4LFGA

Crystal structure of geranylgeranyl diphosphate synthase sub1274 (target efi-509455) from streptococcus uberis 0140j with bound magnesium and isopentyl diphosphate, fully liganded complex;
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
290
structure length
290
Chain Sequence
SMDKLKKIDQTIHAFYCEKAVISEKLNEAVLYSINAGGKRIRPILFLEVIEALQIPLTESHFKAAAALEMIHTGSLIHDDLPAMDNDDYRRGQLTNHKKFDEATAILAGDSLFLDAFGMLAETDFPTDVTVDLVRSLSSASGTFGMVGGQMLDMAAEGKKLNLKNLQLIHRHKTGQLLAYPFWAAARVAQLDENLLATFLEIGMIIGLAFQVRDDILDITANFEEIGKTPKKDVMAEKMTYPHLLGLNESYQILDESLDQAEAILRKLSDEIAFAPQKILSLIERLRLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl Diphosphate Synthase
publication title Crystal Structure of Geranylgeranyl Diphosphate Synthase from Streptococcus Uberis 0140J
rcsb
source organism Streptococcus uberis
total genus 124
structure length 290
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4lfgA00
4LZ3A 4LOBA 3OACB 5E8LA 3CP6A 5HN9A 2Q9ZA 3N3LF 4JXNA 1YHKA 4QXSF 3DYGA 3KROB 1VG4A 3WCDA 3LK5A 2PS4A 1VG3A 3LZ9A 1N22A 3CKEA 1HXAA 3LGZB 3Q2QA 2VF6A 1JFGA 5JUZF 3SDQA 1YYRA 5E8KA 3N1VF 4KVYA 4PVXF 3NF2A 4F6VA 5JV2F 1V4HA 3ASXA 2Z50A 4Q23A 3EFQA 4OGUA 4DI5A 4KQ5A 5ERNA 3ACXA 4RXEA 3WCLA 1VG7A 3S4JA 4LA5A 3ACWA 5B03A 5A0JA 3P8LA 5B0MA 3ICMA 3AE0A 5IMIA 4XQSF 5AYPA 5IL8A 4P0VA 3ZMCA 3WCGA 1V4JA 4GP1A 5ILJA 3WSAA 5B0IA 5ILKA 2Z4XA 3KRFA 4NFJF 5ILIA 1PS1A 4NFKF 3N1WF 4K10A 4JZBA 3WJNA 3AQ0A 3WCIA 5B02A 4DWBA 3LMDA 4RXCA 3KRCB 3ICNA 3TC1A 5CG5A 1YYTA 2OA6A 2PS8A 3KRAA 3EGTA 3OACA 3WCFA 4KFAA 4LZCA 5B01A 4DEMF 4XQRF 4MC8A 2E8WA 3TS7A 3VJAA 2FTZA 2J5CA 3WC9A 5AHUB 3APZA 5IL3A 1N24A 3V66A 5ILHA 4QPFA 3KROA 5IK6A 4LLTA 5DJPF 1HXGA 4LZ0A 2Z4VA 4KVWA 1N1BA 1UBYA 1V4KA 1YQ7A 2E94A 3OABB 2F8CF 4GA3A 3P5PA 4LPGF 2F7MF 3RYWA 3EZ3A 4RNQA 2Z4YA 3VJCA 3SDTA 5IM1A 3WEJA 5ILZA 2J1OA 4H5CF 1WKZA 1N21A 3BNYA 4JVJF 3NRIA 3RBMA 3IBAA 4N9UA 3N6KF 2Z78A 3LSNA 2Q80A 4E9UA 5HN7A 2AZLA 5AELA 3NPRA 5JV1F 5IVGA 2Z7IA 4KVDA 1N20A 4OMHA 2Q58A 3CC9A 3WCMA 4P0XA 3KB9A 2ZY1A 4EA1A 3KRCA 3KBKA 2ONHA 3VJDA 3G4FA 2ZEVA 4LA6A 3N0FA 1HXCA 3PYAA 4JZXA 4LLSA 2E8XA 3QKCA 4H5DF 3V1VA 3S9VA 2PS7A 3WE9A 5EATA 5B00A 1VG2A 4LFEA 2OGDA 5KSXF 3WEIA 2OPMA 3Q30A 5DJVF 1N23A 3ID0A 1WMWA 2Q9YA 3WCJA 4H5EF 4ZQ8A 2ZCRA 3V1XA 2ZCOA 5JA0F 3WCBA 3SAEA 3G4DA 2O1OA 3WSBA 3M0GA 4GAXA 3OABA 1UBVA 2E92A 4NKFA 4WK5A 4OKMA 3RMGA 4DZWA 4FP4A 5DZ2A 3IPIA 4GP2A 4KK2A 1YYSA 3KRPB 3ZL6A 5IK0A 3WEGA 1N1ZA 3N5JF 2Z52A 2AZKA 4OKZA 2PS6A 5HN8A 4NUAA 4HD1A 5DHIA 5I1UA 3P41A 2E93A 2E4OA 5DGNF 2OPNA 2ZCSA 5H9DA 3WEHA 3N3DA 1WL0A 2E95A 4EA0A 4UMJA 3MZVA 1EZFA 4LFGA 1YJ4A 2P1CA 4LPHF 4N1ZF 1HM7A 3VJBA 3WCAA 3DYHA 4KPJA 5ILDA 3PYBA 3AQCB 2E90A 4F6XA 1YV5A 1WY0A 5EASA 5B0LA 1HM4A 1V4EA 3ZOUA 2E8VA 1FPSA 3N5HF 3N49F 2RAHA 2FORA 3PDEA 3SDVA 4DXJA 3ACYA 1UBXA 1JFAA 3SDUA 1DI1A 3Q1OA 4KPDA 4P0WA 4RXDA 2Z4ZA 2Z4WA 3SDRA 4KQUA 3RYEA 5A0IA 3WCEA 3WEFA 1YHMA 5C05A 3LG5A 2F9KF 3KRPA 3BNXA 5IKAA 2F8ZF 2F89F 3P8RA 5IK9A 3AQBB 4JYXA 5EAUA 3LVSA 3N46F 4PVYF 5IKHA 2EWGA 3UCAA 3M9UA 2DH4A 2Z7HA 3LDWA 3P5RA 1KIYA 3ZCDA 3VJ9A 1DGPA 4XQTF 3OYRA 1UBWA 2ZCQA 2J1PA 1WL3A 3VJEA 3LOMA 2QISA 5DGSF 4OMGA 3M01A 3ZMBA 1YHLA 4RXAA 1RQJA 4JXYA 3TFPA 4EA2A 4LXWA 4KUXA 4F62A 2F94F 5CG6A 5ILYA 3M00A 3N0GA 4MC3A 3LGKA 4LFVF 4KKMA 3TFNA 3LLWA 2H8OA 3PKOA 1ZW5A 5DGMF 2E8TA 1YYQA 4KVIA 3WJOA 2E8UA 5DHKA 2ONGA 3TFVA 1RTRA 2AELA 1WL1A 4KWDA 5ERMA 3WCCA 5DJRF 3WCHA 3NPKA 3M02A 5E8HA 4KQSA 5ER8A 4NFIF 2PS5A 1YYUA 2ZEUA 3WEKA 4NKEA 3W7FA 2E91A 4MC0A 5B0JA 1RQIA 3DYFA 3ICKA 4LUUA 4E1EA 4L2XF 3LEEA 5DW7A 5EROA 3WJKA 2AEKA 2I19A 3QQVA 5A0KA 1V4IA 2AZJA 4FJQA 2F92F 3ICZA 5B0KA 5JV0F 4DHDA 1KIZA 4LTZA 5DIQF 5IMPA 3VJ8A 4LTVA 3Q2ZA 1VG6A 4RYPA 4E9ZA 5AFXA 3MAVA 5IMNA 3KRFB 3B7LA 1WL2A 2AETA 3ADZA 1HX9A 5IN8A 3LJIA 4DWGA 5HNAA 4LIXA 3N45F 4NG6A 3PH7A 3KRAB
chains in the Genus database with same CATH superfamily
4LZ3A 4LOBA 3OACB 5E8LA 3CP6A 5HN9A 2Q9ZA 3N3LF 4JXNA 1YHKA 4QXSF 3DYGA 3KROB 1VG4A 3WCDA 3LK5A 2PS4A 1VG3A 3LZ9A 1N22A 3CKEA 1HXAA 3LGZB 3Q2QA 2VF6A 1JFGA 5JUZF 3SDQA 1YYRA 5E8KA 3N1VF 4KVYA 4PVXF 3NF2A 4F6VA 5JV2F 1V4HA 3ASXA 2Z50A 4Q23A 3EFQA 4OGUA 4DI5A 4KQ5A 5ERNA 3ACXA 4RXEA 3WCLA 1VG7A 3S4JA 4LA5A 3ACWA 5B03A 5A0JA 3P8LA 5B0MA 3ICMA 3AE0A 5IMIA 4XQSF 5AYPA 5IL8A 4P0VA 3ZMCA 3WCGA 1V4JA 4GP1A 5ILJA 3WSAA 5B0IA 5ILKA 2Z4XA 3KRFA 4NFJF 5ILIA 1PS1A 4NFKF 3N1WF 4K10A 4JZBA 3WJNA 3AQ0A 3WCIA 5B02A 4DWBA 3LMDA 4RXCA 3KRCB 3ICNA 3TC1A 5CG5A 1YYTA 2OA6A 2PS8A 3KRAA 3EGTA 3OACA 3WCFA 4KFAA 4LZCA 5B01A 4DEMF 4XQRF 4MC8A 2E8WA 3TS7A 3VJAA 2FTZA 2J5CA 3WC9A 5AHUB 3APZA 5IL3A 1N24A 3V66A 5ILHA 4QPFA 3KROA 5IK6A 4LLTA 5DJPF 1HXGA 4LZ0A 2Z4VA 4KVWA 1N1BA 1UBYA 1V4KA 1YQ7A 2E94A 3OABB 2F8CF 4GA3A 3P5PA 4LPGF 2F7MF 3RYWA 3EZ3A 4RNQA 2Z4YA 3VJCA 3SDTA 5IM1A 3WEJA 5ILZA 2J1OA 4H5CF 1WKZA 1N21A 3BNYA 4JVJF 3NRIA 3RBMA 3IBAA 4N9UA 3N6KF 2Z78A 3LSNA 2Q80A 4E9UA 5HN7A 2AZLA 5AELA 3NPRA 5JV1F 5IVGA 2Z7IA 4KVDA 1N20A 4OMHA 2Q58A 3CC9A 3WCMA 4P0XA 3KB9A 2ZY1A 4EA1A 3KRCA 3KBKA 2ONHA 3VJDA 3G4FA 2ZEVA 4LA6A 3N0FA 1HXCA 3PYAA 4JZXA 4LLSA 2E8XA 3QKCA 4H5DF 3V1VA 3S9VA 2PS7A 3WE9A 5EATA 5B00A 1VG2A 4LFEA 2OGDA 5KSXF 3WEIA 2OPMA 3Q30A 5DJVF 1N23A 3ID0A 1WMWA 2Q9YA 3WCJA 4H5EF 4ZQ8A 2ZCRA 3V1XA 2ZCOA 5JA0F 3WCBA 3SAEA 3G4DA 2O1OA 3WSBA 3M0GA 4GAXA 3OABA 1UBVA 2E92A 4NKFA 4WK5A 4OKMA 3RMGA 4DZWA 4FP4A 5DZ2A 3IPIA 4GP2A 4KK2A 1YYSA 3KRPB 3ZL6A 5IK0A 3WEGA 1N1ZA 3N5JF 2Z52A 2AZKA 4OKZA 2PS6A 5HN8A 4NUAA 4HD1A 5DHIA 5I1UA 3P41A 2E93A 2E4OA 5DGNF 2OPNA 2ZCSA 5H9DA 3WEHA 3N3DA 1WL0A 2E95A 4EA0A 4UMJA 3MZVA 1EZFA 4LFGA 1YJ4A 2P1CA 4LPHF 4N1ZF 1HM7A 3VJBA 3WCAA 3DYHA 4KPJA 5ILDA 3PYBA 3AQCB 2E90A 4F6XA 1YV5A 1WY0A 5EASA 5B0LA 1HM4A 1V4EA 3ZOUA 2E8VA 1FPSA 3N5HF 3N49F 2RAHA 2FORA 3PDEA 3SDVA 4DXJA 3ACYA 1UBXA 1JFAA 3SDUA 1DI1A 3Q1OA 4KPDA 4P0WA 4RXDA 2Z4ZA 2Z4WA 3SDRA 4KQUA 3RYEA 5A0IA 3WCEA 3WEFA 1YHMA 5C05A 3LG5A 2F9KF 3KRPA 3BNXA 5IKAA 2F8ZF 2F89F 3P8RA 5IK9A 3AQBB 4JYXA 5EAUA 3LVSA 3N46F 4PVYF 5IKHA 2EWGA 3UCAA 3M9UA 2DH4A 2Z7HA 3LDWA 3P5RA 1KIYA 3ZCDA 3VJ9A 1DGPA 4XQTF 3OYRA 1UBWA 2ZCQA 2J1PA 1WL3A 3VJEA 3LOMA 2QISA 5DGSF 4OMGA 3M01A 3ZMBA 1YHLA 4RXAA 1RQJA 4JXYA 3TFPA 4EA2A 4LXWA 4KUXA 4F62A 2F94F 5CG6A 5ILYA 3M00A 3N0GA 4MC3A 3LGKA 4LFVF 4KKMA 3TFNA 3LLWA 2H8OA 3PKOA 1ZW5A 5DGMF 2E8TA 1YYQA 4KVIA 3WJOA 2E8UA 5DHKA 2ONGA 3TFVA 1RTRA 2AELA 1WL1A 4KWDA 5ERMA 3WCCA 5DJRF 3WCHA 3NPKA 3M02A 5E8HA 4KQSA 5ER8A 4NFIF 2PS5A 1YYUA 2ZEUA 3WEKA 4NKEA 3W7FA 2E91A 4MC0A 5B0JA 1RQIA 3DYFA 3ICKA 4LUUA 4E1EA 4L2XF 3LEEA 5DW7A 5EROA 3WJKA 2AEKA 2I19A 3QQVA 5A0KA 1V4IA 2AZJA 4FJQA 2F92F 3ICZA 5B0KA 5JV0F 4DHDA 1KIZA 4LTZA 5DIQF 5IMPA 3VJ8A 4LTVA 3Q2ZA 1VG6A 4RYPA 4E9ZA 5AFXA 3MAVA 5IMNA 3KRFB 3B7LA 1WL2A 2AETA 3ADZA 1HX9A 5IN8A 3LJIA 4DWGA 5HNAA 4LIXA 3N45F 4NG6A 3PH7A 3KRAB
chains in the Genus database with same CATH topology
4LZ3A 4LOBA 3OACB 5E8LA 3CP6A 5HN9A 2Q9ZA 3N3LF 4JXNA 1YHKA 4QXSF 3DYGA 3KROB 1VG4A 3WCDA 3LK5A 2PS4A 1VG3A 3LZ9A 1N22A 3CKEA 1HXAA 3LGZB 3Q2QA 2VF6A 1JFGA 5JUZF 3SDQA 1YYRA 5E8KA 3N1VF 4KVYA 4PVXF 3NF2A 4F6VA 5JV2F 1V4HA 3ASXA 2Z50A 4Q23A 3EFQA 4OGUA 4DI5A 4KQ5A 5ERNA 3ACXA 4RXEA 3WCLA 1VG7A 3S4JA 4LA5A 3ACWA 5B03A 5A0JA 3P8LA 5B0MA 3ICMA 3AE0A 5IMIA 4XQSF 5AYPA 5IL8A 4P0VA 3ZMCA 3WCGA 1V4JA 4GP1A 5ILJA 3WSAA 5B0IA 5ILKA 2Z4XA 3KRFA 4NFJF 5ILIA 1PS1A 4NFKF 3N1WF 4K10A 4JZBA 3WJNA 3AQ0A 3WCIA 5B02A 4DWBA 3LMDA 4RXCA 3KRCB 3ICNA 3TC1A 5CG5A 1YYTA 2OA6A 2PS8A 3KRAA 3EGTA 3OACA 3WCFA 4KFAA 4LZCA 5B01A 4DEMF 4XQRF 4MC8A 2E8WA 3TS7A 3VJAA 2FTZA 2J5CA 3WC9A 5AHUB 3APZA 5IL3A 1N24A 3V66A 5ILHA 4QPFA 3KROA 5IK6A 4LLTA 5DJPF 1HXGA 4LZ0A 2Z4VA 4KVWA 1N1BA 1UBYA 1V4KA 1YQ7A 2E94A 3OABB 2F8CF 4GA3A 3P5PA 4LPGF 2F7MF 3RYWA 3EZ3A 4RNQA 2Z4YA 3VJCA 3SDTA 5IM1A 3WEJA 5ILZA 2J1OA 4H5CF 1WKZA 1N21A 3BNYA 4JVJF 3NRIA 3RBMA 3IBAA 4N9UA 3N6KF 2Z78A 3LSNA 2Q80A 4E9UA 5HN7A 2AZLA 5AELA 3NPRA 5JV1F 5IVGA 2Z7IA 4KVDA 1N20A 4OMHA 2Q58A 3CC9A 3WCMA 4P0XA 3KB9A 2ZY1A 4EA1A 3KRCA 3KBKA 2ONHA 3VJDA 3G4FA 2ZEVA 4LA6A 3N0FA 1HXCA 3PYAA 4JZXA 4LLSA 2E8XA 3QKCA 4H5DF 3V1VA 3S9VA 2PS7A 3WE9A 5EATA 5B00A 1VG2A 4LFEA 2OGDA 5KSXF 3WEIA 2OPMA 3Q30A 5DJVF 1N23A 3ID0A 1WMWA 2Q9YA 3WCJA 4H5EF 4ZQ8A 2ZCRA 3V1XA 2ZCOA 5JA0F 3WCBA 3SAEA 3G4DA 2O1OA 3WSBA 3M0GA 4GAXA 3OABA 1UBVA 2E92A 4NKFA 4WK5A 4OKMA 3RMGA 4DZWA 4FP4A 5DZ2A 3IPIA 4GP2A 4KK2A 1YYSA 3KRPB 3ZL6A 5IK0A 3WEGA 1N1ZA 3N5JF 2Z52A 2AZKA 4OKZA 2PS6A 5HN8A 4NUAA 4HD1A 5DHIA 5I1UA 3P41A 2E93A 2E4OA 5DGNF 2OPNA 2ZCSA 5H9DA 3WEHA 3N3DA 1WL0A 2E95A 4EA0A 4UMJA 3MZVA 1EZFA 4LFGA 1YJ4A 2P1CA 4LPHF 4N1ZF 1HM7A 3VJBA 3WCAA 3DYHA 4KPJA 5ILDA 3PYBA 3AQCB 2E90A 4F6XA 1YV5A 1WY0A 5EASA 5B0LA 1HM4A 1V4EA 3ZOUA 2E8VA 1FPSA 3N5HF 3N49F 2RAHA 2FORA 3PDEA 3SDVA 4DXJA 3ACYA 1UBXA 1JFAA 3SDUA 1DI1A 3Q1OA 4KPDA 4P0WA 4RXDA 2Z4ZA 2Z4WA 3SDRA 4KQUA 3RYEA 5A0IA 3WCEA 3WEFA 1YHMA 5C05A 3LG5A 2F9KF 3KRPA 3BNXA 5IKAA 2F8ZF 2F89F 3P8RA 5IK9A 3AQBB 4JYXA 5EAUA 3LVSA 3N46F 4PVYF 5IKHA 2EWGA 3UCAA 3M9UA 2DH4A 2Z7HA 3LDWA 3P5RA 1KIYA 3ZCDA 3VJ9A 1DGPA 4XQTF 3OYRA 1UBWA 2ZCQA 2J1PA 1WL3A 3VJEA 3LOMA 2QISA 5DGSF 4OMGA 3M01A 3ZMBA 1YHLA 4RXAA 1RQJA 4JXYA 3TFPA 4EA2A 4LXWA 4KUXA 4F62A 2F94F 5CG6A 5ILYA 3M00A 3N0GA 4MC3A 3LGKA 4LFVF 4KKMA 3TFNA 3LLWA 2H8OA 3PKOA 1ZW5A 5DGMF 2E8TA 1YYQA 4KVIA 3WJOA 2E8UA 5DHKA 2ONGA 3TFVA 1RTRA 2AELA 1WL1A 4KWDA 5ERMA 3WCCA 5DJRF 3WCHA 3NPKA 3M02A 5E8HA 4KQSA 5ER8A 4NFIF 2PS5A 1YYUA 2ZEUA 3WEKA 4NKEA 3W7FA 2E91A 4MC0A 5B0JA 1RQIA 3DYFA 3ICKA 4LUUA 4E1EA 4L2XF 3LEEA 5DW7A 5EROA 3WJKA 2AEKA 2I19A 3QQVA 5A0KA 1V4IA 2AZJA 4FJQA 2F92F 3ICZA 5B0KA 5JV0F 4DHDA 1KIZA 4LTZA 5DIQF 5IMPA 3VJ8A 4LTVA 3Q2ZA 1VG6A 4RYPA 4E9ZA 5AFXA 3MAVA 5IMNA 3KRFB 3B7LA 1WL2A 2AETA 3ADZA 1HX9A 5IN8A 3LJIA 4DWGA 5HNAA 4LIXA 3N45F 4NG6A 3PH7A 3KRAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LZ3 A;  4LOB A;  3OAC B;  5E8L A;  3CP6 A;  5HN9 A;  2Q9Z A;  3N3L F;  4JXN A;  1YHK A;  4QXS F;  3DYG A;  3KRO B;  1VG4 A;  3WCD A;  3LK5 A;  2PS4 A;  1VG3 A;  3LZ9 A;  1N22 A;  3CKE A;  1HXA A;  3LGZ B;  3Q2Q A;  2VF6 A;  1JFG A;  5JUZ F;  3SDQ A;  1YYR A;  5E8K A;  3N1V F;  4KVY A;  4PVX F;  3NF2 A;  4F6V A;  5JV2 F;  1V4H A;  3ASX A;  2Z50 A;  4Q23 A;  3EFQ A;  4OGU A;  4DI5 A;  4KQ5 A;  5ERN A;  3ACX A;  4RXE A;  3WCL A;  1VG7 A;  3S4J A;  4LA5 A;  3ACW A;  5B03 A;  5A0J A;  3P8L A;  5B0M A;  3ICM A;  3AE0 A;  5IMI A;  4XQS F;  5AYP A;  5IL8 A;  4P0V A;  3ZMC A;  3WCG A;  1V4J A;  4GP1 A;  5ILJ A;  3WSA A;  5B0I A;  5ILK A;  2Z4X A;  3KRF A;  4NFJ F;  5ILI A;  1PS1 A;  4NFK F;  3N1W F;  4K10 A;  4JZB A;  3WJN A;  3AQ0 A;  3WCI A;  5B02 A;  4DWB A;  3LMD A;  4RXC A;  3KRC B;  3ICN A;  3TC1 A;  5CG5 A;  1YYT A;  2OA6 A;  2PS8 A;  3KRA A;  3EGT A;  3OAC A;  3WCF A;  4KFA A;  4LZC A;  5B01 A;  4DEM F;  4XQR F;  4MC8 A;  2E8W A;  3TS7 A;  3VJA A;  2FTZ A;  2J5C A;  3WC9 A;  5AHU B;  3APZ A;  5IL3 A;  1N24 A;  3V66 A;  5ILH A;  4QPF A;  3KRO A;  5IK6 A;  4LLT A;  5DJP F;  1HXG A;  4LZ0 A;  2Z4V A;  4KVW A;  1N1B A;  1UBY A;  1V4K A;  1YQ7 A;  2E94 A;  3OAB B;  2F8C F;  4GA3 A;  3P5P A;  4LPG F;  2F7M F;  3RYW A;  3EZ3 A;  4RNQ A;  2Z4Y A;  3VJC A;  3SDT A;  5IM1 A;  3WEJ A;  5ILZ A;  2J1O A;  4H5C F;  1WKZ A;  1N21 A;  3BNY A;  4JVJ F;  3NRI A;  3RBM A;  3IBA A;  4N9U A;  3N6K F;  2Z78 A;  3LSN A;  2Q80 A;  4E9U A;  5HN7 A;  2AZL A;  5AEL A;  3NPR A;  5JV1 F;  5IVG A;  2Z7I A;  4KVD A;  1N20 A;  4OMH A;  2Q58 A;  3CC9 A;  3WCM A;  4P0X A;  3KB9 A;  2ZY1 A;  4EA1 A;  3KRC A;  3KBK A;  2ONH A;  3VJD A;  3G4F A;  2ZEV A;  4LA6 A;  3N0F A;  1HXC A;  3PYA A;  4JZX A;  4LLS A;  2E8X A;  3QKC A;  4H5D F;  3V1V A;  3S9V A;  2PS7 A;  3WE9 A;  5EAT A;  5B00 A;  1VG2 A;  4LFE A;  2OGD A;  5KSX F;  3WEI A;  2OPM A;  3Q30 A;  5DJV F;  1N23 A;  3ID0 A;  1WMW A;  2Q9Y A;  3WCJ A;  4H5E F;  4ZQ8 A;  2ZCR A;  3V1X A;  2ZCO A;  5JA0 F;  3WCB A;  3SAE A;  3G4D A;  2O1O A;  3WSB A;  3M0G A;  4GAX A;  3OAB A;  1UBV A;  2E92 A;  4NKF A;  4WK5 A;  4OKM A;  3RMG A;  4DZW A;  4FP4 A;  5DZ2 A;  3IPI A;  4GP2 A;  4KK2 A;  1YYS A;  3KRP B;  3ZL6 A;  5IK0 A;  3WEG A;  1N1Z A;  3N5J F;  2Z52 A;  2AZK A;  4OKZ A;  2PS6 A;  5HN8 A;  4NUA A;  4HD1 A;  5DHI A;  5I1U A;  3P41 A;  2E93 A;  2E4O A;  5DGN F;  2OPN A;  2ZCS A;  5H9D A;  3WEH A;  3N3D A;  1WL0 A;  2E95 A;  4EA0 A;  4UMJ A;  3MZV A;  1EZF A;  4LFG A;  1YJ4 A;  2P1C A;  4LPH F;  4N1Z F;  1HM7 A;  3VJB A;  3WCA A;  3DYH A;  4KPJ A;  5ILD A;  3PYB A;  3AQC B;  2E90 A;  4F6X A;  1YV5 A;  1WY0 A;  5EAS A;  5B0L A;  1HM4 A;  1V4E A;  3ZOU A;  2E8V A;  1FPS A;  3N5H F;  3N49 F;  2RAH A;  2FOR A;  3PDE A;  3SDV A;  4DXJ A;  3ACY A;  1UBX A;  1JFA A;  3SDU A;  1DI1 A;  3Q1O A;  4KPD A;  4P0W A;  4RXD A;  2Z4Z A;  2Z4W A;  3SDR A;  4KQU A;  3RYE A;  5A0I A;  3WCE A;  3WEF A;  1YHM A;  5C05 A;  3LG5 A;  2F9K F;  3KRP A;  3BNX A;  5IKA A;  2F8Z F;  2F89 F;  3P8R A;  5IK9 A;  3AQB B;  4JYX A;  5EAU A;  3LVS A;  3N46 F;  4PVY F;  5IKH A;  2EWG A;  3UCA A;  3M9U A;  2DH4 A;  2Z7H A;  3LDW A;  3P5R A;  1KIY A;  3ZCD A;  3VJ9 A;  1DGP A;  4XQT F;  3OYR A;  1UBW A;  2ZCQ A;  2J1P A;  1WL3 A;  3VJE A;  3LOM A;  2QIS A;  5DGS F;  4OMG A;  3M01 A;  3ZMB A;  1YHL A;  4RXA A;  1RQJ A;  4JXY A;  3TFP A;  4EA2 A;  4LXW A;  4KUX A;  4F62 A;  2F94 F;  5CG6 A;  5ILY A;  3M00 A;  3N0G A;  4MC3 A;  3LGK A;  4LFV F;  4KKM A;  3TFN A;  3LLW A;  2H8O A;  3PKO A;  1ZW5 A;  5DGM F;  2E8T A;  1YYQ A;  4KVI A;  3WJO A;  2E8U A;  5DHK A;  2ONG A;  3TFV A;  1RTR A;  2AEL A;  1WL1 A;  4KWD A;  5ERM A;  3WCC A;  5DJR F;  3WCH A;  3NPK A;  3M02 A;  5E8H A;  4KQS A;  5ER8 A;  4NFI F;  2PS5 A;  1YYU A;  2ZEU A;  3WEK A;  4NKE A;  3W7F A;  2E91 A;  4MC0 A;  5B0J A;  1RQI A;  3DYF A;  3ICK A;  4LUU A;  4E1E A;  4L2X F;  3LEE A;  5DW7 A;  5ERO A;  3WJK A;  2AEK A;  2I19 A;  3QQV A;  5A0K A;  1V4I A;  2AZJ A;  4FJQ A;  2F92 F;  3ICZ A;  5B0K A;  5JV0 F;  4DHD A;  1KIZ A;  4LTZ A;  5DIQ F;  5IMP A;  3VJ8 A;  4LTV A;  3Q2Z A;  1VG6 A;  4RYP A;  4E9Z A;  5AFX A;  3MAV A;  5IMN A;  3KRF B;  3B7L A;  1WL2 A;  2AET A;  3ADZ A;  1HX9 A;  5IN8 A;  3LJI A;  4DWG A;  5HNA A;  4LIX A;  3N45 F;  4NG6 A;  3PH7 A;  3KRA B; 
#chains in the Genus database with same CATH topology
 4LZ3 A;  4LOB A;  3OAC B;  5E8L A;  3CP6 A;  5HN9 A;  2Q9Z A;  3N3L F;  4JXN A;  1YHK A;  4QXS F;  3DYG A;  3KRO B;  1VG4 A;  3WCD A;  3LK5 A;  2PS4 A;  1VG3 A;  3LZ9 A;  1N22 A;  3CKE A;  1HXA A;  3LGZ B;  3Q2Q A;  2VF6 A;  1JFG A;  5JUZ F;  3SDQ A;  1YYR A;  5E8K A;  3N1V F;  4KVY A;  4PVX F;  3NF2 A;  4F6V A;  5JV2 F;  1V4H A;  3ASX A;  2Z50 A;  4Q23 A;  3EFQ A;  4OGU A;  4DI5 A;  4KQ5 A;  5ERN A;  3ACX A;  4RXE A;  3WCL A;  1VG7 A;  3S4J A;  4LA5 A;  3ACW A;  5B03 A;  5A0J A;  3P8L A;  5B0M A;  3ICM A;  3AE0 A;  5IMI A;  4XQS F;  5AYP A;  5IL8 A;  4P0V A;  3ZMC A;  3WCG A;  1V4J A;  4GP1 A;  5ILJ A;  3WSA A;  5B0I A;  5ILK A;  2Z4X A;  3KRF A;  4NFJ F;  5ILI A;  1PS1 A;  4NFK F;  3N1W F;  4K10 A;  4JZB A;  3WJN A;  3AQ0 A;  3WCI A;  5B02 A;  4DWB A;  3LMD A;  4RXC A;  3KRC B;  3ICN A;  3TC1 A;  5CG5 A;  1YYT A;  2OA6 A;  2PS8 A;  3KRA A;  3EGT A;  3OAC A;  3WCF A;  4KFA A;  4LZC A;  5B01 A;  4DEM F;  4XQR F;  4MC8 A;  2E8W A;  3TS7 A;  3VJA A;  2FTZ A;  2J5C A;  3WC9 A;  5AHU B;  3APZ A;  5IL3 A;  1N24 A;  3V66 A;  5ILH A;  4QPF A;  3KRO A;  5IK6 A;  4LLT A;  5DJP F;  1HXG A;  4LZ0 A;  2Z4V A;  4KVW A;  1N1B A;  1UBY A;  1V4K A;  1YQ7 A;  2E94 A;  3OAB B;  2F8C F;  4GA3 A;  3P5P A;  4LPG F;  2F7M F;  3RYW A;  3EZ3 A;  4RNQ A;  2Z4Y A;  3VJC A;  3SDT A;  5IM1 A;  3WEJ A;  5ILZ A;  2J1O A;  4H5C F;  1WKZ A;  1N21 A;  3BNY A;  4JVJ F;  3NRI A;  3RBM A;  3IBA A;  4N9U A;  3N6K F;  2Z78 A;  3LSN A;  2Q80 A;  4E9U A;  5HN7 A;  2AZL A;  5AEL A;  3NPR A;  5JV1 F;  5IVG A;  2Z7I A;  4KVD A;  1N20 A;  4OMH A;  2Q58 A;  3CC9 A;  3WCM A;  4P0X A;  3KB9 A;  2ZY1 A;  4EA1 A;  3KRC A;  3KBK A;  2ONH A;  3VJD A;  3G4F A;  2ZEV A;  4LA6 A;  3N0F A;  1HXC A;  3PYA A;  4JZX A;  4LLS A;  2E8X A;  3QKC A;  4H5D F;  3V1V A;  3S9V A;  2PS7 A;  3WE9 A;  5EAT A;  5B00 A;  1VG2 A;  4LFE A;  2OGD A;  5KSX F;  3WEI A;  2OPM A;  3Q30 A;  5DJV F;  1N23 A;  3ID0 A;  1WMW A;  2Q9Y A;  3WCJ A;  4H5E F;  4ZQ8 A;  2ZCR A;  3V1X A;  2ZCO A;  5JA0 F;  3WCB A;  3SAE A;  3G4D A;  2O1O A;  3WSB A;  3M0G A;  4GAX A;  3OAB A;  1UBV A;  2E92 A;  4NKF A;  4WK5 A;  4OKM A;  3RMG A;  4DZW A;  4FP4 A;  5DZ2 A;  3IPI A;  4GP2 A;  4KK2 A;  1YYS A;  3KRP B;  3ZL6 A;  5IK0 A;  3WEG A;  1N1Z A;  3N5J F;  2Z52 A;  2AZK A;  4OKZ A;  2PS6 A;  5HN8 A;  4NUA A;  4HD1 A;  5DHI A;  5I1U A;  3P41 A;  2E93 A;  2E4O A;  5DGN F;  2OPN A;  2ZCS A;  5H9D A;  3WEH A;  3N3D A;  1WL0 A;  2E95 A;  4EA0 A;  4UMJ A;  3MZV A;  1EZF A;  4LFG A;  1YJ4 A;  2P1C A;  4LPH F;  4N1Z F;  1HM7 A;  3VJB A;  3WCA A;  3DYH A;  4KPJ A;  5ILD A;  3PYB A;  3AQC B;  2E90 A;  4F6X A;  1YV5 A;  1WY0 A;  5EAS A;  5B0L A;  1HM4 A;  1V4E A;  3ZOU A;  2E8V A;  1FPS A;  3N5H F;  3N49 F;  2RAH A;  2FOR A;  3PDE A;  3SDV A;  4DXJ A;  3ACY A;  1UBX A;  1JFA A;  3SDU A;  1DI1 A;  3Q1O A;  4KPD A;  4P0W A;  4RXD A;  2Z4Z A;  2Z4W A;  3SDR A;  4KQU A;  3RYE A;  5A0I A;  3WCE A;  3WEF A;  1YHM A;  5C05 A;  3LG5 A;  2F9K F;  3KRP A;  3BNX A;  5IKA A;  2F8Z F;  2F89 F;  3P8R A;  5IK9 A;  3AQB B;  4JYX A;  5EAU A;  3LVS A;  3N46 F;  4PVY F;  5IKH A;  2EWG A;  3UCA A;  3M9U A;  2DH4 A;  2Z7H A;  3LDW A;  3P5R A;  1KIY A;  3ZCD A;  3VJ9 A;  1DGP A;  4XQT F;  3OYR A;  1UBW A;  2ZCQ A;  2J1P A;  1WL3 A;  3VJE A;  3LOM A;  2QIS A;  5DGS F;  4OMG A;  3M01 A;  3ZMB A;  1YHL A;  4RXA A;  1RQJ A;  4JXY A;  3TFP A;  4EA2 A;  4LXW A;  4KUX A;  4F62 A;  2F94 F;  5CG6 A;  5ILY A;  3M00 A;  3N0G A;  4MC3 A;  3LGK A;  4LFV F;  4KKM A;  3TFN A;  3LLW A;  2H8O A;  3PKO A;  1ZW5 A;  5DGM F;  2E8T A;  1YYQ A;  4KVI A;  3WJO A;  2E8U A;  5DHK A;  2ONG A;  3TFV A;  1RTR A;  2AEL A;  1WL1 A;  4KWD A;  5ERM A;  3WCC A;  5DJR F;  3WCH A;  3NPK A;  3M02 A;  5E8H A;  4KQS A;  5ER8 A;  4NFI F;  2PS5 A;  1YYU A;  2ZEU A;  3WEK A;  4NKE A;  3W7F A;  2E91 A;  4MC0 A;  5B0J A;  1RQI A;  3DYF A;  3ICK A;  4LUU A;  4E1E A;  4L2X F;  3LEE A;  5DW7 A;  5ERO A;  3WJK A;  2AEK A;  2I19 A;  3QQV A;  5A0K A;  1V4I A;  2AZJ A;  4FJQ A;  2F92 F;  3ICZ A;  5B0K A;  5JV0 F;  4DHD A;  1KIZ A;  4LTZ A;  5DIQ F;  5IMP A;  3VJ8 A;  4LTV A;  3Q2Z A;  1VG6 A;  4RYP A;  4E9Z A;  5AFX A;  3MAV A;  5IMN A;  3KRF B;  3B7L A;  1WL2 A;  2AET A;  3ADZ A;  1HX9 A;  5IN8 A;  3LJI A;  4DWG A;  5HNA A;  4LIX A;  3N45 F;  4NG6 A;  3PH7 A;  3KRA B; 
#chains in the Genus database with same CATH homology
 4LZ3 A;  4LOB A;  3OAC B;  5E8L A;  3CP6 A;  5HN9 A;  2Q9Z A;  3N3L F;  4JXN A;  1YHK A;  4QXS F;  3DYG A;  3KRO B;  1VG4 A;  3WCD A;  3LK5 A;  2PS4 A;  1VG3 A;  3LZ9 A;  1N22 A;  3CKE A;  1HXA A;  3LGZ B;  3Q2Q A;  2VF6 A;  1JFG A;  5JUZ F;  3SDQ A;  1YYR A;  5E8K A;  3N1V F;  4KVY A;  4PVX F;  3NF2 A;  4F6V A;  5JV2 F;  1V4H A;  3ASX A;  2Z50 A;  4Q23 A;  3EFQ A;  4OGU A;  4DI5 A;  4KQ5 A;  5ERN A;  3ACX A;  4RXE A;  3WCL A;  1VG7 A;  3S4J A;  4LA5 A;  3ACW A;  5B03 A;  5A0J A;  3P8L A;  5B0M A;  3ICM A;  3AE0 A;  5IMI A;  4XQS F;  5AYP A;  5IL8 A;  4P0V A;  3ZMC A;  3WCG A;  1V4J A;  4GP1 A;  5ILJ A;  3WSA A;  5B0I A;  5ILK A;  2Z4X A;  3KRF A;  4NFJ F;  5ILI A;  1PS1 A;  4NFK F;  3N1W F;  4K10 A;  4JZB A;  3WJN A;  3AQ0 A;  3WCI A;  5B02 A;  4DWB A;  3LMD A;  4RXC A;  3KRC B;  3ICN A;  3TC1 A;  5CG5 A;  1YYT A;  2OA6 A;  2PS8 A;  3KRA A;  3EGT A;  3OAC A;  3WCF A;  4KFA A;  4LZC A;  5B01 A;  4DEM F;  4XQR F;  4MC8 A;  2E8W A;  3TS7 A;  3VJA A;  2FTZ A;  2J5C A;  3WC9 A;  5AHU B;  3APZ A;  5IL3 A;  1N24 A;  3V66 A;  5ILH A;  4QPF A;  3KRO A;  5IK6 A;  4LLT A;  5DJP F;  1HXG A;  4LZ0 A;  2Z4V A;  4KVW A;  1N1B A;  1UBY A;  1V4K A;  1YQ7 A;  2E94 A;  3OAB B;  2F8C F;  4GA3 A;  3P5P A;  4LPG F;  2F7M F;  3RYW A;  3EZ3 A;  4RNQ A;  2Z4Y A;  3VJC A;  3SDT A;  5IM1 A;  3WEJ A;  5ILZ A;  2J1O A;  4H5C F;  1WKZ A;  1N21 A;  3BNY A;  4JVJ F;  3NRI A;  3RBM A;  3IBA A;  4N9U A;  3N6K F;  2Z78 A;  3LSN A;  2Q80 A;  4E9U A;  5HN7 A;  2AZL A;  5AEL A;  3NPR A;  5JV1 F;  5IVG A;  2Z7I A;  4KVD A;  1N20 A;  4OMH A;  2Q58 A;  3CC9 A;  3WCM A;  4P0X A;  3KB9 A;  2ZY1 A;  4EA1 A;  3KRC A;  3KBK A;  2ONH A;  3VJD A;  3G4F A;  2ZEV A;  4LA6 A;  3N0F A;  1HXC A;  3PYA A;  4JZX A;  4LLS A;  2E8X A;  3QKC A;  4H5D F;  3V1V A;  3S9V A;  2PS7 A;  3WE9 A;  5EAT A;  5B00 A;  1VG2 A;  4LFE A;  2OGD A;  5KSX F;  3WEI A;  2OPM A;  3Q30 A;  5DJV F;  1N23 A;  3ID0 A;  1WMW A;  2Q9Y A;  3WCJ A;  4H5E F;  4ZQ8 A;  2ZCR A;  3V1X A;  2ZCO A;  5JA0 F;  3WCB A;  3SAE A;  3G4D A;  2O1O A;  3WSB A;  3M0G A;  4GAX A;  3OAB A;  1UBV A;  2E92 A;  4NKF A;  4WK5 A;  4OKM A;  3RMG A;  4DZW A;  4FP4 A;  5DZ2 A;  3IPI A;  4GP2 A;  4KK2 A;  1YYS A;  3KRP B;  3ZL6 A;  5IK0 A;  3WEG A;  1N1Z A;  3N5J F;  2Z52 A;  2AZK A;  4OKZ A;  2PS6 A;  5HN8 A;  4NUA A;  4HD1 A;  5DHI A;  5I1U A;  3P41 A;  2E93 A;  2E4O A;  5DGN F;  2OPN A;  2ZCS A;  5H9D A;  3WEH A;  3N3D A;  1WL0 A;  2E95 A;  4EA0 A;  4UMJ A;  3MZV A;  1EZF A;  4LFG A;  1YJ4 A;  2P1C A;  4LPH F;  4N1Z F;  1HM7 A;  3VJB A;  3WCA A;  3DYH A;  4KPJ A;  5ILD A;  3PYB A;  3AQC B;  2E90 A;  4F6X A;  1YV5 A;  1WY0 A;  5EAS A;  5B0L A;  1HM4 A;  1V4E A;  3ZOU A;  2E8V A;  1FPS A;  3N5H F;  3N49 F;  2RAH A;  2FOR A;  3PDE A;  3SDV A;  4DXJ A;  3ACY A;  1UBX A;  1JFA A;  3SDU A;  1DI1 A;  3Q1O A;  4KPD A;  4P0W A;  4RXD A;  2Z4Z A;  2Z4W A;  3SDR A;  4KQU A;  3RYE A;  5A0I A;  3WCE A;  3WEF A;  1YHM A;  5C05 A;  3LG5 A;  2F9K F;  3KRP A;  3BNX A;  5IKA A;  2F8Z F;  2F89 F;  3P8R A;  5IK9 A;  3AQB B;  4JYX A;  5EAU A;  3LVS A;  3N46 F;  4PVY F;  5IKH A;  2EWG A;  3UCA A;  3M9U A;  2DH4 A;  2Z7H A;  3LDW A;  3P5R A;  1KIY A;  3ZCD A;  3VJ9 A;  1DGP A;  4XQT F;  3OYR A;  1UBW A;  2ZCQ A;  2J1P A;  1WL3 A;  3VJE A;  3LOM A;  2QIS A;  5DGS F;  4OMG A;  3M01 A;  3ZMB A;  1YHL A;  4RXA A;  1RQJ A;  4JXY A;  3TFP A;  4EA2 A;  4LXW A;  4KUX A;  4F62 A;  2F94 F;  5CG6 A;  5ILY A;  3M00 A;  3N0G A;  4MC3 A;  3LGK A;  4LFV F;  4KKM A;  3TFN A;  3LLW A;  2H8O A;  3PKO A;  1ZW5 A;  5DGM F;  2E8T A;  1YYQ A;  4KVI A;  3WJO A;  2E8U A;  5DHK A;  2ONG A;  3TFV A;  1RTR A;  2AEL A;  1WL1 A;  4KWD A;  5ERM A;  3WCC A;  5DJR F;  3WCH A;  3NPK A;  3M02 A;  5E8H A;  4KQS A;  5ER8 A;  4NFI F;  2PS5 A;  1YYU A;  2ZEU A;  3WEK A;  4NKE A;  3W7F A;  2E91 A;  4MC0 A;  5B0J A;  1RQI A;  3DYF A;  3ICK A;  4LUU A;  4E1E A;  4L2X F;  3LEE A;  5DW7 A;  5ERO A;  3WJK A;  2AEK A;  2I19 A;  3QQV A;  5A0K A;  1V4I A;  2AZJ A;  4FJQ A;  2F92 F;  3ICZ A;  5B0K A;  5JV0 F;  4DHD A;  1KIZ A;  4LTZ A;  5DIQ F;  5IMP A;  3VJ8 A;  4LTV A;  3Q2Z A;  1VG6 A;  4RYP A;  4E9Z A;  5AFX A;  3MAV A;  5IMN A;  3KRF B;  3B7L A;  1WL2 A;  2AET A;  3ADZ A;  1HX9 A;  5IN8 A;  3LJI A;  4DWG A;  5HNA A;  4LIX A;  3N45 F;  4NG6 A;  3PH7 A;  3KRA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...