3M0GA

Crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
285
structure length
264
Chain Sequence
SLSERLKEVQDAVETAMAAAIGRLPAGDLRDAMAYAAQGGKRLRAFLAIESAAIHGISMAQAMPAALAVEALHAYSLVHDDMPCMDNDDLRRGLPTVHKKWDDATAVLAGDALQTLAFELCTDPVLGSAENRVALVAALAQASGAEGMVYGQALDIAAETAAVPLTLDEIIRLQAGKTGALISFAAQAGAILAGADRGPLTAYATALGLAFQIADDILATFVSLLGLAGAKSRAADLVAEAEAALAPYGEAASTLRACARYVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl diphosphate synthase
publication title CRYSTAL STRUCTURE OF putative farnesyl diphosphate synthase from Rhodobacter capsulatus
rcsb
source organism Rhodobacter capsulatus
molecule tags Transferase
total genus 90
structure length 264
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3m0gA00
5DJVF 3LEEA 5JA0F 1RQJA 5B0LA 5HN7A 4P0XA 3EGTA 3WEHA 2E4OA 1YHMA 2ZCQA 4OKMA 1YV5A 2E94A 4OMHA 3TFNA 2F94F 5A0JA 4OGUA 3Q30A 3AQCB 4KFAA 3WCEA 3ZMCA 5IVGA 1V4EA 4DEMF 4LXWA 3LZ9A 4N9UA 1FPSA 2Z52A 3N0GA 1YQ7A 1N21A 2H8OA 2AZJA 3N0FA 4QXSF 3WE9A 3PDEA 3PYAA 3Q2QA 5B0MA 4KKMA 3LMDA 3B7LA 3OACA 5JV1F 4JZBA 3KRPB 3WJKA 4LZ3A 5ERNA 3RYWA 3ICKA 4NFJF 5I1UA 2Z7IA 4JXYA 2AZKA 5C05A 3APZA 5ER8A 3DYHA 4RXCA 3RBMA 3NRIA 5B02A 3QKCA 5E8HA 3VJ9A 4GAXA 4H5CF 5ERMA 1VG7A 3LG5A 4MC3A 3LOMA 1DGPA 5ILYA 4KK2A 4MC0A 1N24A 4KVDA 1WMWA 2Z7HA 4FP4A 3TS7A 3MAVA 5E8KA 4P0VA 3DYFA 4RXAA 1HM7A 4L2XF 2Q80A 4LPGF 3WJNA 5EROA 3WEFA 3SDTA 2RAHA 2F92F 2ONGA 3S9VA 3OABB 4LLSA 5IKAA 3ACWA 4NG6A 3WCLA 5IN8A 2Z4XA 5DHKA 3WC9A 3KRAB 4LPHF 3M02A 5B0IA 4JYXA 3KROB 2AELA 3UCAA 1WL1A 2F8ZF 4DXJA 2Z78A 3VJ8A 2ZEUA 5AYPA 1N20A 2J1PA 4E1EA 3WCAA 2PS4A 4LLTA 5B03A 3PH7A 1HXAA 3LDWA 5ILHA 4NUAA 2E8TA 4XQSF 2E91A 3ICMA 3N49F 5DZ2A 1JFAA 5IK0A 3WEIA 3M0GA 4XQTF 3WCGA 3V66A 3KRCB 1UBYA 3P8LA 5B01A 5IK6A 4P0WA 5ILJA 2OPNA 3WCFA 3N46F 3KRFB 5DJRF 5KSXF 1WY0A 3WCMA 2Q9ZA 4NFIF 3ACXA 2Z4YA 3N3DA 4F62A 2OPMA 4LA6A 1VG6A 4LUUA 4EA0A 1V4HA 4KQSA 4RYPA 3SDUA 3EZ3A 5ILKA 5DJPF 3Q2ZA 3SAEA 5HNAA 4GA3A 1V4IA 1KIZA 4LTZA 4XQRF 4KVIA 1DI1A 5ILIA 1HM4A 4KUXA 4LOBA 2ZY1A 3WJOA 5AFXA 4GP1A 1N23A 1VG2A 1YHLA 4QPFA 4UMJA 3WCBA 2ONHA 2Z4VA 3IBAA 3VJBA 2Z4WA 3G4FA 5B00A 5HN8A 3WEJA 4NFKF 1HX9A 3IPIA 5ILDA 3AE0A 3AQBB 3AQ0A 4KQ5A 3N1VF 3WSAA 3W7FA 1WL0A 1YHKA 5AHUB 3SDRA 5JV0F 5DGSF 2DH4A 4NKFA 3VJAA 1YYRA 1YYSA 5H9DA 5IMPA 1EZFA 3VJEA 5IL8A 4KVWA 4KVYA 4MC8A 1YYUA 4FJQA 2E90A 4LFVF 4DI5A 5E8LA 2AETA 3LVSA 3NF2A 2PS7A 3ZCDA 3TFVA 3OYRA 2FTZA 3N6KF 3WEKA 1N22A 3P8RA 4E9UA 3KRPA 3RMGA 2F7MF 2O1OA 5IMNA 2Z4ZA 4KPDA 5EAUA 5B0KA 4LFEA 3WCIA 5IKHA 1YJ4A 1HXGA 4DWBA 4LA5A 2ZCRA 3ACYA 1YYTA 1WL3A 3KBKA 2FORA 3LGKA 2E8XA 3DYGA 4KPJA 3M9UA 3N45F 3SDVA 4N1ZF 1RQIA 3ADZA 3TFPA 4EA2A 1N1BA 1YYQA 5CG5A 3BNYA 4KWDA 3LLWA 1KIYA 3WCCA 3V1XA 1RTRA 3OACB 3ICZA 1PS1A 3SDQA 3P5PA 5DW7A 4H5DF 3OABA 2Q9YA 3NPRA 2PS8A 3LSNA 3KRAA 4LIXA 4OKZA 3QQVA 4GP2A 3KROA 4EA1A 2J1OA 3CC9A 1UBWA 1N1ZA 1HXCA 5ILZA 5IL3A 3WCDA 1V4JA 5IM1A 2F89F 3PYBA 3LGZB 2VF6A 3KRCA 3WCHA 4PVXF 4WK5A 2OA6A 2F8CF 4DWGA 1ZW5A 3KRFA 3LJIA 2P1CA 3ZL6A 2E8WA 2F9KF 3M01A 2E93A 2J5CA 2E92A 3EFQA 4LZCA 5DHIA 2E8VA 4NKEA 3RYEA 3TC1A 5DGMF 1WKZA 2OGDA 2QISA 5A0KA 4RNQA 4E9ZA 4RXDA 5HN9A 4HD1A 2EWGA 3P5RA 1V4KA 5IMIA 3CP6A 3Q1OA 2ZEVA 1UBVA 4LTVA 5B0JA 3S4JA 3WEGA 3VJDA 3ICNA 2Z50A 1JFGA 4KQUA 3VJCA 5JUZF 4JXNA 5DIQF 4OMGA 3LK5A 2I19A 3G4DA 4Q23A 5DGNF 3V1VA 4ZQ8A 5AELA 1VG3A 2PS6A 4F6VA 1WL2A 2PS5A 5A0IA 4LZ0A 3CKEA 4DHDA 3PKOA 5EATA 4JZXA 2ZCOA 3WCJA 3BNXA 3NPKA 3ZMBA 4K10A 2AEKA 3N3LF 2AZLA 3N5JF 4F6XA 4DZWA 1UBXA 4LFGA 2E95A 5EASA 4H5EF 3KB9A 3N1WF 3N5HF 5IK9A 4RXEA 3ID0A 2E8UA 2ZCSA 1VG4A 5CG6A 4JVJF 2Q58A 3WSBA 3MZVA 3P41A 3ASXA 3M00A 3ZOUA 4PVYF 5JV2F
chains in the Genus database with same CATH superfamily
5DJVF 3LEEA 5JA0F 1RQJA 5B0LA 5HN7A 4P0XA 3EGTA 3WEHA 2E4OA 1YHMA 2ZCQA 4OKMA 1YV5A 2E94A 4OMHA 3TFNA 2F94F 5A0JA 4OGUA 3Q30A 3AQCB 4KFAA 3WCEA 3ZMCA 5IVGA 1V4EA 4DEMF 4LXWA 3LZ9A 4N9UA 1FPSA 2Z52A 3N0GA 1YQ7A 1N21A 2H8OA 2AZJA 3N0FA 4QXSF 3WE9A 3PDEA 3PYAA 3Q2QA 5B0MA 4KKMA 3LMDA 3B7LA 3OACA 5JV1F 4JZBA 3KRPB 3WJKA 4LZ3A 5ERNA 3RYWA 3ICKA 4NFJF 5I1UA 2Z7IA 4JXYA 2AZKA 5C05A 3APZA 5ER8A 3DYHA 4RXCA 3RBMA 3NRIA 5B02A 3QKCA 5E8HA 3VJ9A 4GAXA 4H5CF 5ERMA 1VG7A 3LG5A 4MC3A 3LOMA 1DGPA 5ILYA 4KK2A 4MC0A 1N24A 4KVDA 1WMWA 2Z7HA 4FP4A 3TS7A 3MAVA 5E8KA 4P0VA 3DYFA 4RXAA 1HM7A 4L2XF 2Q80A 4LPGF 3WJNA 5EROA 3WEFA 3SDTA 2RAHA 2F92F 2ONGA 3S9VA 3OABB 4LLSA 5IKAA 3ACWA 4NG6A 3WCLA 5IN8A 2Z4XA 5DHKA 3WC9A 3KRAB 4LPHF 3M02A 5B0IA 4JYXA 3KROB 2AELA 3UCAA 1WL1A 2F8ZF 4DXJA 2Z78A 3VJ8A 2ZEUA 5AYPA 1N20A 2J1PA 4E1EA 3WCAA 2PS4A 4LLTA 5B03A 3PH7A 1HXAA 3LDWA 5ILHA 4NUAA 2E8TA 4XQSF 2E91A 3ICMA 3N49F 5DZ2A 1JFAA 5IK0A 3WEIA 3M0GA 4XQTF 3WCGA 3V66A 3KRCB 1UBYA 3P8LA 5B01A 5IK6A 4P0WA 5ILJA 2OPNA 3WCFA 3N46F 3KRFB 5DJRF 5KSXF 1WY0A 3WCMA 2Q9ZA 4NFIF 3ACXA 2Z4YA 3N3DA 4F62A 2OPMA 4LA6A 1VG6A 4LUUA 4EA0A 1V4HA 4KQSA 4RYPA 3SDUA 3EZ3A 5ILKA 5DJPF 3Q2ZA 3SAEA 5HNAA 4GA3A 1V4IA 1KIZA 4LTZA 4XQRF 4KVIA 1DI1A 5ILIA 1HM4A 4KUXA 4LOBA 2ZY1A 3WJOA 5AFXA 4GP1A 1N23A 1VG2A 1YHLA 4QPFA 4UMJA 3WCBA 2ONHA 2Z4VA 3IBAA 3VJBA 2Z4WA 3G4FA 5B00A 5HN8A 3WEJA 4NFKF 1HX9A 3IPIA 5ILDA 3AE0A 3AQBB 3AQ0A 4KQ5A 3N1VF 3WSAA 3W7FA 1WL0A 1YHKA 5AHUB 3SDRA 5JV0F 5DGSF 2DH4A 4NKFA 3VJAA 1YYRA 1YYSA 5H9DA 5IMPA 1EZFA 3VJEA 5IL8A 4KVWA 4KVYA 4MC8A 1YYUA 4FJQA 2E90A 4LFVF 4DI5A 5E8LA 2AETA 3LVSA 3NF2A 2PS7A 3ZCDA 3TFVA 3OYRA 2FTZA 3N6KF 3WEKA 1N22A 3P8RA 4E9UA 3KRPA 3RMGA 2F7MF 2O1OA 5IMNA 2Z4ZA 4KPDA 5EAUA 5B0KA 4LFEA 3WCIA 5IKHA 1YJ4A 1HXGA 4DWBA 4LA5A 2ZCRA 3ACYA 1YYTA 1WL3A 3KBKA 2FORA 3LGKA 2E8XA 3DYGA 4KPJA 3M9UA 3N45F 3SDVA 4N1ZF 1RQIA 3ADZA 3TFPA 4EA2A 1N1BA 1YYQA 5CG5A 3BNYA 4KWDA 3LLWA 1KIYA 3WCCA 3V1XA 1RTRA 3OACB 3ICZA 1PS1A 3SDQA 3P5PA 5DW7A 4H5DF 3OABA 2Q9YA 3NPRA 2PS8A 3LSNA 3KRAA 4LIXA 4OKZA 3QQVA 4GP2A 3KROA 4EA1A 2J1OA 3CC9A 1UBWA 1N1ZA 1HXCA 5ILZA 5IL3A 3WCDA 1V4JA 5IM1A 2F89F 3PYBA 3LGZB 2VF6A 3KRCA 3WCHA 4PVXF 4WK5A 2OA6A 2F8CF 4DWGA 1ZW5A 3KRFA 3LJIA 2P1CA 3ZL6A 2E8WA 2F9KF 3M01A 2E93A 2J5CA 2E92A 3EFQA 4LZCA 5DHIA 2E8VA 4NKEA 3RYEA 3TC1A 5DGMF 1WKZA 2OGDA 2QISA 5A0KA 4RNQA 4E9ZA 4RXDA 5HN9A 4HD1A 2EWGA 3P5RA 1V4KA 5IMIA 3CP6A 3Q1OA 2ZEVA 1UBVA 4LTVA 5B0JA 3S4JA 3WEGA 3VJDA 3ICNA 2Z50A 1JFGA 4KQUA 3VJCA 5JUZF 4JXNA 5DIQF 4OMGA 3LK5A 2I19A 3G4DA 4Q23A 5DGNF 3V1VA 4ZQ8A 5AELA 1VG3A 2PS6A 4F6VA 1WL2A 2PS5A 5A0IA 4LZ0A 3CKEA 4DHDA 3PKOA 5EATA 4JZXA 2ZCOA 3WCJA 3BNXA 3NPKA 3ZMBA 4K10A 2AEKA 3N3LF 2AZLA 3N5JF 4F6XA 4DZWA 1UBXA 4LFGA 2E95A 5EASA 4H5EF 3KB9A 3N1WF 3N5HF 5IK9A 4RXEA 3ID0A 2E8UA 2ZCSA 1VG4A 5CG6A 4JVJF 2Q58A 3WSBA 3MZVA 3P41A 3ASXA 3M00A 3ZOUA 4PVYF 5JV2F
chains in the Genus database with same CATH topology
5DJVF 3LEEA 5JA0F 1RQJA 5B0LA 5HN7A 4P0XA 3EGTA 3WEHA 2E4OA 1YHMA 2ZCQA 4OKMA 1YV5A 2E94A 4OMHA 3TFNA 2F94F 5A0JA 4OGUA 3Q30A 3AQCB 4KFAA 3WCEA 3ZMCA 5IVGA 1V4EA 4DEMF 4LXWA 3LZ9A 4N9UA 1FPSA 2Z52A 3N0GA 1YQ7A 1N21A 2H8OA 2AZJA 3N0FA 4QXSF 3WE9A 3PDEA 3PYAA 3Q2QA 5B0MA 4KKMA 3LMDA 3B7LA 3OACA 5JV1F 4JZBA 3KRPB 3WJKA 4LZ3A 5ERNA 3RYWA 3ICKA 4NFJF 5I1UA 2Z7IA 4JXYA 2AZKA 5C05A 3APZA 5ER8A 3DYHA 4RXCA 3RBMA 3NRIA 5B02A 3QKCA 5E8HA 3VJ9A 4GAXA 4H5CF 5ERMA 1VG7A 3LG5A 4MC3A 3LOMA 1DGPA 5ILYA 4KK2A 4MC0A 1N24A 4KVDA 1WMWA 2Z7HA 4FP4A 3TS7A 3MAVA 5E8KA 4P0VA 3DYFA 4RXAA 1HM7A 4L2XF 2Q80A 4LPGF 3WJNA 5EROA 3WEFA 3SDTA 2RAHA 2F92F 2ONGA 3S9VA 3OABB 4LLSA 5IKAA 3ACWA 4NG6A 3WCLA 5IN8A 2Z4XA 5DHKA 3WC9A 3KRAB 4LPHF 3M02A 5B0IA 4JYXA 3KROB 2AELA 3UCAA 1WL1A 2F8ZF 4DXJA 2Z78A 3VJ8A 2ZEUA 5AYPA 1N20A 2J1PA 4E1EA 3WCAA 2PS4A 4LLTA 5B03A 3PH7A 1HXAA 3LDWA 5ILHA 4NUAA 2E8TA 4XQSF 2E91A 3ICMA 3N49F 5DZ2A 1JFAA 5IK0A 3WEIA 3M0GA 4XQTF 3WCGA 3V66A 3KRCB 1UBYA 3P8LA 5B01A 5IK6A 4P0WA 5ILJA 2OPNA 3WCFA 3N46F 3KRFB 5DJRF 5KSXF 1WY0A 3WCMA 2Q9ZA 4NFIF 3ACXA 2Z4YA 3N3DA 4F62A 2OPMA 4LA6A 1VG6A 4LUUA 4EA0A 1V4HA 4KQSA 4RYPA 3SDUA 3EZ3A 5ILKA 5DJPF 3Q2ZA 3SAEA 5HNAA 4GA3A 1V4IA 1KIZA 4LTZA 4XQRF 4KVIA 1DI1A 5ILIA 1HM4A 4KUXA 4LOBA 2ZY1A 3WJOA 5AFXA 4GP1A 1N23A 1VG2A 1YHLA 4QPFA 4UMJA 3WCBA 2ONHA 2Z4VA 3IBAA 3VJBA 2Z4WA 3G4FA 5B00A 5HN8A 3WEJA 4NFKF 1HX9A 3IPIA 5ILDA 3AE0A 3AQBB 3AQ0A 4KQ5A 3N1VF 3WSAA 3W7FA 1WL0A 1YHKA 5AHUB 3SDRA 5JV0F 5DGSF 2DH4A 4NKFA 3VJAA 1YYRA 1YYSA 5H9DA 5IMPA 1EZFA 3VJEA 5IL8A 4KVWA 4KVYA 4MC8A 1YYUA 4FJQA 2E90A 4LFVF 4DI5A 5E8LA 2AETA 3LVSA 3NF2A 2PS7A 3ZCDA 3TFVA 3OYRA 2FTZA 3N6KF 3WEKA 1N22A 3P8RA 4E9UA 3KRPA 3RMGA 2F7MF 2O1OA 5IMNA 2Z4ZA 4KPDA 5EAUA 5B0KA 4LFEA 3WCIA 5IKHA 1YJ4A 1HXGA 4DWBA 4LA5A 2ZCRA 3ACYA 1YYTA 1WL3A 3KBKA 2FORA 3LGKA 2E8XA 3DYGA 4KPJA 3M9UA 3N45F 3SDVA 4N1ZF 1RQIA 3ADZA 3TFPA 4EA2A 1N1BA 1YYQA 5CG5A 3BNYA 4KWDA 3LLWA 1KIYA 3WCCA 3V1XA 1RTRA 3OACB 3ICZA 1PS1A 3SDQA 3P5PA 5DW7A 4H5DF 3OABA 2Q9YA 3NPRA 2PS8A 3LSNA 3KRAA 4LIXA 4OKZA 3QQVA 4GP2A 3KROA 4EA1A 2J1OA 3CC9A 1UBWA 1N1ZA 1HXCA 5ILZA 5IL3A 3WCDA 1V4JA 5IM1A 2F89F 3PYBA 3LGZB 2VF6A 3KRCA 3WCHA 4PVXF 4WK5A 2OA6A 2F8CF 4DWGA 1ZW5A 3KRFA 3LJIA 2P1CA 3ZL6A 2E8WA 2F9KF 3M01A 2E93A 2J5CA 2E92A 3EFQA 4LZCA 5DHIA 2E8VA 4NKEA 3RYEA 3TC1A 5DGMF 1WKZA 2OGDA 2QISA 5A0KA 4RNQA 4E9ZA 4RXDA 5HN9A 4HD1A 2EWGA 3P5RA 1V4KA 5IMIA 3CP6A 3Q1OA 2ZEVA 1UBVA 4LTVA 5B0JA 3S4JA 3WEGA 3VJDA 3ICNA 2Z50A 1JFGA 4KQUA 3VJCA 5JUZF 4JXNA 5DIQF 4OMGA 3LK5A 2I19A 3G4DA 4Q23A 5DGNF 3V1VA 4ZQ8A 5AELA 1VG3A 2PS6A 4F6VA 1WL2A 2PS5A 5A0IA 4LZ0A 3CKEA 4DHDA 3PKOA 5EATA 4JZXA 2ZCOA 3WCJA 3BNXA 3NPKA 3ZMBA 4K10A 2AEKA 3N3LF 2AZLA 3N5JF 4F6XA 4DZWA 1UBXA 4LFGA 2E95A 5EASA 4H5EF 3KB9A 3N1WF 3N5HF 5IK9A 4RXEA 3ID0A 2E8UA 2ZCSA 1VG4A 5CG6A 4JVJF 2Q58A 3WSBA 3MZVA 3P41A 3ASXA 3M00A 3ZOUA 4PVYF 5JV2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DJV F;  3LEE A;  5JA0 F;  1RQJ A;  5B0L A;  5HN7 A;  4P0X A;  3EGT A;  3WEH A;  2E4O A;  1YHM A;  2ZCQ A;  4OKM A;  1YV5 A;  2E94 A;  4OMH A;  3TFN A;  2F94 F;  5A0J A;  4OGU A;  3Q30 A;  3AQC B;  4KFA A;  3WCE A;  3ZMC A;  5IVG A;  1V4E A;  4DEM F;  4LXW A;  3LZ9 A;  4N9U A;  1FPS A;  2Z52 A;  3N0G A;  1YQ7 A;  1N21 A;  2H8O A;  2AZJ A;  3N0F A;  4QXS F;  3WE9 A;  3PDE A;  3PYA A;  3Q2Q A;  5B0M A;  4KKM A;  3LMD A;  3B7L A;  3OAC A;  5JV1 F;  4JZB A;  3KRP B;  3WJK A;  4LZ3 A;  5ERN A;  3RYW A;  3ICK A;  4NFJ F;  5I1U A;  2Z7I A;  4JXY A;  2AZK A;  5C05 A;  3APZ A;  5ER8 A;  3DYH A;  4RXC A;  3RBM A;  3NRI A;  5B02 A;  3QKC A;  5E8H A;  3VJ9 A;  4GAX A;  4H5C F;  5ERM A;  1VG7 A;  3LG5 A;  4MC3 A;  3LOM A;  1DGP A;  5ILY A;  4KK2 A;  4MC0 A;  1N24 A;  4KVD A;  1WMW A;  2Z7H A;  4FP4 A;  3TS7 A;  3MAV A;  5E8K A;  4P0V A;  3DYF A;  4RXA A;  1HM7 A;  4L2X F;  2Q80 A;  4LPG F;  3WJN A;  5ERO A;  3WEF A;  3SDT A;  2RAH A;  2F92 F;  2ONG A;  3S9V A;  3OAB B;  4LLS A;  5IKA A;  3ACW A;  4NG6 A;  3WCL A;  5IN8 A;  2Z4X A;  5DHK A;  3WC9 A;  3KRA B;  4LPH F;  3M02 A;  5B0I A;  4JYX A;  3KRO B;  2AEL A;  3UCA A;  1WL1 A;  2F8Z F;  4DXJ A;  2Z78 A;  3VJ8 A;  2ZEU A;  5AYP A;  1N20 A;  2J1P A;  4E1E A;  3WCA A;  2PS4 A;  4LLT A;  5B03 A;  3PH7 A;  1HXA A;  3LDW A;  5ILH A;  4NUA A;  2E8T A;  4XQS F;  2E91 A;  3ICM A;  3N49 F;  5DZ2 A;  1JFA A;  5IK0 A;  3WEI A;  3M0G A;  4XQT F;  3WCG A;  3V66 A;  3KRC B;  1UBY A;  3P8L A;  5B01 A;  5IK6 A;  4P0W A;  5ILJ A;  2OPN A;  3WCF A;  3N46 F;  3KRF B;  5DJR F;  5KSX F;  1WY0 A;  3WCM A;  2Q9Z A;  4NFI F;  3ACX A;  2Z4Y A;  3N3D A;  4F62 A;  2OPM A;  4LA6 A;  1VG6 A;  4LUU A;  4EA0 A;  1V4H A;  4KQS A;  4RYP A;  3SDU A;  3EZ3 A;  5ILK A;  5DJP F;  3Q2Z A;  3SAE A;  5HNA A;  4GA3 A;  1V4I A;  1KIZ A;  4LTZ A;  4XQR F;  4KVI A;  1DI1 A;  5ILI A;  1HM4 A;  4KUX A;  4LOB A;  2ZY1 A;  3WJO A;  5AFX A;  4GP1 A;  1N23 A;  1VG2 A;  1YHL A;  4QPF A;  4UMJ A;  3WCB A;  2ONH A;  2Z4V A;  3IBA A;  3VJB A;  2Z4W A;  3G4F A;  5B00 A;  5HN8 A;  3WEJ A;  4NFK F;  1HX9 A;  3IPI A;  5ILD A;  3AE0 A;  3AQB B;  3AQ0 A;  4KQ5 A;  3N1V F;  3WSA A;  3W7F A;  1WL0 A;  1YHK A;  5AHU B;  3SDR A;  5JV0 F;  5DGS F;  2DH4 A;  4NKF A;  3VJA A;  1YYR A;  1YYS A;  5H9D A;  5IMP A;  1EZF A;  3VJE A;  5IL8 A;  4KVW A;  4KVY A;  4MC8 A;  1YYU A;  4FJQ A;  2E90 A;  4LFV F;  4DI5 A;  5E8L A;  2AET A;  3LVS A;  3NF2 A;  2PS7 A;  3ZCD A;  3TFV A;  3OYR A;  2FTZ A;  3N6K F;  3WEK A;  1N22 A;  3P8R A;  4E9U A;  3KRP A;  3RMG A;  2F7M F;  2O1O A;  5IMN A;  2Z4Z A;  4KPD A;  5EAU A;  5B0K A;  4LFE A;  3WCI A;  5IKH A;  1YJ4 A;  1HXG A;  4DWB A;  4LA5 A;  2ZCR A;  3ACY A;  1YYT A;  1WL3 A;  3KBK A;  2FOR A;  3LGK A;  2E8X A;  3DYG A;  4KPJ A;  3M9U A;  3N45 F;  3SDV A;  4N1Z F;  1RQI A;  3ADZ A;  3TFP A;  4EA2 A;  1N1B A;  1YYQ A;  5CG5 A;  3BNY A;  4KWD A;  3LLW A;  1KIY A;  3WCC A;  3V1X A;  1RTR A;  3OAC B;  3ICZ A;  1PS1 A;  3SDQ A;  3P5P A;  5DW7 A;  4H5D F;  3OAB A;  2Q9Y A;  3NPR A;  2PS8 A;  3LSN A;  3KRA A;  4LIX A;  4OKZ A;  3QQV A;  4GP2 A;  3KRO A;  4EA1 A;  2J1O A;  3CC9 A;  1UBW A;  1N1Z A;  1HXC A;  5ILZ A;  5IL3 A;  3WCD A;  1V4J A;  5IM1 A;  2F89 F;  3PYB A;  3LGZ B;  2VF6 A;  3KRC A;  3WCH A;  4PVX F;  4WK5 A;  2OA6 A;  2F8C F;  4DWG A;  1ZW5 A;  3KRF A;  3LJI A;  2P1C A;  3ZL6 A;  2E8W A;  2F9K F;  3M01 A;  2E93 A;  2J5C A;  2E92 A;  3EFQ A;  4LZC A;  5DHI A;  2E8V A;  4NKE A;  3RYE A;  3TC1 A;  5DGM F;  1WKZ A;  2OGD A;  2QIS A;  5A0K A;  4RNQ A;  4E9Z A;  4RXD A;  5HN9 A;  4HD1 A;  2EWG A;  3P5R A;  1V4K A;  5IMI A;  3CP6 A;  3Q1O A;  2ZEV A;  1UBV A;  4LTV A;  5B0J A;  3S4J A;  3WEG A;  3VJD A;  3ICN A;  2Z50 A;  1JFG A;  4KQU A;  3VJC A;  5JUZ F;  4JXN A;  5DIQ F;  4OMG A;  3LK5 A;  2I19 A;  3G4D A;  4Q23 A;  5DGN F;  3V1V A;  4ZQ8 A;  5AEL A;  1VG3 A;  2PS6 A;  4F6V A;  1WL2 A;  2PS5 A;  5A0I A;  4LZ0 A;  3CKE A;  4DHD A;  3PKO A;  5EAT A;  4JZX A;  2ZCO A;  3WCJ A;  3BNX A;  3NPK A;  3ZMB A;  4K10 A;  2AEK A;  3N3L F;  2AZL A;  3N5J F;  4F6X A;  4DZW A;  1UBX A;  4LFG A;  2E95 A;  5EAS A;  4H5E F;  3KB9 A;  3N1W F;  3N5H F;  5IK9 A;  4RXE A;  3ID0 A;  2E8U A;  2ZCS A;  1VG4 A;  5CG6 A;  4JVJ F;  2Q58 A;  3WSB A;  3MZV A;  3P41 A;  3ASX A;  3M00 A;  3ZOU A;  4PVY F;  5JV2 F; 
#chains in the Genus database with same CATH topology
 5DJV F;  3LEE A;  5JA0 F;  1RQJ A;  5B0L A;  5HN7 A;  4P0X A;  3EGT A;  3WEH A;  2E4O A;  1YHM A;  2ZCQ A;  4OKM A;  1YV5 A;  2E94 A;  4OMH A;  3TFN A;  2F94 F;  5A0J A;  4OGU A;  3Q30 A;  3AQC B;  4KFA A;  3WCE A;  3ZMC A;  5IVG A;  1V4E A;  4DEM F;  4LXW A;  3LZ9 A;  4N9U A;  1FPS A;  2Z52 A;  3N0G A;  1YQ7 A;  1N21 A;  2H8O A;  2AZJ A;  3N0F A;  4QXS F;  3WE9 A;  3PDE A;  3PYA A;  3Q2Q A;  5B0M A;  4KKM A;  3LMD A;  3B7L A;  3OAC A;  5JV1 F;  4JZB A;  3KRP B;  3WJK A;  4LZ3 A;  5ERN A;  3RYW A;  3ICK A;  4NFJ F;  5I1U A;  2Z7I A;  4JXY A;  2AZK A;  5C05 A;  3APZ A;  5ER8 A;  3DYH A;  4RXC A;  3RBM A;  3NRI A;  5B02 A;  3QKC A;  5E8H A;  3VJ9 A;  4GAX A;  4H5C F;  5ERM A;  1VG7 A;  3LG5 A;  4MC3 A;  3LOM A;  1DGP A;  5ILY A;  4KK2 A;  4MC0 A;  1N24 A;  4KVD A;  1WMW A;  2Z7H A;  4FP4 A;  3TS7 A;  3MAV A;  5E8K A;  4P0V A;  3DYF A;  4RXA A;  1HM7 A;  4L2X F;  2Q80 A;  4LPG F;  3WJN A;  5ERO A;  3WEF A;  3SDT A;  2RAH A;  2F92 F;  2ONG A;  3S9V A;  3OAB B;  4LLS A;  5IKA A;  3ACW A;  4NG6 A;  3WCL A;  5IN8 A;  2Z4X A;  5DHK A;  3WC9 A;  3KRA B;  4LPH F;  3M02 A;  5B0I A;  4JYX A;  3KRO B;  2AEL A;  3UCA A;  1WL1 A;  2F8Z F;  4DXJ A;  2Z78 A;  3VJ8 A;  2ZEU A;  5AYP A;  1N20 A;  2J1P A;  4E1E A;  3WCA A;  2PS4 A;  4LLT A;  5B03 A;  3PH7 A;  1HXA A;  3LDW A;  5ILH A;  4NUA A;  2E8T A;  4XQS F;  2E91 A;  3ICM A;  3N49 F;  5DZ2 A;  1JFA A;  5IK0 A;  3WEI A;  3M0G A;  4XQT F;  3WCG A;  3V66 A;  3KRC B;  1UBY A;  3P8L A;  5B01 A;  5IK6 A;  4P0W A;  5ILJ A;  2OPN A;  3WCF A;  3N46 F;  3KRF B;  5DJR F;  5KSX F;  1WY0 A;  3WCM A;  2Q9Z A;  4NFI F;  3ACX A;  2Z4Y A;  3N3D A;  4F62 A;  2OPM A;  4LA6 A;  1VG6 A;  4LUU A;  4EA0 A;  1V4H A;  4KQS A;  4RYP A;  3SDU A;  3EZ3 A;  5ILK A;  5DJP F;  3Q2Z A;  3SAE A;  5HNA A;  4GA3 A;  1V4I A;  1KIZ A;  4LTZ A;  4XQR F;  4KVI A;  1DI1 A;  5ILI A;  1HM4 A;  4KUX A;  4LOB A;  2ZY1 A;  3WJO A;  5AFX A;  4GP1 A;  1N23 A;  1VG2 A;  1YHL A;  4QPF A;  4UMJ A;  3WCB A;  2ONH A;  2Z4V A;  3IBA A;  3VJB A;  2Z4W A;  3G4F A;  5B00 A;  5HN8 A;  3WEJ A;  4NFK F;  1HX9 A;  3IPI A;  5ILD A;  3AE0 A;  3AQB B;  3AQ0 A;  4KQ5 A;  3N1V F;  3WSA A;  3W7F A;  1WL0 A;  1YHK A;  5AHU B;  3SDR A;  5JV0 F;  5DGS F;  2DH4 A;  4NKF A;  3VJA A;  1YYR A;  1YYS A;  5H9D A;  5IMP A;  1EZF A;  3VJE A;  5IL8 A;  4KVW A;  4KVY A;  4MC8 A;  1YYU A;  4FJQ A;  2E90 A;  4LFV F;  4DI5 A;  5E8L A;  2AET A;  3LVS A;  3NF2 A;  2PS7 A;  3ZCD A;  3TFV A;  3OYR A;  2FTZ A;  3N6K F;  3WEK A;  1N22 A;  3P8R A;  4E9U A;  3KRP A;  3RMG A;  2F7M F;  2O1O A;  5IMN A;  2Z4Z A;  4KPD A;  5EAU A;  5B0K A;  4LFE A;  3WCI A;  5IKH A;  1YJ4 A;  1HXG A;  4DWB A;  4LA5 A;  2ZCR A;  3ACY A;  1YYT A;  1WL3 A;  3KBK A;  2FOR A;  3LGK A;  2E8X A;  3DYG A;  4KPJ A;  3M9U A;  3N45 F;  3SDV A;  4N1Z F;  1RQI A;  3ADZ A;  3TFP A;  4EA2 A;  1N1B A;  1YYQ A;  5CG5 A;  3BNY A;  4KWD A;  3LLW A;  1KIY A;  3WCC A;  3V1X A;  1RTR A;  3OAC B;  3ICZ A;  1PS1 A;  3SDQ A;  3P5P A;  5DW7 A;  4H5D F;  3OAB A;  2Q9Y A;  3NPR A;  2PS8 A;  3LSN A;  3KRA A;  4LIX A;  4OKZ A;  3QQV A;  4GP2 A;  3KRO A;  4EA1 A;  2J1O A;  3CC9 A;  1UBW A;  1N1Z A;  1HXC A;  5ILZ A;  5IL3 A;  3WCD A;  1V4J A;  5IM1 A;  2F89 F;  3PYB A;  3LGZ B;  2VF6 A;  3KRC A;  3WCH A;  4PVX F;  4WK5 A;  2OA6 A;  2F8C F;  4DWG A;  1ZW5 A;  3KRF A;  3LJI A;  2P1C A;  3ZL6 A;  2E8W A;  2F9K F;  3M01 A;  2E93 A;  2J5C A;  2E92 A;  3EFQ A;  4LZC A;  5DHI A;  2E8V A;  4NKE A;  3RYE A;  3TC1 A;  5DGM F;  1WKZ A;  2OGD A;  2QIS A;  5A0K A;  4RNQ A;  4E9Z A;  4RXD A;  5HN9 A;  4HD1 A;  2EWG A;  3P5R A;  1V4K A;  5IMI A;  3CP6 A;  3Q1O A;  2ZEV A;  1UBV A;  4LTV A;  5B0J A;  3S4J A;  3WEG A;  3VJD A;  3ICN A;  2Z50 A;  1JFG A;  4KQU A;  3VJC A;  5JUZ F;  4JXN A;  5DIQ F;  4OMG A;  3LK5 A;  2I19 A;  3G4D A;  4Q23 A;  5DGN F;  3V1V A;  4ZQ8 A;  5AEL A;  1VG3 A;  2PS6 A;  4F6V A;  1WL2 A;  2PS5 A;  5A0I A;  4LZ0 A;  3CKE A;  4DHD A;  3PKO A;  5EAT A;  4JZX A;  2ZCO A;  3WCJ A;  3BNX A;  3NPK A;  3ZMB A;  4K10 A;  2AEK A;  3N3L F;  2AZL A;  3N5J F;  4F6X A;  4DZW A;  1UBX A;  4LFG A;  2E95 A;  5EAS A;  4H5E F;  3KB9 A;  3N1W F;  3N5H F;  5IK9 A;  4RXE A;  3ID0 A;  2E8U A;  2ZCS A;  1VG4 A;  5CG6 A;  4JVJ F;  2Q58 A;  3WSB A;  3MZV A;  3P41 A;  3ASX A;  3M00 A;  3ZOU A;  4PVY F;  5JV2 F; 
#chains in the Genus database with same CATH homology
 5DJV F;  3LEE A;  5JA0 F;  1RQJ A;  5B0L A;  5HN7 A;  4P0X A;  3EGT A;  3WEH A;  2E4O A;  1YHM A;  2ZCQ A;  4OKM A;  1YV5 A;  2E94 A;  4OMH A;  3TFN A;  2F94 F;  5A0J A;  4OGU A;  3Q30 A;  3AQC B;  4KFA A;  3WCE A;  3ZMC A;  5IVG A;  1V4E A;  4DEM F;  4LXW A;  3LZ9 A;  4N9U A;  1FPS A;  2Z52 A;  3N0G A;  1YQ7 A;  1N21 A;  2H8O A;  2AZJ A;  3N0F A;  4QXS F;  3WE9 A;  3PDE A;  3PYA A;  3Q2Q A;  5B0M A;  4KKM A;  3LMD A;  3B7L A;  3OAC A;  5JV1 F;  4JZB A;  3KRP B;  3WJK A;  4LZ3 A;  5ERN A;  3RYW A;  3ICK A;  4NFJ F;  5I1U A;  2Z7I A;  4JXY A;  2AZK A;  5C05 A;  3APZ A;  5ER8 A;  3DYH A;  4RXC A;  3RBM A;  3NRI A;  5B02 A;  3QKC A;  5E8H A;  3VJ9 A;  4GAX A;  4H5C F;  5ERM A;  1VG7 A;  3LG5 A;  4MC3 A;  3LOM A;  1DGP A;  5ILY A;  4KK2 A;  4MC0 A;  1N24 A;  4KVD A;  1WMW A;  2Z7H A;  4FP4 A;  3TS7 A;  3MAV A;  5E8K A;  4P0V A;  3DYF A;  4RXA A;  1HM7 A;  4L2X F;  2Q80 A;  4LPG F;  3WJN A;  5ERO A;  3WEF A;  3SDT A;  2RAH A;  2F92 F;  2ONG A;  3S9V A;  3OAB B;  4LLS A;  5IKA A;  3ACW A;  4NG6 A;  3WCL A;  5IN8 A;  2Z4X A;  5DHK A;  3WC9 A;  3KRA B;  4LPH F;  3M02 A;  5B0I A;  4JYX A;  3KRO B;  2AEL A;  3UCA A;  1WL1 A;  2F8Z F;  4DXJ A;  2Z78 A;  3VJ8 A;  2ZEU A;  5AYP A;  1N20 A;  2J1P A;  4E1E A;  3WCA A;  2PS4 A;  4LLT A;  5B03 A;  3PH7 A;  1HXA A;  3LDW A;  5ILH A;  4NUA A;  2E8T A;  4XQS F;  2E91 A;  3ICM A;  3N49 F;  5DZ2 A;  1JFA A;  5IK0 A;  3WEI A;  3M0G A;  4XQT F;  3WCG A;  3V66 A;  3KRC B;  1UBY A;  3P8L A;  5B01 A;  5IK6 A;  4P0W A;  5ILJ A;  2OPN A;  3WCF A;  3N46 F;  3KRF B;  5DJR F;  5KSX F;  1WY0 A;  3WCM A;  2Q9Z A;  4NFI F;  3ACX A;  2Z4Y A;  3N3D A;  4F62 A;  2OPM A;  4LA6 A;  1VG6 A;  4LUU A;  4EA0 A;  1V4H A;  4KQS A;  4RYP A;  3SDU A;  3EZ3 A;  5ILK A;  5DJP F;  3Q2Z A;  3SAE A;  5HNA A;  4GA3 A;  1V4I A;  1KIZ A;  4LTZ A;  4XQR F;  4KVI A;  1DI1 A;  5ILI A;  1HM4 A;  4KUX A;  4LOB A;  2ZY1 A;  3WJO A;  5AFX A;  4GP1 A;  1N23 A;  1VG2 A;  1YHL A;  4QPF A;  4UMJ A;  3WCB A;  2ONH A;  2Z4V A;  3IBA A;  3VJB A;  2Z4W A;  3G4F A;  5B00 A;  5HN8 A;  3WEJ A;  4NFK F;  1HX9 A;  3IPI A;  5ILD A;  3AE0 A;  3AQB B;  3AQ0 A;  4KQ5 A;  3N1V F;  3WSA A;  3W7F A;  1WL0 A;  1YHK A;  5AHU B;  3SDR A;  5JV0 F;  5DGS F;  2DH4 A;  4NKF A;  3VJA A;  1YYR A;  1YYS A;  5H9D A;  5IMP A;  1EZF A;  3VJE A;  5IL8 A;  4KVW A;  4KVY A;  4MC8 A;  1YYU A;  4FJQ A;  2E90 A;  4LFV F;  4DI5 A;  5E8L A;  2AET A;  3LVS A;  3NF2 A;  2PS7 A;  3ZCD A;  3TFV A;  3OYR A;  2FTZ A;  3N6K F;  3WEK A;  1N22 A;  3P8R A;  4E9U A;  3KRP A;  3RMG A;  2F7M F;  2O1O A;  5IMN A;  2Z4Z A;  4KPD A;  5EAU A;  5B0K A;  4LFE A;  3WCI A;  5IKH A;  1YJ4 A;  1HXG A;  4DWB A;  4LA5 A;  2ZCR A;  3ACY A;  1YYT A;  1WL3 A;  3KBK A;  2FOR A;  3LGK A;  2E8X A;  3DYG A;  4KPJ A;  3M9U A;  3N45 F;  3SDV A;  4N1Z F;  1RQI A;  3ADZ A;  3TFP A;  4EA2 A;  1N1B A;  1YYQ A;  5CG5 A;  3BNY A;  4KWD A;  3LLW A;  1KIY A;  3WCC A;  3V1X A;  1RTR A;  3OAC B;  3ICZ A;  1PS1 A;  3SDQ A;  3P5P A;  5DW7 A;  4H5D F;  3OAB A;  2Q9Y A;  3NPR A;  2PS8 A;  3LSN A;  3KRA A;  4LIX A;  4OKZ A;  3QQV A;  4GP2 A;  3KRO A;  4EA1 A;  2J1O A;  3CC9 A;  1UBW A;  1N1Z A;  1HXC A;  5ILZ A;  5IL3 A;  3WCD A;  1V4J A;  5IM1 A;  2F89 F;  3PYB A;  3LGZ B;  2VF6 A;  3KRC A;  3WCH A;  4PVX F;  4WK5 A;  2OA6 A;  2F8C F;  4DWG A;  1ZW5 A;  3KRF A;  3LJI A;  2P1C A;  3ZL6 A;  2E8W A;  2F9K F;  3M01 A;  2E93 A;  2J5C A;  2E92 A;  3EFQ A;  4LZC A;  5DHI A;  2E8V A;  4NKE A;  3RYE A;  3TC1 A;  5DGM F;  1WKZ A;  2OGD A;  2QIS A;  5A0K A;  4RNQ A;  4E9Z A;  4RXD A;  5HN9 A;  4HD1 A;  2EWG A;  3P5R A;  1V4K A;  5IMI A;  3CP6 A;  3Q1O A;  2ZEV A;  1UBV A;  4LTV A;  5B0J A;  3S4J A;  3WEG A;  3VJD A;  3ICN A;  2Z50 A;  1JFG A;  4KQU A;  3VJC A;  5JUZ F;  4JXN A;  5DIQ F;  4OMG A;  3LK5 A;  2I19 A;  3G4D A;  4Q23 A;  5DGN F;  3V1V A;  4ZQ8 A;  5AEL A;  1VG3 A;  2PS6 A;  4F6V A;  1WL2 A;  2PS5 A;  5A0I A;  4LZ0 A;  3CKE A;  4DHD A;  3PKO A;  5EAT A;  4JZX A;  2ZCO A;  3WCJ A;  3BNX A;  3NPK A;  3ZMB A;  4K10 A;  2AEK A;  3N3L F;  2AZL A;  3N5J F;  4F6X A;  4DZW A;  1UBX A;  4LFG A;  2E95 A;  5EAS A;  4H5E F;  3KB9 A;  3N1W F;  3N5H F;  5IK9 A;  4RXE A;  3ID0 A;  2E8U A;  2ZCS A;  1VG4 A;  5CG6 A;  4JVJ F;  2Q58 A;  3WSB A;  3MZV A;  3P41 A;  3ASX A;  3M00 A;  3ZOU A;  4PVY F;  5JV2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...