2Q80A

Crystal structure of human geranylgeranyl pyrophosphate synthase bound to ggpp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
291
structure length
285
Chain Sequence
ETVQRILLEPYKYLLQLPGKQVRTKLSQAFNHWLKVPEDKLQIIIEVTEMLHNASLLIDDIEDNSKLRRGFPVAHSIYGIPSVINSANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQGQGLDIYWRDNYTCPTEEEYKAMVLQKTGGLFGLAVGLMQLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl pyrophosphate synthetase
publication title The crystal structure of human geranylgeranyl pyrophosphate synthase reveals a novel hexameric arrangement and inhibitory product binding
pubmed doi rcsb
source organism Homo sapiens
total genus 124
structure length 285
sequence length 291
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2007-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2q80A00
3WCIA 1V4KA 1VG6A 5ILJA 2AZKA 4OGUA 3WEJA 4LFVF 5B0MA 3WEKA 4MC8A 3S9VA 5ILHA 1VG3A 3WCLA 2OPMA 3ACWA 4OMHA 2ONHA 4KK2A 4NG6A 4KQUA 4KPDA 5DGMF 3KRPA 3ICKA 4LZ0A 1RQJA 3WCEA 5JV2F 5EASA 3LSNA 4DWGA 2E91A 3ID0A 1DI1A 3KROA 3NF2A 2Z78A 3B7LA 3N45F 2Z7HA 3ZMCA 3Q30A 3PDEA 4EA2A 3RYEA 5E8HA 4PVXF 5B01A 3KRFB 3RBMA 2F89F 1N1BA 3PYAA 4PVYF 3QQVA 2Z50A 4NKFA 2AELA 2PS8A 1VG2A 3AQCB 5EAUA 4LOBA 2ZCQA 3Q1OA 3TFVA 3G4DA 1N24A 4LTZA 2Q9ZA 4QXSF 1YYRA 4E1EA 3KB9A 1WL3A 3KRCB 3ICZA 2Z4YA 3WJKA 3VJCA 5EATA 3S4JA 4OMGA 1VG7A 3WC9A 4ZQ8A 1YV5A 2Q80A 3WCGA 3PH7A 2E4OA 5B0IA 2AZJA 4HD1A 2PS6A 5HN9A 1UBYA 2E8VA 4H5EF 3SDTA 3V66A 1YQ7A 3P8LA 5IM1A 1V4EA 1V4IA 2Q9YA 5AFXA 3VJEA 3P5PA 4KKMA 3LJIA 3LK5A 3KBKA 5B0LA 4DHDA 3OABA 5KSXF 4EA1A 4RYPA 1ZW5A 3ACXA 1YYTA 3P8RA 1V4JA 5DIQF 4Q23A 1YYUA 2J1PA 5IK9A 5IMIA 2F8ZF 2J5CA 2P1CA 4KVIA 5E8LA 1HXAA 5H9DA 3M02A 4KWDA 4LFEA 4OKMA 4FP4A 3DYFA 3N5JF 3WJNA 4EA0A 4LUUA 4WK5A 1N1ZA 1UBVA 5C05A 3G4FA 4JZBA 3WE9A 1WY0A 3EFQA 3M0GA 1JFGA 4LA6A 3LOMA 4KUXA 4KVDA 3LZ9A 1YJ4A 3NRIA 3M9UA 3WCMA 5AELA 4DWBA 5JV0F 2E8XA 3CP6A 3P5RA 5DZ2A 2Z52A 3BNYA 5ILDA 1HM4A 3VJDA 5AYPA 3OABB 3TC1A 4E9ZA 3OACA 4KQ5A 4JXNA 4N1ZF 2F92F 5IK6A 3WEIA 3LMDA 4UMJA 4F6XA 3N0FA 3IPIA 4DI5A 3M01A 5ILZA 3N46F 3EGTA 2E95A 4GA3A 3WEFA 5IVGA 4DZWA 5B0KA 5IN8A 4K10A 3N6KF 3M00A 1DGPA 4LZ3A 2O1OA 3WEGA 2ZY1A 1PS1A 4RNQA 3MZVA 4H5DF 2F8CF 5IL8A 3WCAA 4LXWA 4QPFA 3VJ8A 5ILIA 1WL1A 3KRPB 1RTRA 5IKHA 3CKEA 5JA0F 4LPHF 4LTVA 2QISA 5IL3A 5DGSF 4LZCA 3OACB 3VJ9A 3KROB 1V4HA 5IMNA 2ZCRA 2OGDA 1VG4A 4H5CF 3LVSA 4N9UA 4LLSA 3IBAA 2OA6A 2E8UA 3WCBA 3WCCA 5IMPA 2OPNA 3RYWA 4JYXA 1UBWA 3AQ0A 3SDUA 3ACYA 2E92A 2PS7A 5A0KA 5DJVF 1EZFA 3SDVA 5DJRF 5ERMA 3WSBA 5DW7A 3N1VF 2E90A 1WL2A 2E8TA 3ZL6A 1WMWA 4DEMF 4JXYA 5E8KA 3N49F 2F94F 1JFAA 2Q58A 4LA5A 3ADZA 4LLTA 2EWGA 4NFJF 2ONGA 4GAXA 1YHMA 1N21A 1YHKA 3LGKA 3NPRA 3AE0A 5DJPF 5DHKA 4F62A 1N20A 5JV1F 3WCJA 5DHIA 5HN7A 5ERNA 2F9KF 4GP1A 3TFPA 1FPSA 4RXAA 3LG5A 2RAHA 3KRFA 1HXGA 3WJOA 1N22A 3EZ3A 5A0JA 2ZEVA 4NKEA 3WCFA 5JUZF 2FTZA 3N3DA 2H8OA 4JVJF 3LLWA 2PS4A 3ZMBA 2F7MF 1KIZA 5B03A 3PKOA 3KRCA 5IKAA 3TFNA 4NFIF 4KFAA 5CG5A 5ILKA 2ZCSA 1YHLA 5B00A 4E9UA 2E94A 4P0WA 4FJQA 2Z4ZA 4RXDA 3VJAA 2DH4A 3LEEA 5CG6A 2E93A 4LFGA 5I1UA 3LGZB 3N3LF 3WCHA 1HXCA 3MAVA 3ZOUA 3KRAA 5IK0A 4KVYA 3Q2ZA 3N1WF 5ER8A 5HN8A 3BNXA 1WL0A 3VJBA 5B02A 2Z4XA 3ICMA 3WCDA 4P0VA 1HX9A 3WEHA 2PS5A 2J1OA 3WSAA 3DYHA 2AETA 3P41A 5AHUB 3RMGA 5ILYA 2AZLA 4MC0A 1UBXA 4XQSF 2ZEUA 4RXEA 2E8WA 2FORA 4NFKF 4OKZA 3V1VA 4DXJA 1YYSA 4MC3A 3UCAA 4XQRF 4P0XA 3QKCA 3TS7A 2Z7IA 4KPJA 1N23A 2I19A 4KQSA 4LIXA 4RXCA 4LPGF 3NPKA 2Z4WA 3KRAB 3AQBB 1RQIA 1WKZA 5A0IA 3ASXA 3W7FA 5DGNF 3CC9A 3ICNA 2ZCOA 5HNAA 4NUAA 3PYBA 1HM7A 3DYGA 4JZXA 4L2XF 2VF6A 3N0GA 3APZA 3V1XA 1YYQA 3SDRA 3Q2QA 5EROA 1KIYA 3ZCDA 2AEKA 4XQTF 3SAEA 4KVWA 3SDQA 2Z4VA 3LDWA 5B0JA 3OYRA 4F6VA 4GP2A 3N5HF
chains in the Genus database with same CATH superfamily
3WCIA 1V4KA 1VG6A 5ILJA 2AZKA 4OGUA 3WEJA 4LFVF 5B0MA 3WEKA 4MC8A 3S9VA 5ILHA 1VG3A 3WCLA 2OPMA 3ACWA 4OMHA 2ONHA 4KK2A 4NG6A 4KQUA 4KPDA 5DGMF 3KRPA 3ICKA 4LZ0A 1RQJA 3WCEA 5JV2F 5EASA 3LSNA 4DWGA 2E91A 3ID0A 1DI1A 3KROA 3NF2A 2Z78A 3B7LA 3N45F 2Z7HA 3ZMCA 3Q30A 3PDEA 4EA2A 3RYEA 5E8HA 4PVXF 5B01A 3KRFB 3RBMA 2F89F 1N1BA 3PYAA 4PVYF 3QQVA 2Z50A 4NKFA 2AELA 2PS8A 1VG2A 3AQCB 5EAUA 4LOBA 2ZCQA 3Q1OA 3TFVA 3G4DA 1N24A 4LTZA 2Q9ZA 4QXSF 1YYRA 4E1EA 3KB9A 1WL3A 3KRCB 3ICZA 2Z4YA 3WJKA 3VJCA 5EATA 3S4JA 4OMGA 1VG7A 3WC9A 4ZQ8A 1YV5A 2Q80A 3WCGA 3PH7A 2E4OA 5B0IA 2AZJA 4HD1A 2PS6A 5HN9A 1UBYA 2E8VA 4H5EF 3SDTA 3V66A 1YQ7A 3P8LA 5IM1A 1V4EA 1V4IA 2Q9YA 5AFXA 3VJEA 3P5PA 4KKMA 3LJIA 3LK5A 3KBKA 5B0LA 4DHDA 3OABA 5KSXF 4EA1A 4RYPA 1ZW5A 3ACXA 1YYTA 3P8RA 1V4JA 5DIQF 4Q23A 1YYUA 2J1PA 5IK9A 5IMIA 2F8ZF 2J5CA 2P1CA 4KVIA 5E8LA 1HXAA 5H9DA 3M02A 4KWDA 4LFEA 4OKMA 4FP4A 3DYFA 3N5JF 3WJNA 4EA0A 4LUUA 4WK5A 1N1ZA 1UBVA 5C05A 3G4FA 4JZBA 3WE9A 1WY0A 3EFQA 3M0GA 1JFGA 4LA6A 3LOMA 4KUXA 4KVDA 3LZ9A 1YJ4A 3NRIA 3M9UA 3WCMA 5AELA 4DWBA 5JV0F 2E8XA 3CP6A 3P5RA 5DZ2A 2Z52A 3BNYA 5ILDA 1HM4A 3VJDA 5AYPA 3OABB 3TC1A 4E9ZA 3OACA 4KQ5A 4JXNA 4N1ZF 2F92F 5IK6A 3WEIA 3LMDA 4UMJA 4F6XA 3N0FA 3IPIA 4DI5A 3M01A 5ILZA 3N46F 3EGTA 2E95A 4GA3A 3WEFA 5IVGA 4DZWA 5B0KA 5IN8A 4K10A 3N6KF 3M00A 1DGPA 4LZ3A 2O1OA 3WEGA 2ZY1A 1PS1A 4RNQA 3MZVA 4H5DF 2F8CF 5IL8A 3WCAA 4LXWA 4QPFA 3VJ8A 5ILIA 1WL1A 3KRPB 1RTRA 5IKHA 3CKEA 5JA0F 4LPHF 4LTVA 2QISA 5IL3A 5DGSF 4LZCA 3OACB 3VJ9A 3KROB 1V4HA 5IMNA 2ZCRA 2OGDA 1VG4A 4H5CF 3LVSA 4N9UA 4LLSA 3IBAA 2OA6A 2E8UA 3WCBA 3WCCA 5IMPA 2OPNA 3RYWA 4JYXA 1UBWA 3AQ0A 3SDUA 3ACYA 2E92A 2PS7A 5A0KA 5DJVF 1EZFA 3SDVA 5DJRF 5ERMA 3WSBA 5DW7A 3N1VF 2E90A 1WL2A 2E8TA 3ZL6A 1WMWA 4DEMF 4JXYA 5E8KA 3N49F 2F94F 1JFAA 2Q58A 4LA5A 3ADZA 4LLTA 2EWGA 4NFJF 2ONGA 4GAXA 1YHMA 1N21A 1YHKA 3LGKA 3NPRA 3AE0A 5DJPF 5DHKA 4F62A 1N20A 5JV1F 3WCJA 5DHIA 5HN7A 5ERNA 2F9KF 4GP1A 3TFPA 1FPSA 4RXAA 3LG5A 2RAHA 3KRFA 1HXGA 3WJOA 1N22A 3EZ3A 5A0JA 2ZEVA 4NKEA 3WCFA 5JUZF 2FTZA 3N3DA 2H8OA 4JVJF 3LLWA 2PS4A 3ZMBA 2F7MF 1KIZA 5B03A 3PKOA 3KRCA 5IKAA 3TFNA 4NFIF 4KFAA 5CG5A 5ILKA 2ZCSA 1YHLA 5B00A 4E9UA 2E94A 4P0WA 4FJQA 2Z4ZA 4RXDA 3VJAA 2DH4A 3LEEA 5CG6A 2E93A 4LFGA 5I1UA 3LGZB 3N3LF 3WCHA 1HXCA 3MAVA 3ZOUA 3KRAA 5IK0A 4KVYA 3Q2ZA 3N1WF 5ER8A 5HN8A 3BNXA 1WL0A 3VJBA 5B02A 2Z4XA 3ICMA 3WCDA 4P0VA 1HX9A 3WEHA 2PS5A 2J1OA 3WSAA 3DYHA 2AETA 3P41A 5AHUB 3RMGA 5ILYA 2AZLA 4MC0A 1UBXA 4XQSF 2ZEUA 4RXEA 2E8WA 2FORA 4NFKF 4OKZA 3V1VA 4DXJA 1YYSA 4MC3A 3UCAA 4XQRF 4P0XA 3QKCA 3TS7A 2Z7IA 4KPJA 1N23A 2I19A 4KQSA 4LIXA 4RXCA 4LPGF 3NPKA 2Z4WA 3KRAB 3AQBB 1RQIA 1WKZA 5A0IA 3ASXA 3W7FA 5DGNF 3CC9A 3ICNA 2ZCOA 5HNAA 4NUAA 3PYBA 1HM7A 3DYGA 4JZXA 4L2XF 2VF6A 3N0GA 3APZA 3V1XA 1YYQA 3SDRA 3Q2QA 5EROA 1KIYA 3ZCDA 2AEKA 4XQTF 3SAEA 4KVWA 3SDQA 2Z4VA 3LDWA 5B0JA 3OYRA 4F6VA 4GP2A 3N5HF
chains in the Genus database with same CATH topology
3WCIA 1V4KA 1VG6A 5ILJA 2AZKA 4OGUA 3WEJA 4LFVF 5B0MA 3WEKA 4MC8A 3S9VA 5ILHA 1VG3A 3WCLA 2OPMA 3ACWA 4OMHA 2ONHA 4KK2A 4NG6A 4KQUA 4KPDA 5DGMF 3KRPA 3ICKA 4LZ0A 1RQJA 3WCEA 5JV2F 5EASA 3LSNA 4DWGA 2E91A 3ID0A 1DI1A 3KROA 3NF2A 2Z78A 3B7LA 3N45F 2Z7HA 3ZMCA 3Q30A 3PDEA 4EA2A 3RYEA 5E8HA 4PVXF 5B01A 3KRFB 3RBMA 2F89F 1N1BA 3PYAA 4PVYF 3QQVA 2Z50A 4NKFA 2AELA 2PS8A 1VG2A 3AQCB 5EAUA 4LOBA 2ZCQA 3Q1OA 3TFVA 3G4DA 1N24A 4LTZA 2Q9ZA 4QXSF 1YYRA 4E1EA 3KB9A 1WL3A 3KRCB 3ICZA 2Z4YA 3WJKA 3VJCA 5EATA 3S4JA 4OMGA 1VG7A 3WC9A 4ZQ8A 1YV5A 2Q80A 3WCGA 3PH7A 2E4OA 5B0IA 2AZJA 4HD1A 2PS6A 5HN9A 1UBYA 2E8VA 4H5EF 3SDTA 3V66A 1YQ7A 3P8LA 5IM1A 1V4EA 1V4IA 2Q9YA 5AFXA 3VJEA 3P5PA 4KKMA 3LJIA 3LK5A 3KBKA 5B0LA 4DHDA 3OABA 5KSXF 4EA1A 4RYPA 1ZW5A 3ACXA 1YYTA 3P8RA 1V4JA 5DIQF 4Q23A 1YYUA 2J1PA 5IK9A 5IMIA 2F8ZF 2J5CA 2P1CA 4KVIA 5E8LA 1HXAA 5H9DA 3M02A 4KWDA 4LFEA 4OKMA 4FP4A 3DYFA 3N5JF 3WJNA 4EA0A 4LUUA 4WK5A 1N1ZA 1UBVA 5C05A 3G4FA 4JZBA 3WE9A 1WY0A 3EFQA 3M0GA 1JFGA 4LA6A 3LOMA 4KUXA 4KVDA 3LZ9A 1YJ4A 3NRIA 3M9UA 3WCMA 5AELA 4DWBA 5JV0F 2E8XA 3CP6A 3P5RA 5DZ2A 2Z52A 3BNYA 5ILDA 1HM4A 3VJDA 5AYPA 3OABB 3TC1A 4E9ZA 3OACA 4KQ5A 4JXNA 4N1ZF 2F92F 5IK6A 3WEIA 3LMDA 4UMJA 4F6XA 3N0FA 3IPIA 4DI5A 3M01A 5ILZA 3N46F 3EGTA 2E95A 4GA3A 3WEFA 5IVGA 4DZWA 5B0KA 5IN8A 4K10A 3N6KF 3M00A 1DGPA 4LZ3A 2O1OA 3WEGA 2ZY1A 1PS1A 4RNQA 3MZVA 4H5DF 2F8CF 5IL8A 3WCAA 4LXWA 4QPFA 3VJ8A 5ILIA 1WL1A 3KRPB 1RTRA 5IKHA 3CKEA 5JA0F 4LPHF 4LTVA 2QISA 5IL3A 5DGSF 4LZCA 3OACB 3VJ9A 3KROB 1V4HA 5IMNA 2ZCRA 2OGDA 1VG4A 4H5CF 3LVSA 4N9UA 4LLSA 3IBAA 2OA6A 2E8UA 3WCBA 3WCCA 5IMPA 2OPNA 3RYWA 4JYXA 1UBWA 3AQ0A 3SDUA 3ACYA 2E92A 2PS7A 5A0KA 5DJVF 1EZFA 3SDVA 5DJRF 5ERMA 3WSBA 5DW7A 3N1VF 2E90A 1WL2A 2E8TA 3ZL6A 1WMWA 4DEMF 4JXYA 5E8KA 3N49F 2F94F 1JFAA 2Q58A 4LA5A 3ADZA 4LLTA 2EWGA 4NFJF 2ONGA 4GAXA 1YHMA 1N21A 1YHKA 3LGKA 3NPRA 3AE0A 5DJPF 5DHKA 4F62A 1N20A 5JV1F 3WCJA 5DHIA 5HN7A 5ERNA 2F9KF 4GP1A 3TFPA 1FPSA 4RXAA 3LG5A 2RAHA 3KRFA 1HXGA 3WJOA 1N22A 3EZ3A 5A0JA 2ZEVA 4NKEA 3WCFA 5JUZF 2FTZA 3N3DA 2H8OA 4JVJF 3LLWA 2PS4A 3ZMBA 2F7MF 1KIZA 5B03A 3PKOA 3KRCA 5IKAA 3TFNA 4NFIF 4KFAA 5CG5A 5ILKA 2ZCSA 1YHLA 5B00A 4E9UA 2E94A 4P0WA 4FJQA 2Z4ZA 4RXDA 3VJAA 2DH4A 3LEEA 5CG6A 2E93A 4LFGA 5I1UA 3LGZB 3N3LF 3WCHA 1HXCA 3MAVA 3ZOUA 3KRAA 5IK0A 4KVYA 3Q2ZA 3N1WF 5ER8A 5HN8A 3BNXA 1WL0A 3VJBA 5B02A 2Z4XA 3ICMA 3WCDA 4P0VA 1HX9A 3WEHA 2PS5A 2J1OA 3WSAA 3DYHA 2AETA 3P41A 5AHUB 3RMGA 5ILYA 2AZLA 4MC0A 1UBXA 4XQSF 2ZEUA 4RXEA 2E8WA 2FORA 4NFKF 4OKZA 3V1VA 4DXJA 1YYSA 4MC3A 3UCAA 4XQRF 4P0XA 3QKCA 3TS7A 2Z7IA 4KPJA 1N23A 2I19A 4KQSA 4LIXA 4RXCA 4LPGF 3NPKA 2Z4WA 3KRAB 3AQBB 1RQIA 1WKZA 5A0IA 3ASXA 3W7FA 5DGNF 3CC9A 3ICNA 2ZCOA 5HNAA 4NUAA 3PYBA 1HM7A 3DYGA 4JZXA 4L2XF 2VF6A 3N0GA 3APZA 3V1XA 1YYQA 3SDRA 3Q2QA 5EROA 1KIYA 3ZCDA 2AEKA 4XQTF 3SAEA 4KVWA 3SDQA 2Z4VA 3LDWA 5B0JA 3OYRA 4F6VA 4GP2A 3N5HF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCI A;  1V4K A;  1VG6 A;  5ILJ A;  2AZK A;  4OGU A;  3WEJ A;  4LFV F;  5B0M A;  3WEK A;  4MC8 A;  3S9V A;  5ILH A;  1VG3 A;  3WCL A;  2OPM A;  3ACW A;  4OMH A;  2ONH A;  4KK2 A;  4NG6 A;  4KQU A;  4KPD A;  5DGM F;  3KRP A;  3ICK A;  4LZ0 A;  1RQJ A;  3WCE A;  5JV2 F;  5EAS A;  3LSN A;  4DWG A;  2E91 A;  3ID0 A;  1DI1 A;  3KRO A;  3NF2 A;  2Z78 A;  3B7L A;  3N45 F;  2Z7H A;  3ZMC A;  3Q30 A;  3PDE A;  4EA2 A;  3RYE A;  5E8H A;  4PVX F;  5B01 A;  3KRF B;  3RBM A;  2F89 F;  1N1B A;  3PYA A;  4PVY F;  3QQV A;  2Z50 A;  4NKF A;  2AEL A;  2PS8 A;  1VG2 A;  3AQC B;  5EAU A;  4LOB A;  2ZCQ A;  3Q1O A;  3TFV A;  3G4D A;  1N24 A;  4LTZ A;  2Q9Z A;  4QXS F;  1YYR A;  4E1E A;  3KB9 A;  1WL3 A;  3KRC B;  3ICZ A;  2Z4Y A;  3WJK A;  3VJC A;  5EAT A;  3S4J A;  4OMG A;  1VG7 A;  3WC9 A;  4ZQ8 A;  1YV5 A;  2Q80 A;  3WCG A;  3PH7 A;  2E4O A;  5B0I A;  2AZJ A;  4HD1 A;  2PS6 A;  5HN9 A;  1UBY A;  2E8V A;  4H5E F;  3SDT A;  3V66 A;  1YQ7 A;  3P8L A;  5IM1 A;  1V4E A;  1V4I A;  2Q9Y A;  5AFX A;  3VJE A;  3P5P A;  4KKM A;  3LJI A;  3LK5 A;  3KBK A;  5B0L A;  4DHD A;  3OAB A;  5KSX F;  4EA1 A;  4RYP A;  1ZW5 A;  3ACX A;  1YYT A;  3P8R A;  1V4J A;  5DIQ F;  4Q23 A;  1YYU A;  2J1P A;  5IK9 A;  5IMI A;  2F8Z F;  2J5C A;  2P1C A;  4KVI A;  5E8L A;  1HXA A;  5H9D A;  3M02 A;  4KWD A;  4LFE A;  4OKM A;  4FP4 A;  3DYF A;  3N5J F;  3WJN A;  4EA0 A;  4LUU A;  4WK5 A;  1N1Z A;  1UBV A;  5C05 A;  3G4F A;  4JZB A;  3WE9 A;  1WY0 A;  3EFQ A;  3M0G A;  1JFG A;  4LA6 A;  3LOM A;  4KUX A;  4KVD A;  3LZ9 A;  1YJ4 A;  3NRI A;  3M9U A;  3WCM A;  5AEL A;  4DWB A;  5JV0 F;  2E8X A;  3CP6 A;  3P5R A;  5DZ2 A;  2Z52 A;  3BNY A;  5ILD A;  1HM4 A;  3VJD A;  5AYP A;  3OAB B;  3TC1 A;  4E9Z A;  3OAC A;  4KQ5 A;  4JXN A;  4N1Z F;  2F92 F;  5IK6 A;  3WEI A;  3LMD A;  4UMJ A;  4F6X A;  3N0F A;  3IPI A;  4DI5 A;  3M01 A;  5ILZ A;  3N46 F;  3EGT A;  2E95 A;  4GA3 A;  3WEF A;  5IVG A;  4DZW A;  5B0K A;  5IN8 A;  4K10 A;  3N6K F;  3M00 A;  1DGP A;  4LZ3 A;  2O1O A;  3WEG A;  2ZY1 A;  1PS1 A;  4RNQ A;  3MZV A;  4H5D F;  2F8C F;  5IL8 A;  3WCA A;  4LXW A;  4QPF A;  3VJ8 A;  5ILI A;  1WL1 A;  3KRP B;  1RTR A;  5IKH A;  3CKE A;  5JA0 F;  4LPH F;  4LTV A;  2QIS A;  5IL3 A;  5DGS F;  4LZC A;  3OAC B;  3VJ9 A;  3KRO B;  1V4H A;  5IMN A;  2ZCR A;  2OGD A;  1VG4 A;  4H5C F;  3LVS A;  4N9U A;  4LLS A;  3IBA A;  2OA6 A;  2E8U A;  3WCB A;  3WCC A;  5IMP A;  2OPN A;  3RYW A;  4JYX A;  1UBW A;  3AQ0 A;  3SDU A;  3ACY A;  2E92 A;  2PS7 A;  5A0K A;  5DJV F;  1EZF A;  3SDV A;  5DJR F;  5ERM A;  3WSB A;  5DW7 A;  3N1V F;  2E90 A;  1WL2 A;  2E8T A;  3ZL6 A;  1WMW A;  4DEM F;  4JXY A;  5E8K A;  3N49 F;  2F94 F;  1JFA A;  2Q58 A;  4LA5 A;  3ADZ A;  4LLT A;  2EWG A;  4NFJ F;  2ONG A;  4GAX A;  1YHM A;  1N21 A;  1YHK A;  3LGK A;  3NPR A;  3AE0 A;  5DJP F;  5DHK A;  4F62 A;  1N20 A;  5JV1 F;  3WCJ A;  5DHI A;  5HN7 A;  5ERN A;  2F9K F;  4GP1 A;  3TFP A;  1FPS A;  4RXA A;  3LG5 A;  2RAH A;  3KRF A;  1HXG A;  3WJO A;  1N22 A;  3EZ3 A;  5A0J A;  2ZEV A;  4NKE A;  3WCF A;  5JUZ F;  2FTZ A;  3N3D A;  2H8O A;  4JVJ F;  3LLW A;  2PS4 A;  3ZMB A;  2F7M F;  1KIZ A;  5B03 A;  3PKO A;  3KRC A;  5IKA A;  3TFN A;  4NFI F;  4KFA A;  5CG5 A;  5ILK A;  2ZCS A;  1YHL A;  5B00 A;  4E9U A;  2E94 A;  4P0W A;  4FJQ A;  2Z4Z A;  4RXD A;  3VJA A;  2DH4 A;  3LEE A;  5CG6 A;  2E93 A;  4LFG A;  5I1U A;  3LGZ B;  3N3L F;  3WCH A;  1HXC A;  3MAV A;  3ZOU A;  3KRA A;  5IK0 A;  4KVY A;  3Q2Z A;  3N1W F;  5ER8 A;  5HN8 A;  3BNX A;  1WL0 A;  3VJB A;  5B02 A;  2Z4X A;  3ICM A;  3WCD A;  4P0V A;  1HX9 A;  3WEH A;  2PS5 A;  2J1O A;  3WSA A;  3DYH A;  2AET A;  3P41 A;  5AHU B;  3RMG A;  5ILY A;  2AZL A;  4MC0 A;  1UBX A;  4XQS F;  2ZEU A;  4RXE A;  2E8W A;  2FOR A;  4NFK F;  4OKZ A;  3V1V A;  4DXJ A;  1YYS A;  4MC3 A;  3UCA A;  4XQR F;  4P0X A;  3QKC A;  3TS7 A;  2Z7I A;  4KPJ A;  1N23 A;  2I19 A;  4KQS A;  4LIX A;  4RXC A;  4LPG F;  3NPK A;  2Z4W A;  3KRA B;  3AQB B;  1RQI A;  1WKZ A;  5A0I A;  3ASX A;  3W7F A;  5DGN F;  3CC9 A;  3ICN A;  2ZCO A;  5HNA A;  4NUA A;  3PYB A;  1HM7 A;  3DYG A;  4JZX A;  4L2X F;  2VF6 A;  3N0G A;  3APZ A;  3V1X A;  1YYQ A;  3SDR A;  3Q2Q A;  5ERO A;  1KIY A;  3ZCD A;  2AEK A;  4XQT F;  3SAE A;  4KVW A;  3SDQ A;  2Z4V A;  3LDW A;  5B0J A;  3OYR A;  4F6V A;  4GP2 A;  3N5H F; 
#chains in the Genus database with same CATH topology
 3WCI A;  1V4K A;  1VG6 A;  5ILJ A;  2AZK A;  4OGU A;  3WEJ A;  4LFV F;  5B0M A;  3WEK A;  4MC8 A;  3S9V A;  5ILH A;  1VG3 A;  3WCL A;  2OPM A;  3ACW A;  4OMH A;  2ONH A;  4KK2 A;  4NG6 A;  4KQU A;  4KPD A;  5DGM F;  3KRP A;  3ICK A;  4LZ0 A;  1RQJ A;  3WCE A;  5JV2 F;  5EAS A;  3LSN A;  4DWG A;  2E91 A;  3ID0 A;  1DI1 A;  3KRO A;  3NF2 A;  2Z78 A;  3B7L A;  3N45 F;  2Z7H A;  3ZMC A;  3Q30 A;  3PDE A;  4EA2 A;  3RYE A;  5E8H A;  4PVX F;  5B01 A;  3KRF B;  3RBM A;  2F89 F;  1N1B A;  3PYA A;  4PVY F;  3QQV A;  2Z50 A;  4NKF A;  2AEL A;  2PS8 A;  1VG2 A;  3AQC B;  5EAU A;  4LOB A;  2ZCQ A;  3Q1O A;  3TFV A;  3G4D A;  1N24 A;  4LTZ A;  2Q9Z A;  4QXS F;  1YYR A;  4E1E A;  3KB9 A;  1WL3 A;  3KRC B;  3ICZ A;  2Z4Y A;  3WJK A;  3VJC A;  5EAT A;  3S4J A;  4OMG A;  1VG7 A;  3WC9 A;  4ZQ8 A;  1YV5 A;  2Q80 A;  3WCG A;  3PH7 A;  2E4O A;  5B0I A;  2AZJ A;  4HD1 A;  2PS6 A;  5HN9 A;  1UBY A;  2E8V A;  4H5E F;  3SDT A;  3V66 A;  1YQ7 A;  3P8L A;  5IM1 A;  1V4E A;  1V4I A;  2Q9Y A;  5AFX A;  3VJE A;  3P5P A;  4KKM A;  3LJI A;  3LK5 A;  3KBK A;  5B0L A;  4DHD A;  3OAB A;  5KSX F;  4EA1 A;  4RYP A;  1ZW5 A;  3ACX A;  1YYT A;  3P8R A;  1V4J A;  5DIQ F;  4Q23 A;  1YYU A;  2J1P A;  5IK9 A;  5IMI A;  2F8Z F;  2J5C A;  2P1C A;  4KVI A;  5E8L A;  1HXA A;  5H9D A;  3M02 A;  4KWD A;  4LFE A;  4OKM A;  4FP4 A;  3DYF A;  3N5J F;  3WJN A;  4EA0 A;  4LUU A;  4WK5 A;  1N1Z A;  1UBV A;  5C05 A;  3G4F A;  4JZB A;  3WE9 A;  1WY0 A;  3EFQ A;  3M0G A;  1JFG A;  4LA6 A;  3LOM A;  4KUX A;  4KVD A;  3LZ9 A;  1YJ4 A;  3NRI A;  3M9U A;  3WCM A;  5AEL A;  4DWB A;  5JV0 F;  2E8X A;  3CP6 A;  3P5R A;  5DZ2 A;  2Z52 A;  3BNY A;  5ILD A;  1HM4 A;  3VJD A;  5AYP A;  3OAB B;  3TC1 A;  4E9Z A;  3OAC A;  4KQ5 A;  4JXN A;  4N1Z F;  2F92 F;  5IK6 A;  3WEI A;  3LMD A;  4UMJ A;  4F6X A;  3N0F A;  3IPI A;  4DI5 A;  3M01 A;  5ILZ A;  3N46 F;  3EGT A;  2E95 A;  4GA3 A;  3WEF A;  5IVG A;  4DZW A;  5B0K A;  5IN8 A;  4K10 A;  3N6K F;  3M00 A;  1DGP A;  4LZ3 A;  2O1O A;  3WEG A;  2ZY1 A;  1PS1 A;  4RNQ A;  3MZV A;  4H5D F;  2F8C F;  5IL8 A;  3WCA A;  4LXW A;  4QPF A;  3VJ8 A;  5ILI A;  1WL1 A;  3KRP B;  1RTR A;  5IKH A;  3CKE A;  5JA0 F;  4LPH F;  4LTV A;  2QIS A;  5IL3 A;  5DGS F;  4LZC A;  3OAC B;  3VJ9 A;  3KRO B;  1V4H A;  5IMN A;  2ZCR A;  2OGD A;  1VG4 A;  4H5C F;  3LVS A;  4N9U A;  4LLS A;  3IBA A;  2OA6 A;  2E8U A;  3WCB A;  3WCC A;  5IMP A;  2OPN A;  3RYW A;  4JYX A;  1UBW A;  3AQ0 A;  3SDU A;  3ACY A;  2E92 A;  2PS7 A;  5A0K A;  5DJV F;  1EZF A;  3SDV A;  5DJR F;  5ERM A;  3WSB A;  5DW7 A;  3N1V F;  2E90 A;  1WL2 A;  2E8T A;  3ZL6 A;  1WMW A;  4DEM F;  4JXY A;  5E8K A;  3N49 F;  2F94 F;  1JFA A;  2Q58 A;  4LA5 A;  3ADZ A;  4LLT A;  2EWG A;  4NFJ F;  2ONG A;  4GAX A;  1YHM A;  1N21 A;  1YHK A;  3LGK A;  3NPR A;  3AE0 A;  5DJP F;  5DHK A;  4F62 A;  1N20 A;  5JV1 F;  3WCJ A;  5DHI A;  5HN7 A;  5ERN A;  2F9K F;  4GP1 A;  3TFP A;  1FPS A;  4RXA A;  3LG5 A;  2RAH A;  3KRF A;  1HXG A;  3WJO A;  1N22 A;  3EZ3 A;  5A0J A;  2ZEV A;  4NKE A;  3WCF A;  5JUZ F;  2FTZ A;  3N3D A;  2H8O A;  4JVJ F;  3LLW A;  2PS4 A;  3ZMB A;  2F7M F;  1KIZ A;  5B03 A;  3PKO A;  3KRC A;  5IKA A;  3TFN A;  4NFI F;  4KFA A;  5CG5 A;  5ILK A;  2ZCS A;  1YHL A;  5B00 A;  4E9U A;  2E94 A;  4P0W A;  4FJQ A;  2Z4Z A;  4RXD A;  3VJA A;  2DH4 A;  3LEE A;  5CG6 A;  2E93 A;  4LFG A;  5I1U A;  3LGZ B;  3N3L F;  3WCH A;  1HXC A;  3MAV A;  3ZOU A;  3KRA A;  5IK0 A;  4KVY A;  3Q2Z A;  3N1W F;  5ER8 A;  5HN8 A;  3BNX A;  1WL0 A;  3VJB A;  5B02 A;  2Z4X A;  3ICM A;  3WCD A;  4P0V A;  1HX9 A;  3WEH A;  2PS5 A;  2J1O A;  3WSA A;  3DYH A;  2AET A;  3P41 A;  5AHU B;  3RMG A;  5ILY A;  2AZL A;  4MC0 A;  1UBX A;  4XQS F;  2ZEU A;  4RXE A;  2E8W A;  2FOR A;  4NFK F;  4OKZ A;  3V1V A;  4DXJ A;  1YYS A;  4MC3 A;  3UCA A;  4XQR F;  4P0X A;  3QKC A;  3TS7 A;  2Z7I A;  4KPJ A;  1N23 A;  2I19 A;  4KQS A;  4LIX A;  4RXC A;  4LPG F;  3NPK A;  2Z4W A;  3KRA B;  3AQB B;  1RQI A;  1WKZ A;  5A0I A;  3ASX A;  3W7F A;  5DGN F;  3CC9 A;  3ICN A;  2ZCO A;  5HNA A;  4NUA A;  3PYB A;  1HM7 A;  3DYG A;  4JZX A;  4L2X F;  2VF6 A;  3N0G A;  3APZ A;  3V1X A;  1YYQ A;  3SDR A;  3Q2Q A;  5ERO A;  1KIY A;  3ZCD A;  2AEK A;  4XQT F;  3SAE A;  4KVW A;  3SDQ A;  2Z4V A;  3LDW A;  5B0J A;  3OYR A;  4F6V A;  4GP2 A;  3N5H F; 
#chains in the Genus database with same CATH homology
 3WCI A;  1V4K A;  1VG6 A;  5ILJ A;  2AZK A;  4OGU A;  3WEJ A;  4LFV F;  5B0M A;  3WEK A;  4MC8 A;  3S9V A;  5ILH A;  1VG3 A;  3WCL A;  2OPM A;  3ACW A;  4OMH A;  2ONH A;  4KK2 A;  4NG6 A;  4KQU A;  4KPD A;  5DGM F;  3KRP A;  3ICK A;  4LZ0 A;  1RQJ A;  3WCE A;  5JV2 F;  5EAS A;  3LSN A;  4DWG A;  2E91 A;  3ID0 A;  1DI1 A;  3KRO A;  3NF2 A;  2Z78 A;  3B7L A;  3N45 F;  2Z7H A;  3ZMC A;  3Q30 A;  3PDE A;  4EA2 A;  3RYE A;  5E8H A;  4PVX F;  5B01 A;  3KRF B;  3RBM A;  2F89 F;  1N1B A;  3PYA A;  4PVY F;  3QQV A;  2Z50 A;  4NKF A;  2AEL A;  2PS8 A;  1VG2 A;  3AQC B;  5EAU A;  4LOB A;  2ZCQ A;  3Q1O A;  3TFV A;  3G4D A;  1N24 A;  4LTZ A;  2Q9Z A;  4QXS F;  1YYR A;  4E1E A;  3KB9 A;  1WL3 A;  3KRC B;  3ICZ A;  2Z4Y A;  3WJK A;  3VJC A;  5EAT A;  3S4J A;  4OMG A;  1VG7 A;  3WC9 A;  4ZQ8 A;  1YV5 A;  2Q80 A;  3WCG A;  3PH7 A;  2E4O A;  5B0I A;  2AZJ A;  4HD1 A;  2PS6 A;  5HN9 A;  1UBY A;  2E8V A;  4H5E F;  3SDT A;  3V66 A;  1YQ7 A;  3P8L A;  5IM1 A;  1V4E A;  1V4I A;  2Q9Y A;  5AFX A;  3VJE A;  3P5P A;  4KKM A;  3LJI A;  3LK5 A;  3KBK A;  5B0L A;  4DHD A;  3OAB A;  5KSX F;  4EA1 A;  4RYP A;  1ZW5 A;  3ACX A;  1YYT A;  3P8R A;  1V4J A;  5DIQ F;  4Q23 A;  1YYU A;  2J1P A;  5IK9 A;  5IMI A;  2F8Z F;  2J5C A;  2P1C A;  4KVI A;  5E8L A;  1HXA A;  5H9D A;  3M02 A;  4KWD A;  4LFE A;  4OKM A;  4FP4 A;  3DYF A;  3N5J F;  3WJN A;  4EA0 A;  4LUU A;  4WK5 A;  1N1Z A;  1UBV A;  5C05 A;  3G4F A;  4JZB A;  3WE9 A;  1WY0 A;  3EFQ A;  3M0G A;  1JFG A;  4LA6 A;  3LOM A;  4KUX A;  4KVD A;  3LZ9 A;  1YJ4 A;  3NRI A;  3M9U A;  3WCM A;  5AEL A;  4DWB A;  5JV0 F;  2E8X A;  3CP6 A;  3P5R A;  5DZ2 A;  2Z52 A;  3BNY A;  5ILD A;  1HM4 A;  3VJD A;  5AYP A;  3OAB B;  3TC1 A;  4E9Z A;  3OAC A;  4KQ5 A;  4JXN A;  4N1Z F;  2F92 F;  5IK6 A;  3WEI A;  3LMD A;  4UMJ A;  4F6X A;  3N0F A;  3IPI A;  4DI5 A;  3M01 A;  5ILZ A;  3N46 F;  3EGT A;  2E95 A;  4GA3 A;  3WEF A;  5IVG A;  4DZW A;  5B0K A;  5IN8 A;  4K10 A;  3N6K F;  3M00 A;  1DGP A;  4LZ3 A;  2O1O A;  3WEG A;  2ZY1 A;  1PS1 A;  4RNQ A;  3MZV A;  4H5D F;  2F8C F;  5IL8 A;  3WCA A;  4LXW A;  4QPF A;  3VJ8 A;  5ILI A;  1WL1 A;  3KRP B;  1RTR A;  5IKH A;  3CKE A;  5JA0 F;  4LPH F;  4LTV A;  2QIS A;  5IL3 A;  5DGS F;  4LZC A;  3OAC B;  3VJ9 A;  3KRO B;  1V4H A;  5IMN A;  2ZCR A;  2OGD A;  1VG4 A;  4H5C F;  3LVS A;  4N9U A;  4LLS A;  3IBA A;  2OA6 A;  2E8U A;  3WCB A;  3WCC A;  5IMP A;  2OPN A;  3RYW A;  4JYX A;  1UBW A;  3AQ0 A;  3SDU A;  3ACY A;  2E92 A;  2PS7 A;  5A0K A;  5DJV F;  1EZF A;  3SDV A;  5DJR F;  5ERM A;  3WSB A;  5DW7 A;  3N1V F;  2E90 A;  1WL2 A;  2E8T A;  3ZL6 A;  1WMW A;  4DEM F;  4JXY A;  5E8K A;  3N49 F;  2F94 F;  1JFA A;  2Q58 A;  4LA5 A;  3ADZ A;  4LLT A;  2EWG A;  4NFJ F;  2ONG A;  4GAX A;  1YHM A;  1N21 A;  1YHK A;  3LGK A;  3NPR A;  3AE0 A;  5DJP F;  5DHK A;  4F62 A;  1N20 A;  5JV1 F;  3WCJ A;  5DHI A;  5HN7 A;  5ERN A;  2F9K F;  4GP1 A;  3TFP A;  1FPS A;  4RXA A;  3LG5 A;  2RAH A;  3KRF A;  1HXG A;  3WJO A;  1N22 A;  3EZ3 A;  5A0J A;  2ZEV A;  4NKE A;  3WCF A;  5JUZ F;  2FTZ A;  3N3D A;  2H8O A;  4JVJ F;  3LLW A;  2PS4 A;  3ZMB A;  2F7M F;  1KIZ A;  5B03 A;  3PKO A;  3KRC A;  5IKA A;  3TFN A;  4NFI F;  4KFA A;  5CG5 A;  5ILK A;  2ZCS A;  1YHL A;  5B00 A;  4E9U A;  2E94 A;  4P0W A;  4FJQ A;  2Z4Z A;  4RXD A;  3VJA A;  2DH4 A;  3LEE A;  5CG6 A;  2E93 A;  4LFG A;  5I1U A;  3LGZ B;  3N3L F;  3WCH A;  1HXC A;  3MAV A;  3ZOU A;  3KRA A;  5IK0 A;  4KVY A;  3Q2Z A;  3N1W F;  5ER8 A;  5HN8 A;  3BNX A;  1WL0 A;  3VJB A;  5B02 A;  2Z4X A;  3ICM A;  3WCD A;  4P0V A;  1HX9 A;  3WEH A;  2PS5 A;  2J1O A;  3WSA A;  3DYH A;  2AET A;  3P41 A;  5AHU B;  3RMG A;  5ILY A;  2AZL A;  4MC0 A;  1UBX A;  4XQS F;  2ZEU A;  4RXE A;  2E8W A;  2FOR A;  4NFK F;  4OKZ A;  3V1V A;  4DXJ A;  1YYS A;  4MC3 A;  3UCA A;  4XQR F;  4P0X A;  3QKC A;  3TS7 A;  2Z7I A;  4KPJ A;  1N23 A;  2I19 A;  4KQS A;  4LIX A;  4RXC A;  4LPG F;  3NPK A;  2Z4W A;  3KRA B;  3AQB B;  1RQI A;  1WKZ A;  5A0I A;  3ASX A;  3W7F A;  5DGN F;  3CC9 A;  3ICN A;  2ZCO A;  5HNA A;  4NUA A;  3PYB A;  1HM7 A;  3DYG A;  4JZX A;  4L2X F;  2VF6 A;  3N0G A;  3APZ A;  3V1X A;  1YYQ A;  3SDR A;  3Q2Q A;  5ERO A;  1KIY A;  3ZCD A;  2AEK A;  4XQT F;  3SAE A;  4KVW A;  3SDQ A;  2Z4V A;  3LDW A;  5B0J A;  3OYR A;  4F6V A;  4GP2 A;  3N5H F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...