  5IMP A;  3NRI A;  3WCA A;  4N9U A;  4QXS F;  4NKE A;  3LJI A;  1UBX A;  4PVY F;  3N5H F;  2PS8 A;  3WCL A;  4DWG A;  3Q30 A;  4GP1 A;  1UBY A;  2DH4 A;  3G4D A;  5CG5 A;  3KRO B;  3RBM A;  2FTZ A;  5IM1 A;  1FPS A;  1V4H A;  4MC8 A;  2F8Z F;  1VG2 A;  5DHK A;  1WL0 A;  4H5D F;  3N5J F;  5IK9 A;  5EAU A;  2E94 A;  4H5C F;  3N3L F;  3WCB A;  4DI5 A;  3KRO A;  2AEL A;  1DGP A;  4ZQ8 A;  5HN7 A;  3ICK A;  3LVS A;  1UBW A;  3ZMC A;  3ZOU A;  3N1W F;  4LFV F;  1UBV A;  5A0K A;  3P8L A;  3N3D A;  3SDR A;  1N20 A;  3LGZ B;  3PYA A;  5H9D A;  5JV1 F;  3LSN A;  3LEE A;  3VJB A;  5ILZ A;  2I19 A;  2E95 A;  2O1O A;  4PVX F;  4FJQ A;  3VJ8 A;  5DIQ F;  4RNQ A;  3M9U A;  3DYG A;  3DYH A;  5DGN F;  5B0K A;  5I1U A;  3ICZ A;  4KPJ A;  4LZC A;  5B0I A;  2F94 F;  5B01 A;  3LG5 A;  5ERO A;  4MC0 A;  4OMG A;  3KRA A;  5IKA A;  3KBK A;  1V4E A;  4LFE A;  4NUA A;  1YHK A;  3S4J A;  2VF6 A;  2Z7H A;  5A0I A;  4LPG F;  4NG6 A;  2ZCO A;  3TFV A;  1N24 A;  4RXD A;  5B0L A;  2Q9Y A;  4UMJ A;  1YQ7 A;  3Q2Q A;  3Q1O A;  3ZMB A;  1HXA A;  4E9Z A;  2ZCR A;  1HXC A;  3LGK A;  5AFX A;  3WEI A;  5ILK A;  1HM7 A;  1DI1 A;  4KVD A;  3AQB B;  3AQC B;  3IBA A;  3WCF A;  5DGM F;  2F7M F;  4KVI A;  3P5R A;  3EGT A;  3QQV A;  4JZB A;  3N1V F;  2J1O A;  3N0G A;  4KWD A;  4H5E F;  5B00 A;  1JFA A;  4LTZ A;  4LOB A;  3ASX A;  4EA1 A;  4JYX A;  2J1P A;  5CG6 A;  3ICM A;  3WEJ A;  5ERN A;  4EA2 A;  1N23 A;  4JZX A;  4OKM A;  4LZ3 A;  1WL3 A;  2Q58 A;  3RYW A;  3P8R A;  5JA0 F;  4E1E A;  2E90 A;  3SDV A;  4EA0 A;  2E8W A;  4F6X A;  5EAS A;  3V1V A;  1YJ4 A;  1RQJ A;  1EZF A;  3EZ3 A;  3S9V A;  3AQ0 A;  1YYT A;  4DEM F;  3RYE A;  3OAC B;  3LLW A;  3OAB A;  5DGS F;  1WY0 A;  5IL3 A;  4LFG A;  3ICN A;  3VJA A;  1VG6 A;  2PS4 A;  3WCD A;  3SAE A;  5IMI A;  3TFP A;  3WSA A;  5B03 A;  2ONG A;  2PS5 A;  3ID0 A;  2ZCS A;  2E8V A;  3ADZ A;  3M0G A;  1WL1 A;  1KIY A;  3PKO A;  1JFG A;  2AET A;  3APZ A;  2ZCQ A;  3WCM A;  4F62 A;  3KB9 A;  4NFI F;  2OPM A;  4RYP A;  3WCE A;  3OAC A;  1WL2 A;  1V4K A;  2F8C F;  3VJ9 A;  5EAT A;  4JXY A;  2E8X A;  2E8T A;  3N49 F;  5JV0 F;  4KK2 A;  3WEK A;  3KRC B;  3NPR A;  5AHU B;  2Z4V A;  3KRP B;  4DHD A;  4LZ0 A;  2PS6 A;  3BNY A;  2Z7I A;  3VJC A;  4WK5 A;  1V4J A;  3ZCD A;  5IK6 A;  3VJD A;  5ILH A;  3LOM A;  5HNA A;  4OMH A;  2Z4X A;  4KFA A;  4KVY A;  5B0J A;  3WCH A;  2H8O A;  4KKM A;  4DWB A;  3ACX A;  2P1C A;  3SDT A;  4NFJ F;  4KUX A;  1VG7 A;  3NF2 A;  4DZW A; 
#chains in the Genus database with same CATH topology
 2Q9Z A;  3SDU A;  4K10 A;  3Q2Z A;  3KRF B;  4GA3 A;  5B02 A;  3RMG A;  3N45 F;  3M01 A;  4RXE A;  5E8L A;  5JUZ F;  4F6V A;  3WEF A;  2ZEV A;  3W7F A;  4LLS A;  2EWG A;  5IVG A;  2Z4Z A;  5AYP A;  3ACY A;  3OYR A;  1N21 A;  1HX9 A;  2E91 A;  4LIX A;  3AE0 A;  3WJN A;  3N0F A;  5IMN A;  4LA5 A;  5B0M A;  4DXJ A;  3PH7 A;  2Z50 A;  1ZW5 A;  1RTR A;  3M02 A;  3G4F A;  1VG3 A;  3WEH A;  2E4O A;  3ZL6 A;  4P0X A;  5DW7 A;  2E93 A;  3WSB A;  3UCA A;  4LXW A;  4FP4 A;  5IK0 A;  4P0V A;  1N1Z A;  5DHI A;  4KQU A;  3WCG A;  5DJR F;  5C05 A;  4KQ5 A;  4KVW A;  3IPI A;  5HN8 A;  3LMD A;  3MZV A;  3WJK A;  3DYF A;  4QPF A;  2FOR A;  5ILY A;  4NFK F;  1N22 A;  3EFQ A;  5ILD A;  3PDE A;  4GAX A;  4OKZ A;  3LZ9 A;  3P5P A;  5A0J A;  3TS7 A;  1RQI A;  1N1B A;  3P41 A;  2F9K F;  5JV2 F;  2ZY1 A;  3CKE A;  1YYU A;  3SDQ A;  2E92 A;  3V66 A;  2OGD A;  5IL8 A;  3QKC A;  4MC3 A;  3KRA B;  4XQR F;  1KIZ A;  3N46 F;  5DZ2 A;  2AZL A;  4LUU A;  2ONH A;  4OGU A;  2Z4Y A;  3WC9 A;  1YHM A;  2Z52 A;  3NPK A;  4N1Z F;  2AEK A;  3KRC A;  5ILJ A;  3TC1 A;  3VJE A;  2OPN A;  2Z4W A;  1PS1 A;  4HD1 A;  4LTV A;  5HN9 A;  2F89 F;  4XQT F;  5ER8 A;  3KRP A;  3MAV A;  2OA6 A;  4Q23 A;  5IKH A;  5IN8 A;  4RXC A;  4GP2 A;  1HM4 A;  1YYR A;  3LK5 A;  3B7L A;  2QIS A;  5DJV F;  2PS7 A;  5AEL A;  3PYB A;  4JXN A;  4NKF A;  3CP6 A;  4LA6 A;  3N6K F;  2AZK A;  3LDW A;  5E8H A;  3CC9 A;  4E9U A;  1VG4 A;  3WEG A;  2F92 F;  3TFN A;  3WCC A;  5E8K A;  1YV5 A;  3M00 A;  1YYQ A;  4XQS F;  1WKZ A;  1V4I A;  5DJP F;  3BNX A;  3WJO A;  4JVJ F;  5ILI A;  1YHL A;  3V1X A;  3KRF A;  2E8U A;  5KSX F;  4KPD A;  5ERM A;  3WCI A;  2Q80 A;  2AZJ A;  4KQS A;  3WCJ A;  1YYS A;  4RXA A;  2J5C A;  1WMW A;  4P0W A;  2RAH A;  2ZEU A;  1HXG A;  3WE9 A;  4L2X F;  3ACW A;  3OAB B;  2Z78 A;  4LPH F;  4LLT A;  5IMP A;  3NRI A;  3WCA A;  4N9U A;  4QXS F;  4NKE A;  3LJI A;  1UBX A;  4PVY F;  3N5H F;  2PS8 A;  3WCL A;  4DWG A;  3Q30 A;  4GP1 A;  1UBY A;  2DH4 A;  3G4D A;  5CG5 A;  3KRO B;  3RBM A;  2FTZ A;  5IM1 A;  1FPS A;  1V4H A;  4MC8 A;  2F8Z F;  1VG2 A;  5DHK A;  1WL0 A;  4H5D F;  3N5J F;  5IK9 A;  5EAU A;  2E94 A;  4H5C F;  3N3L F;  3WCB A;  4DI5 A;  3KRO A;  2AEL A;  1DGP A;  4ZQ8 A;  5HN7 A;  3ICK A;  3LVS A;  1UBW A;  3ZMC A;  3ZOU A;  3N1W F;  4LFV F;  1UBV A;  5A0K A;  3P8L A;  3N3D A;  3SDR A;  1N20 A;  3LGZ B;  3PYA A;  5H9D A;  5JV1 F;  3LSN A;  3LEE A;  3VJB A;  5ILZ A;  2I19 A;  2E95 A;  2O1O A;  4PVX F;  4FJQ A;  3VJ8 A;  5DIQ F;  4RNQ A;  3M9U A;  3DYG A;  3DYH A;  5DGN F;  5B0K A;  5I1U A;  3ICZ A;  4KPJ A;  4LZC A;  5B0I A;  2F94 F;  5B01 A;  3LG5 A;  5ERO A;  4MC0 A;  4OMG A;  3KRA A;  5IKA A;  3KBK A;  1V4E A;  4LFE A;  4NUA A;  1YHK A;  3S4J A;  2VF6 A;  2Z7H A;  5A0I A;  4LPG F;  4NG6 A;  2ZCO A;  3TFV A;  1N24 A;  4RXD A;  5B0L A;  2Q9Y A;  4UMJ A;  1YQ7 A;  3Q2Q A;  3Q1O A;  3ZMB A;  1HXA A;  4E9Z A;  2ZCR A;  1HXC A;  3LGK A;  5AFX A;  3WEI A;  5ILK A;  1HM7 A;  1DI1 A;  4KVD A;  3AQB B;  3AQC B;  3IBA A;  3WCF A;  5DGM F;  2F7M F;  4KVI A;  3P5R A;  3EGT A;  3QQV A;  4JZB A;  3N1V F;  2J1O A;  3N0G A;  4KWD A;  4H5E F;  5B00 A;  1JFA A;  4LTZ A;  4LOB A;  3ASX A;  4EA1 A;  4JYX A;  2J1P A;  5CG6 A;  3ICM A;  3WEJ A;  5ERN A;  4EA2 A;  1N23 A;  4JZX A;  4OKM A;  4LZ3 A;  1WL3 A;  2Q58 A;  3RYW A;  3P8R A;  5JA0 F;  4E1E A;  2E90 A;  3SDV A;  4EA0 A;  2E8W A;  4F6X A;  5EAS A;  3V1V A;  1YJ4 A;  1RQJ A;  1EZF A;  3EZ3 A;  3S9V A;  3AQ0 A;  1YYT A;  4DEM F;  3RYE A;  3OAC B;  3LLW A;  3OAB A;  5DGS F;  1WY0 A;  5IL3 A;  4LFG A;  3ICN A;  3VJA A;  1VG6 A;  2PS4 A;  3WCD A;  3SAE A;  5IMI A;  3TFP A;  3WSA A;  5B03 A;  2ONG A;  2PS5 A;  3ID0 A;  2ZCS A;  2E8V A;  3ADZ A;  3M0G A;  1WL1 A;  1KIY A;  3PKO A;  1JFG A;  2AET A;  3APZ A;  2ZCQ A;  3WCM A;  4F62 A;  3KB9 A;  4NFI F;  2OPM A;  4RYP A;  3WCE A;  3OAC A;  1WL2 A;  1V4K A;  2F8C F;  3VJ9 A;  5EAT A;  4JXY A;  2E8X A;  2E8T A;  3N49 F;  5JV0 F;  4KK2 A;  3WEK A;  3KRC B;  3NPR A;  5AHU B;  2Z4V A;  3KRP B;  4DHD A;  4LZ0 A;  2PS6 A;  3BNY A;  2Z7I A;  3VJC A;  4WK5 A;  1V4J A;  3ZCD A;  5IK6 A;  3VJD A;  5ILH A;  3LOM A;  5HNA A;  4OMH A;  2Z4X A;  4KFA A;  4KVY A;  5B0J A;  3WCH A;  2H8O A;  4KKM A;  4DWB A;  3ACX A;  2P1C A;  3SDT A;  4NFJ F;  4KUX A;  1VG7 A;  3NF2 A;  4DZW A; 
#chains in the Genus database with same CATH homology
 2Q9Z A;  3SDU A;  4K10 A;  3Q2Z A;  3KRF B;  4GA3 A;  5B02 A;  3RMG A;  3N45 F;  3M01 A;  4RXE A;  5E8L A;  5JUZ F;  4F6V A;  3WEF A;  2ZEV A;  3W7F A;  4LLS A;  2EWG A;  5IVG A;  2Z4Z A;  5AYP A;  3ACY A;  3OYR A;  1N21 A;  1HX9 A;  2E91 A;  4LIX A;  3AE0 A;  3WJN A;  3N0F A;  5IMN A;  4LA5 A;  5B0M A;  4DXJ A;  3PH7 A;  2Z50 A;  1ZW5 A;  1RTR A;  3M02 A;  3G4F A;  1VG3 A;  3WEH A;  2E4O A;  3ZL6 A;  4P0X A;  5DW7 A;  2E93 A;  3WSB A;  3UCA A;  4LXW A;  4FP4 A;  5IK0 A;  4P0V A;  1N1Z A;  5DHI A;  4KQU A;  3WCG A;  5DJR F;  5C05 A;  4KQ5 A;  4KVW A;  3IPI A;  5HN8 A;  3LMD A;  3MZV A;  3WJK A;  3DYF A;  4QPF A;  2FOR A;  5ILY A;  4NFK F;  1N22 A;  3EFQ A;  5ILD A;  3PDE A;  4GAX A;  4OKZ A;  3LZ9 A;  3P5P A;  5A0J A;  3TS7 A;  1RQI A;  1N1B A;  3P41 A;  2F9K F;  5JV2 F;  2ZY1 A;  3CKE A;  1YYU A;  3SDQ A;  2E92 A;  3V66 A;  2OGD A;  5IL8 A;  3QKC A;  4MC3 A;  3KRA B;  4XQR F;  1KIZ A;  3N46 F;  5DZ2 A;  2AZL A;  4LUU A;  2ONH A;  4OGU A;  2Z4Y A;  3WC9 A;  1YHM A;  2Z52 A;  3NPK A;  4N1Z F;  2AEK A;  3KRC A;  5ILJ A;  3TC1 A;  3VJE A;  2OPN A;  2Z4W A;  1PS1 A;  4HD1 A;  4LTV A;  5HN9 A;  2F89 F;  4XQT F;  5ER8 A;  3KRP A;  3MAV A;  2OA6 A;  4Q23 A;  5IKH A;  5IN8 A;  4RXC A;  4GP2 A;  1HM4 A;  1YYR A;  3LK5 A;  3B7L A;  2QIS A;  5DJV F;  2PS7 A;  5AEL A;  3PYB A;  4JXN A;  4NKF A;  3CP6 A;  4LA6 A;  3N6K F;  2AZK A;  3LDW A;  5E8H A;  3CC9 A;  4E9U A;  1VG4 A;  3WEG A;  2F92 F;  3TFN A;  3WCC A;  5E8K A;  1YV5 A;  3M00 A;  1YYQ A;  4XQS F;  1WKZ A;  1V4I A;  5DJP F;  3BNX A;  3WJO A;  4JVJ F;  5ILI A;  1YHL A;  3V1X A;  3KRF A;  2E8U A;  5KSX F;  4KPD A;  5ERM A;  3WCI A;  2Q80 A;  2AZJ A;  4KQS A;  3WCJ A;  1YYS A;  4RXA A;  2J5C A;  1WMW A;  4P0W A;  2RAH A;  2ZEU A;  1HXG A;  3WE9 A;  4L2X F;  3ACW A;  3OAB B;  2Z78 A;  4LPH F;  4LLT A;  5IMP A;  3NRI A;  3WCA A;  4N9U A;  4QXS F;  4NKE A;  3LJI A;  1UBX A;  4PVY F;  3N5H F;  2PS8 A;  3WCL A;  4DWG A;  3Q30 A;  4GP1 A;  1UBY A;  2DH4 A;  3G4D A;  5CG5 A;  3KRO B;  3RBM A;  2FTZ A;  5IM1 A;  1FPS A;  1V4H A;  4MC8 A;  2F8Z F;  1VG2 A;  5DHK A;  1WL0 A;  4H5D F;  3N5J F;  5IK9 A;  5EAU A;  2E94 A;  4H5C F;  3N3L F;  3WCB A;  4DI5 A;  3KRO A;  2AEL A;  1DGP A;  4ZQ8 A;  5HN7 A;  3ICK A;  3LVS A;  1UBW A;  3ZMC A;  3ZOU A;  3N1W F;  4LFV F;  1UBV A;  5A0K A;  3P8L A;  3N3D A;  3SDR A;  1N20 A;  3LGZ B;  3PYA A;  5H9D A;  5JV1 F;  3LSN A;  3LEE A;  3VJB A;  5ILZ A;  2I19 A;  2E95 A;  2O1O A;  4PVX F;  4FJQ A;  3VJ8 A;  5DIQ F;  4RNQ A;  3M9U A;  3DYG A;  3DYH A;  5DGN F;  5B0K A;  5I1U A;  3ICZ A;  4KPJ A;  4LZC A;  5B0I A;  2F94 F;  5B01 A;  3LG5 A;  5ERO A;  4MC0 A;  4OMG A;  3KRA A;  5IKA A;  3KBK A;  1V4E A;  4LFE A;  4NUA A;  1YHK A;  3S4J A;  2VF6 A;  2Z7H A;  5A0I A;  4LPG F;  4NG6 A;  2ZCO A;  3TFV A;  1N24 A;  4RXD A;  5B0L A;  2Q9Y A;  4UMJ A;  1YQ7 A;  3Q2Q A;  3Q1O A;  3ZMB A;  1HXA A;  4E9Z A;  2ZCR A;  1HXC A;  3LGK A;  5AFX A;  3WEI A;  5ILK A;  1HM7 A;  1DI1 A;  4KVD A;  3AQB B;  3AQC B;  3IBA A;  3WCF A;  5DGM F;  2F7M F;  4KVI A;  3P5R A;  3EGT A;  3QQV A;  4JZB A;  3N1V F;  2J1O A;  3N0G A;  4KWD A;  4H5E F;  5B00 A;  1JFA A;  4LTZ A;  4LOB A;  3ASX A;  4EA1 A;  4JYX A;  2J1P A;  5CG6 A;  3ICM A;  3WEJ A;  5ERN A;  4EA2 A;  1N23 A;  4JZX A;  4OKM A;  4LZ3 A;  1WL3 A;  2Q58 A;  3RYW A;  3P8R A;  5JA0 F;  4E1E A;  2E90 A;  3SDV A;  4EA0 A;  2E8W A;  4F6X A;  5EAS A;  3V1V A;  1YJ4 A;  1RQJ A;  1EZF A;  3EZ3 A;  3S9V A;  3AQ0 A;  1YYT A;  4DEM F;  3RYE A;  3OAC B;  3LLW A;  3OAB A;  5DGS F;  1WY0 A;  5IL3 A;  4LFG A;  3ICN A;  3VJA A;  1VG6 A;  2PS4 A;  3WCD A;  3SAE A;  5IMI A;  3TFP A;  3WSA A;  5B03 A;  2ONG A;  2PS5 A;  3ID0 A;  2ZCS A;  2E8V A;  3ADZ A;  3M0G A;  1WL1 A;  1KIY A;  3PKO A;  1JFG A;  2AET A;  3APZ A;  2ZCQ A;  3WCM A;  4F62 A;  3KB9 A;  4NFI F;  2OPM A;  4RYP A;  3WCE A;  3OAC A;  1WL2 A;  1V4K A;  2F8C F;  3VJ9 A;  5EAT A;  4JXY A;  2E8X A;  2E8T A;  3N49 F;  5JV0 F;  4KK2 A;  3WEK A;  3KRC B;  3NPR A;  5AHU B;  2Z4V A;  3KRP B;  4DHD A;  4LZ0 A;  2PS6 A;  3BNY A;  2Z7I A;  3VJC A;  4WK5 A;  1V4J A;  3ZCD A;  5IK6 A;  3VJD A;  5ILH A;  3LOM A;  5HNA A;  4OMH A;  2Z4X A;  4KFA A;  4KVY A;  5B0J A;  3WCH A;  2H8O A;  4KKM A;  4DWB A;  3ACX A;  2P1C A;  3SDT A;  4NFJ F;  4KUX A;  1VG7 A;  3NF2 A;  4DZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...