5B03A

Structure of moen5-sso7d fusion protein in complex with geranyl pyrophosphate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
264
structure length
264
Chain Sequence
VDDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, dna binding protein
molecule keywords MoeN5,DNA-binding protein 7d
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
total genus 115
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b03A00
5AFXA 3ACWA 4RXDA 3DYGA 3RBMA 5IMPA 3MAVA 1UBYA 2PS8A 3SDVA 5A0JA 5DZ2A 3WCGA 4N9UA 4LTZA 1DI1A 3Q2ZA 3VJEA 3ICKA 3WCAA 2E8UA 5ER8A 4LLTA 2Z7HA 3P5RA 5ILZA 2QISA 1V4JA 3CP6A 5ILKA 2FORA 2F8ZF 1WY0A 4KVIA 4MC8A 3SDQA 3LZ9A 5B00A 5CG6A 3LSNA 5HN8A 4DZWA 4LTVA 4MC3A 5IK6A 4LZ0A 4QPFA 4NFJF 4QXSF 4LZCA 1YV5A 4JXNA 3QKCA 2Z52A 4OGUA 4DHDA 1VG3A 3B7LA 3SAEA 5AYPA 4OMGA 3VJCA 2OA6A 3WCLA 1WKZA 3M00A 1N23A 3EFQA 4PVYF 3ZOUA 2OPMA 1YHKA 3SDRA 4LFVF 1WL1A 2F7MF 3LVSA 3MZVA 3SDTA 3M0GA 1N1BA 1KIYA 3N45F 1N20A 3WEIA 4NG6A 1HX9A 1HXCA 1YHLA 5DJPF 3WCHA 1YYSA 3LDWA 3WCFA 3S9VA 3VJBA 4RXCA 4RNQA 4KQSA 3ZMCA 4LOBA 3PH7A 2AZKA 3LLWA 4NKFA 3ID0A 4H5EF 2E91A 4OMHA 3BNYA 5E8KA 3WCEA 5AELA 5ILYA 3AQCB 2J1OA 3WEHA 1JFGA 2F94F 4E9UA 5IKHA 3KRPB 5ERNA 4F6XA 3VJAA 2J1PA 1V4IA 3P41A 2AELA 2ZEVA 5B03A 3UCAA 2ZY1A 4DWBA 1N1ZA 3PDEA 3KRPA 3N5JF 5DGMF 4GP2A 4H5DF 4F6VA 2Z4WA 2E95A 4XQRF 4JZXA 1RQJA 5B0JA 5DHIA 2PS5A 3N0FA 3TFPA 4DEMF 5IK9A 5ILIA 5ILHA 2ZCQA 2ONGA 3TS7A 2Z4YA 4KVYA 2E4OA 2Z4VA 4DWGA 1WL2A 5C05A 1WMWA 3WEGA 2ZEUA 1ZW5A 5JA0F 3ADZA 3IBAA 5IL3A 4ZQ8A 2Z78A 3APZA 4XQTF 2Q9YA 5DJVF 3N46F 4KK2A 4H5CF 2E8WA 3AQBB 3N0GA 3LEEA 4NFKF 3WCDA 3P5PA 2O1OA 5DW7A 5DHKA 1V4EA 3G4FA 4LPGF 2AETA 3WEJA 2F8CF 3ACXA 5ILDA 1YYUA 1N22A 5ERMA 3WJKA 2E8TA 3WSAA 3WE9A 2AZLA 2Q58A 5B0KA 3G4DA 3DYFA 4KVDA 2E94A 5KSXF 3EZ3A 2Q80A 5DJRF 4LIXA 1RQIA 3VJ8A 2AZJA 3ICMA 3NPRA 3LG5A 4KQUA 4MC0A 2RAHA 2FTZA 1N24A 3KRCB 4GP1A 3KB9A 1DGPA 4RYPA 5IN8A 2P1CA 5HN9A 4FP4A 3KRCA 4LZ3A 1YHMA 3LK5A 3LJIA 4JVJF 3M01A 4LA6A 4PVXF 4HD1A 5EATA 5E8HA 5IM1A 1WL0A 4P0XA 1KIZA 2OGDA 3KROB 5JV1F 3V1XA 4LFGA 4DI5A 4E9ZA 4GA3A 2E92A 4RXEA 3CKEA 2AEKA 3VJ9A 4KQ5A 3RYEA 3KROA 3WJNA 3N1WF 3N3LF 4EA2A 2VF6A 3OYRA 4N1ZF 3TFNA 3NRIA 4NKEA 3WCIA 5B02A 3WCBA 5B0LA 3AQ0A 2ONHA 3EGTA 3PYBA 3Q30A 5EROA 2E8XA 4DXJA 1VG2A 2J5CA 5JV0F 3M9UA 4LXWA 5EASA 3LGZB 3Q2QA 5IL8A 3ZCDA 2PS4A 2PS6A 3AE0A 2OPNA 5B0MA 3WCJA 5IMNA 3ASXA 1VG7A 3ICZA 1N21A 5IKAA 3WEKA 3IPIA 3WSBA 2ZCOA 3VJDA 4KPDA 3LMDA 4KKMA 4KFAA 3RYWA 4E1EA 2I19A 4KWDA 2DH4A 4XQSF 4NUAA 4LPHF 3P8LA 3KRAB 3PKOA 2Q9ZA 1RTRA 2H8OA 3OACB 3WCCA 4OKZA 3V1VA 4LA5A 2F89F 4K10A 3P8RA 1HM7A 2Z7IA 3KRAA 1UBVA 3OACA 1PS1A 3N6KF 4LLSA 4FJQA 1V4KA 2E8VA 5IK0A 1HXGA 2Z50A 5A0KA 3QQVA 5DGNF 4Q23A 5HNAA 5HN7A 2EWGA 3NPKA 3DYHA 3KBKA 4KPJA 5E8LA 4EA1A 5JUZF 5B01A 4UMJA 5CG5A 2E93A 3LGKA 4WK5A 4JXYA 5DGSF 1YYTA 4KUXA 3N49F 2F92F 4OKMA 3N3DA 4JZBA 4L2XF 3Q1OA 1UBWA 3ICNA 3KRFB 4JYXA 2Z4XA 4NFIF 1VG6A 3WEFA 5JV2F 5IVGA 5B0IA 4EA0A 5EAUA 3KRFA 3BNXA 1VG4A 4F62A 1EZFA 4P0VA 3SDUA 1WL3A 4KVWA 5DIQF 5IMIA 3ACYA 5H9DA 2ZCRA 1YYRA 5ILJA 4LUUA 3M02A 1JFAA 3OABB 3N5HF 3N1VF 3CC9A 4P0WA 2E90A 3OABA 3W7FA 4LFEA 2ZCSA 3WC9A 1YJ4A 1UBXA 3NF2A 1HM4A 3S4JA 1YQ7A 1V4HA 3WJOA 1YYQA 5A0IA 5I1UA 3ZMBA 3RMGA 3LOMA 3ZL6A 5AHUB 2Z4ZA 3V66A 3TC1A 2PS7A 3PYAA 3WCMA 3TFVA 4RXAA 1FPSA 1HXAA 4GAXA 2F9KF
chains in the Genus database with same CATH superfamily
5AFXA 3ACWA 4RXDA 3DYGA 3RBMA 5IMPA 3MAVA 1UBYA 2PS8A 3SDVA 5A0JA 5DZ2A 3WCGA 4N9UA 4LTZA 1DI1A 3Q2ZA 3VJEA 3ICKA 3WCAA 2E8UA 5ER8A 4LLTA 2Z7HA 3P5RA 5ILZA 2QISA 1V4JA 3CP6A 5ILKA 2FORA 2F8ZF 1WY0A 4KVIA 4MC8A 3SDQA 3LZ9A 5B00A 5CG6A 3LSNA 5HN8A 4DZWA 4LTVA 4MC3A 5IK6A 4LZ0A 4QPFA 4NFJF 4QXSF 4LZCA 1YV5A 4JXNA 3QKCA 2Z52A 4OGUA 4DHDA 1VG3A 3B7LA 3SAEA 5AYPA 4OMGA 3VJCA 2OA6A 3WCLA 1WKZA 3M00A 1N23A 3EFQA 4PVYF 3ZOUA 2OPMA 1YHKA 3SDRA 4LFVF 1WL1A 2F7MF 3LVSA 3MZVA 3SDTA 3M0GA 1N1BA 1KIYA 3N45F 1N20A 3WEIA 4NG6A 1HX9A 1HXCA 1YHLA 5DJPF 3WCHA 1YYSA 3LDWA 3WCFA 3S9VA 3VJBA 4RXCA 4RNQA 4KQSA 3ZMCA 4LOBA 3PH7A 2AZKA 3LLWA 4NKFA 3ID0A 4H5EF 2E91A 4OMHA 3BNYA 5E8KA 3WCEA 5AELA 5ILYA 3AQCB 2J1OA 3WEHA 1JFGA 2F94F 4E9UA 5IKHA 3KRPB 5ERNA 4F6XA 3VJAA 2J1PA 1V4IA 3P41A 2AELA 2ZEVA 5B03A 3UCAA 2ZY1A 4DWBA 1N1ZA 3PDEA 3KRPA 3N5JF 5DGMF 4GP2A 4H5DF 4F6VA 2Z4WA 2E95A 4XQRF 4JZXA 1RQJA 5B0JA 5DHIA 2PS5A 3N0FA 3TFPA 4DEMF 5IK9A 5ILIA 5ILHA 2ZCQA 2ONGA 3TS7A 2Z4YA 4KVYA 2E4OA 2Z4VA 4DWGA 1WL2A 5C05A 1WMWA 3WEGA 2ZEUA 1ZW5A 5JA0F 3ADZA 3IBAA 5IL3A 4ZQ8A 2Z78A 3APZA 4XQTF 2Q9YA 5DJVF 3N46F 4KK2A 4H5CF 2E8WA 3AQBB 3N0GA 3LEEA 4NFKF 3WCDA 3P5PA 2O1OA 5DW7A 5DHKA 1V4EA 3G4FA 4LPGF 2AETA 3WEJA 2F8CF 3ACXA 5ILDA 1YYUA 1N22A 5ERMA 3WJKA 2E8TA 3WSAA 3WE9A 2AZLA 2Q58A 5B0KA 3G4DA 3DYFA 4KVDA 2E94A 5KSXF 3EZ3A 2Q80A 5DJRF 4LIXA 1RQIA 3VJ8A 2AZJA 3ICMA 3NPRA 3LG5A 4KQUA 4MC0A 2RAHA 2FTZA 1N24A 3KRCB 4GP1A 3KB9A 1DGPA 4RYPA 5IN8A 2P1CA 5HN9A 4FP4A 3KRCA 4LZ3A 1YHMA 3LK5A 3LJIA 4JVJF 3M01A 4LA6A 4PVXF 4HD1A 5EATA 5E8HA 5IM1A 1WL0A 4P0XA 1KIZA 2OGDA 3KROB 5JV1F 3V1XA 4LFGA 4DI5A 4E9ZA 4GA3A 2E92A 4RXEA 3CKEA 2AEKA 3VJ9A 4KQ5A 3RYEA 3KROA 3WJNA 3N1WF 3N3LF 4EA2A 2VF6A 3OYRA 4N1ZF 3TFNA 3NRIA 4NKEA 3WCIA 5B02A 3WCBA 5B0LA 3AQ0A 2ONHA 3EGTA 3PYBA 3Q30A 5EROA 2E8XA 4DXJA 1VG2A 2J5CA 5JV0F 3M9UA 4LXWA 5EASA 3LGZB 3Q2QA 5IL8A 3ZCDA 2PS4A 2PS6A 3AE0A 2OPNA 5B0MA 3WCJA 5IMNA 3ASXA 1VG7A 3ICZA 1N21A 5IKAA 3WEKA 3IPIA 3WSBA 2ZCOA 3VJDA 4KPDA 3LMDA 4KKMA 4KFAA 3RYWA 4E1EA 2I19A 4KWDA 2DH4A 4XQSF 4NUAA 4LPHF 3P8LA 3KRAB 3PKOA 2Q9ZA 1RTRA 2H8OA 3OACB 3WCCA 4OKZA 3V1VA 4LA5A 2F89F 4K10A 3P8RA 1HM7A 2Z7IA 3KRAA 1UBVA 3OACA 1PS1A 3N6KF 4LLSA 4FJQA 1V4KA 2E8VA 5IK0A 1HXGA 2Z50A 5A0KA 3QQVA 5DGNF 4Q23A 5HNAA 5HN7A 2EWGA 3NPKA 3DYHA 3KBKA 4KPJA 5E8LA 4EA1A 5JUZF 5B01A 4UMJA 5CG5A 2E93A 3LGKA 4WK5A 4JXYA 5DGSF 1YYTA 4KUXA 3N49F 2F92F 4OKMA 3N3DA 4JZBA 4L2XF 3Q1OA 1UBWA 3ICNA 3KRFB 4JYXA 2Z4XA 4NFIF 1VG6A 3WEFA 5JV2F 5IVGA 5B0IA 4EA0A 5EAUA 3KRFA 3BNXA 1VG4A 4F62A 1EZFA 4P0VA 3SDUA 1WL3A 4KVWA 5DIQF 5IMIA 3ACYA 5H9DA 2ZCRA 1YYRA 5ILJA 4LUUA 3M02A 1JFAA 3OABB 3N5HF 3N1VF 3CC9A 4P0WA 2E90A 3OABA 3W7FA 4LFEA 2ZCSA 3WC9A 1YJ4A 1UBXA 3NF2A 1HM4A 3S4JA 1YQ7A 1V4HA 3WJOA 1YYQA 5A0IA 5I1UA 3ZMBA 3RMGA 3LOMA 3ZL6A 5AHUB 2Z4ZA 3V66A 3TC1A 2PS7A 3PYAA 3WCMA 3TFVA 4RXAA 1FPSA 1HXAA 4GAXA 2F9KF
chains in the Genus database with same CATH topology
5AFXA 3ACWA 4RXDA 3DYGA 3RBMA 5IMPA 3MAVA 1UBYA 2PS8A 3SDVA 5A0JA 5DZ2A 3WCGA 4N9UA 4LTZA 1DI1A 3Q2ZA 3VJEA 3ICKA 3WCAA 2E8UA 5ER8A 4LLTA 2Z7HA 3P5RA 5ILZA 2QISA 1V4JA 3CP6A 5ILKA 2FORA 2F8ZF 1WY0A 4KVIA 4MC8A 3SDQA 3LZ9A 5B00A 5CG6A 3LSNA 5HN8A 4DZWA 4LTVA 4MC3A 5IK6A 4LZ0A 4QPFA 4NFJF 4QXSF 4LZCA 1YV5A 4JXNA 3QKCA 2Z52A 4OGUA 4DHDA 1VG3A 3B7LA 3SAEA 5AYPA 4OMGA 3VJCA 2OA6A 3WCLA 1WKZA 3M00A 1N23A 3EFQA 4PVYF 3ZOUA 2OPMA 1YHKA 3SDRA 4LFVF 1WL1A 2F7MF 3LVSA 3MZVA 3SDTA 3M0GA 1N1BA 1KIYA 3N45F 1N20A 3WEIA 4NG6A 1HX9A 1HXCA 1YHLA 5DJPF 3WCHA 1YYSA 3LDWA 3WCFA 3S9VA 3VJBA 4RXCA 4RNQA 4KQSA 3ZMCA 4LOBA 3PH7A 2AZKA 3LLWA 4NKFA 3ID0A 4H5EF 2E91A 4OMHA 3BNYA 5E8KA 3WCEA 5AELA 5ILYA 3AQCB 2J1OA 3WEHA 1JFGA 2F94F 4E9UA 5IKHA 3KRPB 5ERNA 4F6XA 3VJAA 2J1PA 1V4IA 3P41A 2AELA 2ZEVA 5B03A 3UCAA 2ZY1A 4DWBA 1N1ZA 3PDEA 3KRPA 3N5JF 5DGMF 4GP2A 4H5DF 4F6VA 2Z4WA 2E95A 4XQRF 4JZXA 1RQJA 5B0JA 5DHIA 2PS5A 3N0FA 3TFPA 4DEMF 5IK9A 5ILIA 5ILHA 2ZCQA 2ONGA 3TS7A 2Z4YA 4KVYA 2E4OA 2Z4VA 4DWGA 1WL2A 5C05A 1WMWA 3WEGA 2ZEUA 1ZW5A 5JA0F 3ADZA 3IBAA 5IL3A 4ZQ8A 2Z78A 3APZA 4XQTF 2Q9YA 5DJVF 3N46F 4KK2A 4H5CF 2E8WA 3AQBB 3N0GA 3LEEA 4NFKF 3WCDA 3P5PA 2O1OA 5DW7A 5DHKA 1V4EA 3G4FA 4LPGF 2AETA 3WEJA 2F8CF 3ACXA 5ILDA 1YYUA 1N22A 5ERMA 3WJKA 2E8TA 3WSAA 3WE9A 2AZLA 2Q58A 5B0KA 3G4DA 3DYFA 4KVDA 2E94A 5KSXF 3EZ3A 2Q80A 5DJRF 4LIXA 1RQIA 3VJ8A 2AZJA 3ICMA 3NPRA 3LG5A 4KQUA 4MC0A 2RAHA 2FTZA 1N24A 3KRCB 4GP1A 3KB9A 1DGPA 4RYPA 5IN8A 2P1CA 5HN9A 4FP4A 3KRCA 4LZ3A 1YHMA 3LK5A 3LJIA 4JVJF 3M01A 4LA6A 4PVXF 4HD1A 5EATA 5E8HA 5IM1A 1WL0A 4P0XA 1KIZA 2OGDA 3KROB 5JV1F 3V1XA 4LFGA 4DI5A 4E9ZA 4GA3A 2E92A 4RXEA 3CKEA 2AEKA 3VJ9A 4KQ5A 3RYEA 3KROA 3WJNA 3N1WF 3N3LF 4EA2A 2VF6A 3OYRA 4N1ZF 3TFNA 3NRIA 4NKEA 3WCIA 5B02A 3WCBA 5B0LA 3AQ0A 2ONHA 3EGTA 3PYBA 3Q30A 5EROA 2E8XA 4DXJA 1VG2A 2J5CA 5JV0F 3M9UA 4LXWA 5EASA 3LGZB 3Q2QA 5IL8A 3ZCDA 2PS4A 2PS6A 3AE0A 2OPNA 5B0MA 3WCJA 5IMNA 3ASXA 1VG7A 3ICZA 1N21A 5IKAA 3WEKA 3IPIA 3WSBA 2ZCOA 3VJDA 4KPDA 3LMDA 4KKMA 4KFAA 3RYWA 4E1EA 2I19A 4KWDA 2DH4A 4XQSF 4NUAA 4LPHF 3P8LA 3KRAB 3PKOA 2Q9ZA 1RTRA 2H8OA 3OACB 3WCCA 4OKZA 3V1VA 4LA5A 2F89F 4K10A 3P8RA 1HM7A 2Z7IA 3KRAA 1UBVA 3OACA 1PS1A 3N6KF 4LLSA 4FJQA 1V4KA 2E8VA 5IK0A 1HXGA 2Z50A 5A0KA 3QQVA 5DGNF 4Q23A 5HNAA 5HN7A 2EWGA 3NPKA 3DYHA 3KBKA 4KPJA 5E8LA 4EA1A 5JUZF 5B01A 4UMJA 5CG5A 2E93A 3LGKA 4WK5A 4JXYA 5DGSF 1YYTA 4KUXA 3N49F 2F92F 4OKMA 3N3DA 4JZBA 4L2XF 3Q1OA 1UBWA 3ICNA 3KRFB 4JYXA 2Z4XA 4NFIF 1VG6A 3WEFA 5JV2F 5IVGA 5B0IA 4EA0A 5EAUA 3KRFA 3BNXA 1VG4A 4F62A 1EZFA 4P0VA 3SDUA 1WL3A 4KVWA 5DIQF 5IMIA 3ACYA 5H9DA 2ZCRA 1YYRA 5ILJA 4LUUA 3M02A 1JFAA 3OABB 3N5HF 3N1VF 3CC9A 4P0WA 2E90A 3OABA 3W7FA 4LFEA 2ZCSA 3WC9A 1YJ4A 1UBXA 3NF2A 1HM4A 3S4JA 1YQ7A 1V4HA 3WJOA 1YYQA 5A0IA 5I1UA 3ZMBA 3RMGA 3LOMA 3ZL6A 5AHUB 2Z4ZA 3V66A 3TC1A 2PS7A 3PYAA 3WCMA 3TFVA 4RXAA 1FPSA 1HXAA 4GAXA 2F9KF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFX A;  3ACW A;  4RXD A;  3DYG A;  3RBM A;  5IMP A;  3MAV A;  1UBY A;  2PS8 A;  3SDV A;  5A0J A;  5DZ2 A;  3WCG A;  4N9U A;  4LTZ A;  1DI1 A;  3Q2Z A;  3VJE A;  3ICK A;  3WCA A;  2E8U A;  5ER8 A;  4LLT A;  2Z7H A;  3P5R A;  5ILZ A;  2QIS A;  1V4J A;  3CP6 A;  5ILK A;  2FOR A;  2F8Z F;  1WY0 A;  4KVI A;  4MC8 A;  3SDQ A;  3LZ9 A;  5B00 A;  5CG6 A;  3LSN A;  5HN8 A;  4DZW A;  4LTV A;  4MC3 A;  5IK6 A;  4LZ0 A;  4QPF A;  4NFJ F;  4QXS F;  4LZC A;  1YV5 A;  4JXN A;  3QKC A;  2Z52 A;  4OGU A;  4DHD A;  1VG3 A;  3B7L A;  3SAE A;  5AYP A;  4OMG A;  3VJC A;  2OA6 A;  3WCL A;  1WKZ A;  3M00 A;  1N23 A;  3EFQ A;  4PVY F;  3ZOU A;  2OPM A;  1YHK A;  3SDR A;  4LFV F;  1WL1 A;  2F7M F;  3LVS A;  3MZV A;  3SDT A;  3M0G A;  1N1B A;  1KIY A;  3N45 F;  1N20 A;  3WEI A;  4NG6 A;  1HX9 A;  1HXC A;  1YHL A;  5DJP F;  3WCH A;  1YYS A;  3LDW A;  3WCF A;  3S9V A;  3VJB A;  4RXC A;  4RNQ A;  4KQS A;  3ZMC A;  4LOB A;  3PH7 A;  2AZK A;  3LLW A;  4NKF A;  3ID0 A;  4H5E F;  2E91 A;  4OMH A;  3BNY A;  5E8K A;  3WCE A;  5AEL A;  5ILY A;  3AQC B;  2J1O A;  3WEH A;  1JFG A;  2F94 F;  4E9U A;  5IKH A;  3KRP B;  5ERN A;  4F6X A;  3VJA A;  2J1P A;  1V4I A;  3P41 A;  2AEL A;  2ZEV A;  5B03 A;  3UCA A;  2ZY1 A;  4DWB A;  1N1Z A;  3PDE A;  3KRP A;  3N5J F;  5DGM F;  4GP2 A;  4H5D F;  4F6V A;  2Z4W A;  2E95 A;  4XQR F;  4JZX A;  1RQJ A;  5B0J A;  5DHI A;  2PS5 A;  3N0F A;  3TFP A;  4DEM F;  5IK9 A;  5ILI A;  5ILH A;  2ZCQ A;  2ONG A;  3TS7 A;  2Z4Y A;  4KVY A;  2E4O A;  2Z4V A;  4DWG A;  1WL2 A;  5C05 A;  1WMW A;  3WEG A;  2ZEU A;  1ZW5 A;  5JA0 F;  3ADZ A;  3IBA A;  5IL3 A;  4ZQ8 A;  2Z78 A;  3APZ A;  4XQT F;  2Q9Y A;  5DJV F;  3N46 F;  4KK2 A;  4H5C F;  2E8W A;  3AQB B;  3N0G A;  3LEE A;  4NFK F;  3WCD A;  3P5P A;  2O1O A;  5DW7 A;  5DHK A;  1V4E A;  3G4F A;  4LPG F;  2AET A;  3WEJ A;  2F8C F;  3ACX A;  5ILD A;  1YYU A;  1N22 A;  5ERM A;  3WJK A;  2E8T A;  3WSA A;  3WE9 A;  2AZL A;  2Q58 A;  5B0K A;  3G4D A;  3DYF A;  4KVD A;  2E94 A;  5KSX F;  3EZ3 A;  2Q80 A;  5DJR F;  4LIX A;  1RQI A;  3VJ8 A;  2AZJ A;  3ICM A;  3NPR A;  3LG5 A;  4KQU A;  4MC0 A;  2RAH A;  2FTZ A;  1N24 A;  3KRC B;  4GP1 A;  3KB9 A;  1DGP A;  4RYP A;  5IN8 A;  2P1C A;  5HN9 A;  4FP4 A;  3KRC A;  4LZ3 A;  1YHM A;  3LK5 A;  3LJI A;  4JVJ F;  3M01 A;  4LA6 A;  4PVX F;  4HD1 A;  5EAT A;  5E8H A;  5IM1 A;  1WL0 A;  4P0X A;  1KIZ A;  2OGD A;  3KRO B;  5JV1 F;  3V1X A;  4LFG A;  4DI5 A;  4E9Z A;  4GA3 A;  2E92 A;  4RXE A;  3CKE A;  2AEK A;  3VJ9 A;  4KQ5 A;  3RYE A;  3KRO A;  3WJN A;  3N1W F;  3N3L F;  4EA2 A;  2VF6 A;  3OYR A;  4N1Z F;  3TFN A;  3NRI A;  4NKE A;  3WCI A;  5B02 A;  3WCB A;  5B0L A;  3AQ0 A;  2ONH A;  3EGT A;  3PYB A;  3Q30 A;  5ERO A;  2E8X A;  4DXJ A;  1VG2 A;  2J5C A;  5JV0 F;  3M9U A;  4LXW A;  5EAS A;  3LGZ B;  3Q2Q A;  5IL8 A;  3ZCD A;  2PS4 A;  2PS6 A;  3AE0 A;  2OPN A;  5B0M A;  3WCJ A;  5IMN A;  3ASX A;  1VG7 A;  3ICZ A;  1N21 A;  5IKA A;  3WEK A;  3IPI A;  3WSB A;  2ZCO A;  3VJD A;  4KPD A;  3LMD A;  4KKM A;  4KFA A;  3RYW A;  4E1E A;  2I19 A;  4KWD A;  2DH4 A;  4XQS F;  4NUA A;  4LPH F;  3P8L A;  3KRA B;  3PKO A;  2Q9Z A;  1RTR A;  2H8O A;  3OAC B;  3WCC A;  4OKZ A;  3V1V A;  4LA5 A;  2F89 F;  4K10 A;  3P8R A;  1HM7 A;  2Z7I A;  3KRA A;  1UBV A;  3OAC A;  1PS1 A;  3N6K F;  4LLS A;  4FJQ A;  1V4K A;  2E8V A;  5IK0 A;  1HXG A;  2Z50 A;  5A0K A;  3QQV A;  5DGN F;  4Q23 A;  5HNA A;  5HN7 A;  2EWG A;  3NPK A;  3DYH A;  3KBK A;  4KPJ A;  5E8L A;  4EA1 A;  5JUZ F;  5B01 A;  4UMJ A;  5CG5 A;  2E93 A;  3LGK A;  4WK5 A;  4JXY A;  5DGS F;  1YYT A;  4KUX A;  3N49 F;  2F92 F;  4OKM A;  3N3D A;  4JZB A;  4L2X F;  3Q1O A;  1UBW A;  3ICN A;  3KRF B;  4JYX A;  2Z4X A;  4NFI F;  1VG6 A;  3WEF A;  5JV2 F;  5IVG A;  5B0I A;  4EA0 A;  5EAU A;  3KRF A;  3BNX A;  1VG4 A;  4F62 A;  1EZF A;  4P0V A;  3SDU A;  1WL3 A;  4KVW A;  5DIQ F;  5IMI A;  3ACY A;  5H9D A;  2ZCR A;  1YYR A;  5ILJ A;  4LUU A;  3M02 A;  1JFA A;  3OAB B;  3N5H F;  3N1V F;  3CC9 A;  4P0W A;  2E90 A;  3OAB A;  3W7F A;  4LFE A;  2ZCS A;  3WC9 A;  1YJ4 A;  1UBX A;  3NF2 A;  1HM4 A;  3S4J A;  1YQ7 A;  1V4H A;  3WJO A;  1YYQ A;  5A0I A;  5I1U A;  3ZMB A;  3RMG A;  3LOM A;  3ZL6 A;  5AHU B;  2Z4Z A;  3V66 A;  3TC1 A;  2PS7 A;  3PYA A;  3WCM A;  3TFV A;  4RXA A;  1FPS A;  1HXA A;  4GAX A;  2F9K F; 
#chains in the Genus database with same CATH topology
 5AFX A;  3ACW A;  4RXD A;  3DYG A;  3RBM A;  5IMP A;  3MAV A;  1UBY A;  2PS8 A;  3SDV A;  5A0J A;  5DZ2 A;  3WCG A;  4N9U A;  4LTZ A;  1DI1 A;  3Q2Z A;  3VJE A;  3ICK A;  3WCA A;  2E8U A;  5ER8 A;  4LLT A;  2Z7H A;  3P5R A;  5ILZ A;  2QIS A;  1V4J A;  3CP6 A;  5ILK A;  2FOR A;  2F8Z F;  1WY0 A;  4KVI A;  4MC8 A;  3SDQ A;  3LZ9 A;  5B00 A;  5CG6 A;  3LSN A;  5HN8 A;  4DZW A;  4LTV A;  4MC3 A;  5IK6 A;  4LZ0 A;  4QPF A;  4NFJ F;  4QXS F;  4LZC A;  1YV5 A;  4JXN A;  3QKC A;  2Z52 A;  4OGU A;  4DHD A;  1VG3 A;  3B7L A;  3SAE A;  5AYP A;  4OMG A;  3VJC A;  2OA6 A;  3WCL A;  1WKZ A;  3M00 A;  1N23 A;  3EFQ A;  4PVY F;  3ZOU A;  2OPM A;  1YHK A;  3SDR A;  4LFV F;  1WL1 A;  2F7M F;  3LVS A;  3MZV A;  3SDT A;  3M0G A;  1N1B A;  1KIY A;  3N45 F;  1N20 A;  3WEI A;  4NG6 A;  1HX9 A;  1HXC A;  1YHL A;  5DJP F;  3WCH A;  1YYS A;  3LDW A;  3WCF A;  3S9V A;  3VJB A;  4RXC A;  4RNQ A;  4KQS A;  3ZMC A;  4LOB A;  3PH7 A;  2AZK A;  3LLW A;  4NKF A;  3ID0 A;  4H5E F;  2E91 A;  4OMH A;  3BNY A;  5E8K A;  3WCE A;  5AEL A;  5ILY A;  3AQC B;  2J1O A;  3WEH A;  1JFG A;  2F94 F;  4E9U A;  5IKH A;  3KRP B;  5ERN A;  4F6X A;  3VJA A;  2J1P A;  1V4I A;  3P41 A;  2AEL A;  2ZEV A;  5B03 A;  3UCA A;  2ZY1 A;  4DWB A;  1N1Z A;  3PDE A;  3KRP A;  3N5J F;  5DGM F;  4GP2 A;  4H5D F;  4F6V A;  2Z4W A;  2E95 A;  4XQR F;  4JZX A;  1RQJ A;  5B0J A;  5DHI A;  2PS5 A;  3N0F A;  3TFP A;  4DEM F;  5IK9 A;  5ILI A;  5ILH A;  2ZCQ A;  2ONG A;  3TS7 A;  2Z4Y A;  4KVY A;  2E4O A;  2Z4V A;  4DWG A;  1WL2 A;  5C05 A;  1WMW A;  3WEG A;  2ZEU A;  1ZW5 A;  5JA0 F;  3ADZ A;  3IBA A;  5IL3 A;  4ZQ8 A;  2Z78 A;  3APZ A;  4XQT F;  2Q9Y A;  5DJV F;  3N46 F;  4KK2 A;  4H5C F;  2E8W A;  3AQB B;  3N0G A;  3LEE A;  4NFK F;  3WCD A;  3P5P A;  2O1O A;  5DW7 A;  5DHK A;  1V4E A;  3G4F A;  4LPG F;  2AET A;  3WEJ A;  2F8C F;  3ACX A;  5ILD A;  1YYU A;  1N22 A;  5ERM A;  3WJK A;  2E8T A;  3WSA A;  3WE9 A;  2AZL A;  2Q58 A;  5B0K A;  3G4D A;  3DYF A;  4KVD A;  2E94 A;  5KSX F;  3EZ3 A;  2Q80 A;  5DJR F;  4LIX A;  1RQI A;  3VJ8 A;  2AZJ A;  3ICM A;  3NPR A;  3LG5 A;  4KQU A;  4MC0 A;  2RAH A;  2FTZ A;  1N24 A;  3KRC B;  4GP1 A;  3KB9 A;  1DGP A;  4RYP A;  5IN8 A;  2P1C A;  5HN9 A;  4FP4 A;  3KRC A;  4LZ3 A;  1YHM A;  3LK5 A;  3LJI A;  4JVJ F;  3M01 A;  4LA6 A;  4PVX F;  4HD1 A;  5EAT A;  5E8H A;  5IM1 A;  1WL0 A;  4P0X A;  1KIZ A;  2OGD A;  3KRO B;  5JV1 F;  3V1X A;  4LFG A;  4DI5 A;  4E9Z A;  4GA3 A;  2E92 A;  4RXE A;  3CKE A;  2AEK A;  3VJ9 A;  4KQ5 A;  3RYE A;  3KRO A;  3WJN A;  3N1W F;  3N3L F;  4EA2 A;  2VF6 A;  3OYR A;  4N1Z F;  3TFN A;  3NRI A;  4NKE A;  3WCI A;  5B02 A;  3WCB A;  5B0L A;  3AQ0 A;  2ONH A;  3EGT A;  3PYB A;  3Q30 A;  5ERO A;  2E8X A;  4DXJ A;  1VG2 A;  2J5C A;  5JV0 F;  3M9U A;  4LXW A;  5EAS A;  3LGZ B;  3Q2Q A;  5IL8 A;  3ZCD A;  2PS4 A;  2PS6 A;  3AE0 A;  2OPN A;  5B0M A;  3WCJ A;  5IMN A;  3ASX A;  1VG7 A;  3ICZ A;  1N21 A;  5IKA A;  3WEK A;  3IPI A;  3WSB A;  2ZCO A;  3VJD A;  4KPD A;  3LMD A;  4KKM A;  4KFA A;  3RYW A;  4E1E A;  2I19 A;  4KWD A;  2DH4 A;  4XQS F;  4NUA A;  4LPH F;  3P8L A;  3KRA B;  3PKO A;  2Q9Z A;  1RTR A;  2H8O A;  3OAC B;  3WCC A;  4OKZ A;  3V1V A;  4LA5 A;  2F89 F;  4K10 A;  3P8R A;  1HM7 A;  2Z7I A;  3KRA A;  1UBV A;  3OAC A;  1PS1 A;  3N6K F;  4LLS A;  4FJQ A;  1V4K A;  2E8V A;  5IK0 A;  1HXG A;  2Z50 A;  5A0K A;  3QQV A;  5DGN F;  4Q23 A;  5HNA A;  5HN7 A;  2EWG A;  3NPK A;  3DYH A;  3KBK A;  4KPJ A;  5E8L A;  4EA1 A;  5JUZ F;  5B01 A;  4UMJ A;  5CG5 A;  2E93 A;  3LGK A;  4WK5 A;  4JXY A;  5DGS F;  1YYT A;  4KUX A;  3N49 F;  2F92 F;  4OKM A;  3N3D A;  4JZB A;  4L2X F;  3Q1O A;  1UBW A;  3ICN A;  3KRF B;  4JYX A;  2Z4X A;  4NFI F;  1VG6 A;  3WEF A;  5JV2 F;  5IVG A;  5B0I A;  4EA0 A;  5EAU A;  3KRF A;  3BNX A;  1VG4 A;  4F62 A;  1EZF A;  4P0V A;  3SDU A;  1WL3 A;  4KVW A;  5DIQ F;  5IMI A;  3ACY A;  5H9D A;  2ZCR A;  1YYR A;  5ILJ A;  4LUU A;  3M02 A;  1JFA A;  3OAB B;  3N5H F;  3N1V F;  3CC9 A;  4P0W A;  2E90 A;  3OAB A;  3W7F A;  4LFE A;  2ZCS A;  3WC9 A;  1YJ4 A;  1UBX A;  3NF2 A;  1HM4 A;  3S4J A;  1YQ7 A;  1V4H A;  3WJO A;  1YYQ A;  5A0I A;  5I1U A;  3ZMB A;  3RMG A;  3LOM A;  3ZL6 A;  5AHU B;  2Z4Z A;  3V66 A;  3TC1 A;  2PS7 A;  3PYA A;  3WCM A;  3TFV A;  4RXA A;  1FPS A;  1HXA A;  4GAX A;  2F9K F; 
#chains in the Genus database with same CATH homology
 5AFX A;  3ACW A;  4RXD A;  3DYG A;  3RBM A;  5IMP A;  3MAV A;  1UBY A;  2PS8 A;  3SDV A;  5A0J A;  5DZ2 A;  3WCG A;  4N9U A;  4LTZ A;  1DI1 A;  3Q2Z A;  3VJE A;  3ICK A;  3WCA A;  2E8U A;  5ER8 A;  4LLT A;  2Z7H A;  3P5R A;  5ILZ A;  2QIS A;  1V4J A;  3CP6 A;  5ILK A;  2FOR A;  2F8Z F;  1WY0 A;  4KVI A;  4MC8 A;  3SDQ A;  3LZ9 A;  5B00 A;  5CG6 A;  3LSN A;  5HN8 A;  4DZW A;  4LTV A;  4MC3 A;  5IK6 A;  4LZ0 A;  4QPF A;  4NFJ F;  4QXS F;  4LZC A;  1YV5 A;  4JXN A;  3QKC A;  2Z52 A;  4OGU A;  4DHD A;  1VG3 A;  3B7L A;  3SAE A;  5AYP A;  4OMG A;  3VJC A;  2OA6 A;  3WCL A;  1WKZ A;  3M00 A;  1N23 A;  3EFQ A;  4PVY F;  3ZOU A;  2OPM A;  1YHK A;  3SDR A;  4LFV F;  1WL1 A;  2F7M F;  3LVS A;  3MZV A;  3SDT A;  3M0G A;  1N1B A;  1KIY A;  3N45 F;  1N20 A;  3WEI A;  4NG6 A;  1HX9 A;  1HXC A;  1YHL A;  5DJP F;  3WCH A;  1YYS A;  3LDW A;  3WCF A;  3S9V A;  3VJB A;  4RXC A;  4RNQ A;  4KQS A;  3ZMC A;  4LOB A;  3PH7 A;  2AZK A;  3LLW A;  4NKF A;  3ID0 A;  4H5E F;  2E91 A;  4OMH A;  3BNY A;  5E8K A;  3WCE A;  5AEL A;  5ILY A;  3AQC B;  2J1O A;  3WEH A;  1JFG A;  2F94 F;  4E9U A;  5IKH A;  3KRP B;  5ERN A;  4F6X A;  3VJA A;  2J1P A;  1V4I A;  3P41 A;  2AEL A;  2ZEV A;  5B03 A;  3UCA A;  2ZY1 A;  4DWB A;  1N1Z A;  3PDE A;  3KRP A;  3N5J F;  5DGM F;  4GP2 A;  4H5D F;  4F6V A;  2Z4W A;  2E95 A;  4XQR F;  4JZX A;  1RQJ A;  5B0J A;  5DHI A;  2PS5 A;  3N0F A;  3TFP A;  4DEM F;  5IK9 A;  5ILI A;  5ILH A;  2ZCQ A;  2ONG A;  3TS7 A;  2Z4Y A;  4KVY A;  2E4O A;  2Z4V A;  4DWG A;  1WL2 A;  5C05 A;  1WMW A;  3WEG A;  2ZEU A;  1ZW5 A;  5JA0 F;  3ADZ A;  3IBA A;  5IL3 A;  4ZQ8 A;  2Z78 A;  3APZ A;  4XQT F;  2Q9Y A;  5DJV F;  3N46 F;  4KK2 A;  4H5C F;  2E8W A;  3AQB B;  3N0G A;  3LEE A;  4NFK F;  3WCD A;  3P5P A;  2O1O A;  5DW7 A;  5DHK A;  1V4E A;  3G4F A;  4LPG F;  2AET A;  3WEJ A;  2F8C F;  3ACX A;  5ILD A;  1YYU A;  1N22 A;  5ERM A;  3WJK A;  2E8T A;  3WSA A;  3WE9 A;  2AZL A;  2Q58 A;  5B0K A;  3G4D A;  3DYF A;  4KVD A;  2E94 A;  5KSX F;  3EZ3 A;  2Q80 A;  5DJR F;  4LIX A;  1RQI A;  3VJ8 A;  2AZJ A;  3ICM A;  3NPR A;  3LG5 A;  4KQU A;  4MC0 A;  2RAH A;  2FTZ A;  1N24 A;  3KRC B;  4GP1 A;  3KB9 A;  1DGP A;  4RYP A;  5IN8 A;  2P1C A;  5HN9 A;  4FP4 A;  3KRC A;  4LZ3 A;  1YHM A;  3LK5 A;  3LJI A;  4JVJ F;  3M01 A;  4LA6 A;  4PVX F;  4HD1 A;  5EAT A;  5E8H A;  5IM1 A;  1WL0 A;  4P0X A;  1KIZ A;  2OGD A;  3KRO B;  5JV1 F;  3V1X A;  4LFG A;  4DI5 A;  4E9Z A;  4GA3 A;  2E92 A;  4RXE A;  3CKE A;  2AEK A;  3VJ9 A;  4KQ5 A;  3RYE A;  3KRO A;  3WJN A;  3N1W F;  3N3L F;  4EA2 A;  2VF6 A;  3OYR A;  4N1Z F;  3TFN A;  3NRI A;  4NKE A;  3WCI A;  5B02 A;  3WCB A;  5B0L A;  3AQ0 A;  2ONH A;  3EGT A;  3PYB A;  3Q30 A;  5ERO A;  2E8X A;  4DXJ A;  1VG2 A;  2J5C A;  5JV0 F;  3M9U A;  4LXW A;  5EAS A;  3LGZ B;  3Q2Q A;  5IL8 A;  3ZCD A;  2PS4 A;  2PS6 A;  3AE0 A;  2OPN A;  5B0M A;  3WCJ A;  5IMN A;  3ASX A;  1VG7 A;  3ICZ A;  1N21 A;  5IKA A;  3WEK A;  3IPI A;  3WSB A;  2ZCO A;  3VJD A;  4KPD A;  3LMD A;  4KKM A;  4KFA A;  3RYW A;  4E1E A;  2I19 A;  4KWD A;  2DH4 A;  4XQS F;  4NUA A;  4LPH F;  3P8L A;  3KRA B;  3PKO A;  2Q9Z A;  1RTR A;  2H8O A;  3OAC B;  3WCC A;  4OKZ A;  3V1V A;  4LA5 A;  2F89 F;  4K10 A;  3P8R A;  1HM7 A;  2Z7I A;  3KRA A;  1UBV A;  3OAC A;  1PS1 A;  3N6K F;  4LLS A;  4FJQ A;  1V4K A;  2E8V A;  5IK0 A;  1HXG A;  2Z50 A;  5A0K A;  3QQV A;  5DGN F;  4Q23 A;  5HNA A;  5HN7 A;  2EWG A;  3NPK A;  3DYH A;  3KBK A;  4KPJ A;  5E8L A;  4EA1 A;  5JUZ F;  5B01 A;  4UMJ A;  5CG5 A;  2E93 A;  3LGK A;  4WK5 A;  4JXY A;  5DGS F;  1YYT A;  4KUX A;  3N49 F;  2F92 F;  4OKM A;  3N3D A;  4JZB A;  4L2X F;  3Q1O A;  1UBW A;  3ICN A;  3KRF B;  4JYX A;  2Z4X A;  4NFI F;  1VG6 A;  3WEF A;  5JV2 F;  5IVG A;  5B0I A;  4EA0 A;  5EAU A;  3KRF A;  3BNX A;  1VG4 A;  4F62 A;  1EZF A;  4P0V A;  3SDU A;  1WL3 A;  4KVW A;  5DIQ F;  5IMI A;  3ACY A;  5H9D A;  2ZCR A;  1YYR A;  5ILJ A;  4LUU A;  3M02 A;  1JFA A;  3OAB B;  3N5H F;  3N1V F;  3CC9 A;  4P0W A;  2E90 A;  3OAB A;  3W7F A;  4LFE A;  2ZCS A;  3WC9 A;  1YJ4 A;  1UBX A;  3NF2 A;  1HM4 A;  3S4J A;  1YQ7 A;  1V4H A;  3WJO A;  1YYQ A;  5A0I A;  5I1U A;  3ZMB A;  3RMG A;  3LOM A;  3ZL6 A;  5AHU B;  2Z4Z A;  3V66 A;  3TC1 A;  2PS7 A;  3PYA A;  3WCM A;  3TFV A;  4RXA A;  1FPS A;  1HXA A;  4GAX A;  2F9K F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...