3M0GA

Crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
285
structure length
264
Chain Sequence
SLSERLKEVQDAVETAMAAAIGRLPAGDLRDAMAYAAQGGKRLRAFLAIESAAIHGISMAQAMPAALAVEALHAYSLVHDDMPCMDNDDLRRGLPTVHKKWDDATAVLAGDALQTLAFELCTDPVLGSAENRVALVAALAQASGAEGMVYGQALDIAAETAAVPLTLDEIIRLQAGKTGALISFAAQAGAILAGADRGPLTAYATALGLAFQIADDILATFVSLLGLAGAKSRAADLVAEAEAALAPYGEAASTLRACARYVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl diphosphate synthase
publication title CRYSTAL STRUCTURE OF putative farnesyl diphosphate synthase from Rhodobacter capsulatus
rcsb
source organism Rhodobacter capsulatus
molecule tags Transferase
total genus 90
structure length 264
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3m0gA00
4LLSA 1YHKA 3NRIA 4LXWA 2F89F 2F9KF 1VG3A 3OACA 4QPFA 1HXCA 1PS1A 2ZEUA 2Q58A 2PS4A 5IK9A 2Z4WA 3WCAA 2Q9YA 5C05A 5B03A 3N0FA 4DWBA 5IVGA 5B0JA 3ICKA 2ONHA 3LEEA 2AZLA 1HXGA 3VJBA 3P8RA 4KFAA 5EROA 1V4HA 5E8LA 4OKMA 4LUUA 5DGMF 2Q80A 5E8HA 3MAVA 4NUAA 4DZWA 2E93A 2VF6A 3QQVA 4H5EF 1YYRA 4RNQA 4FJQA 4KPDA 4WK5A 3RYWA 3Q30A 1YHLA 1YJ4A 5AFXA 4E1EA 4LTZA 3RMGA 2Z4ZA 5ILHA 2E91A 3KRAB 3LZ9A 3LMDA 4NKEA 4LPHF 2ZY1A 4KVWA 4DXJA 2E95A 1V4IA 3BNYA 3WEJA 1WL3A 2Z7IA 3WEKA 5A0JA 3V1VA 2Z78A 3P5RA 5KSXF 1HM4A 3WEIA 1YV5A 3N3LF 1YYQA 3LOMA 3WCHA 3WEGA 1HXAA 3KRCA 2QISA 4NFJF 4KWDA 4Q23A 5DIQF 4RXDA 3M01A 3KRFB 5IK0A 4GA3A 3LGKA 2E8WA 2ZCRA 3WEHA 1N22A 3AQCB 5DHKA 2EWGA 4OMGA 5DJRF 3WCJA 3SDTA 4LLTA 2O1OA 1DI1A 2Z50A 4P0XA 1N23A 3WCMA 2E90A 3N5JF 3EZ3A 3TFVA 3SDRA 5IL3A 3PYAA 1WY0A 3KRPB 3ZCDA 5ILYA 4QXSF 3M9UA 3VJ9A 2ZCOA 2AETA 3DYHA 1WKZA 3KB9A 1ZW5A 5HNAA 4JVJF 3P41A 4XQSF 5EAUA 3EGTA 3ICMA 3AQ0A 4KK2A 3WJNA 3OABB 5B0KA 5CG6A 3VJAA 5ILZA 1UBYA 5IMIA 3PYBA 4LFEA 3WCFA 5DW7A 3BNXA 1VG6A 5DJPF 3N1VF 3WCDA 4DEMF 2J5CA 1WL1A 3LLWA 2E92A 5IM1A 3KBKA 3EFQA 4H5CF 5DZ2A 2E8UA 3ZMBA 3DYFA 3LDWA 1JFGA 5ILKA 1VG2A 4JYXA 5HN7A 4OGUA 3M02A 1WMWA 3WCGA 2E8VA 3P5PA 5IKHA 3SDUA 3TFNA 4N9UA 2OPNA 5B00A 3WCCA 2J1OA 4RXCA 3M0GA 3SDQA 1N1BA 2F94F 4MC3A 5JA0F 1UBXA 5IN8A 3N5HF 1V4KA 2E4OA 1RQIA 4NFKF 3G4DA 5IMPA 3N1WF 3WJKA 1KIZA 3RYEA 4NKFA 1WL0A 3N0GA 3TS7A 4LFVF 4JZXA 3MZVA 5B02A 4DI5A 2OA6A 4KUXA 3N45F 3KRAA 3VJDA 2Z52A 1RTRA 3VJEA 5H9DA 2FORA 2OPMA 3ASXA 4KQ5A 4E9UA 4LA5A 1YYTA 3LSNA 4F62A 4PVXF 2F8ZF 1KIYA 2AZKA 2F92F 5DGNF 4E9ZA 2J1PA 2PS8A 2FTZA 3ID0A 3ADZA 4KVYA 4LFGA 2Q9ZA 4K10A 3IBAA 5DGSF 3SDVA 3KROB 1VG4A 3Q1OA 3WSBA 4JXNA 4ZQ8A 3ZMCA 3KRFA 2AEKA 3TFPA 5IL8A 3WSAA 3LVSA 3NPKA 4P0WA 4GP1A 3CKEA 5B0IA 5IMNA 3ZL6A 3ZOUA 4JXYA 3ACXA 1JFAA 1WL2A 5ER8A 3PKOA 1YYUA 3VJCA 3M00A 3S9VA 4EA2A 3CC9A 2F8CF 5IK6A 4KQUA 4LZ3A 3KRPA 1EZFA 3V66A 2Z4VA 4OMHA 3DYGA 3AQBB 3OACB 4KVDA 2RAHA 3G4FA 1UBWA 3NF2A 1RQJA 4H5DF 5HN8A 5B01A 3WCLA 1UBVA 3OABA 2OGDA 2Z4XA 4KKMA 3OYRA 2Z7HA 4RYPA 3WEFA 4PVYF 3ICNA 2I19A 2PS6A 5HN9A 4KQSA 2E8XA 4LTVA 4F6VA 4DHDA 4OKZA 3N46F 4FP4A 1YYSA 2ONGA 5EASA 3N3DA 3UCAA 5AELA 1N24A 1N1ZA 2DH4A 4MC8A 5DJVF 5ILDA 3WC9A 3WJOA 5B0MA 4KPJA 4LIXA 2E94A 4RXEA 4F6XA 5JV2F 5A0KA 4LOBA 5B0LA 4GAXA 3LG5A 3IPIA 4L2XF 3RBMA 5JV1F 2H8OA 3PDEA 4HD1A 4P0VA 3CP6A 3PH7A 2ZCSA 3QKCA 4NG6A 4EA1A 2Z4YA 1V4JA 2P1CA 1DGPA 4N1ZF 4RXAA 3LGZB 2PS5A 2AZJA 5IKAA 3SAEA 5ERMA 2AELA 3KRCB 2E8TA 5I1UA 3Q2QA 5DHIA 3Q2ZA 1YQ7A 4LA6A 3WCIA 3APZA 4XQTF 4UMJA 3N49F 5AHUB 5EATA 3KROA 4MC0A 3B7LA 1HM7A 4KVIA 3AE0A 3WE9A 5CG5A 4NFIF 1N20A 1YHMA 2PS7A 5A0IA 3ICZA 3LJIA 5ILIA 5JV0F 1V4EA 4LZCA 5AYPA 3V1XA 5ERNA 3S4JA 4XQRF 2F7MF 1HX9A 1N21A 4LZ0A 4LPGF 3VJ8A 4DWGA 3N6KF 2ZEVA 4JZBA 3W7FA 3LK5A 3TC1A 3ACYA 1FPSA 3NPRA 3WCBA 5ILJA 1VG7A 4GP2A 4EA0A 5JUZF 5E8KA 3WCEA 3P8LA 2ZCQA 3ACWA
chains in the Genus database with same CATH superfamily
4LLSA 1YHKA 3NRIA 4LXWA 2F89F 2F9KF 1VG3A 3OACA 4QPFA 1HXCA 1PS1A 2ZEUA 2Q58A 2PS4A 5IK9A 2Z4WA 3WCAA 2Q9YA 5C05A 5B03A 3N0FA 4DWBA 5IVGA 5B0JA 3ICKA 2ONHA 3LEEA 2AZLA 1HXGA 3VJBA 3P8RA 4KFAA 5EROA 1V4HA 5E8LA 4OKMA 4LUUA 5DGMF 2Q80A 5E8HA 3MAVA 4NUAA 4DZWA 2E93A 2VF6A 3QQVA 4H5EF 1YYRA 4RNQA 4FJQA 4KPDA 4WK5A 3RYWA 3Q30A 1YHLA 1YJ4A 5AFXA 4E1EA 4LTZA 3RMGA 2Z4ZA 5ILHA 2E91A 3KRAB 3LZ9A 3LMDA 4NKEA 4LPHF 2ZY1A 4KVWA 4DXJA 2E95A 1V4IA 3BNYA 3WEJA 1WL3A 2Z7IA 3WEKA 5A0JA 3V1VA 2Z78A 3P5RA 5KSXF 1HM4A 3WEIA 1YV5A 3N3LF 1YYQA 3LOMA 3WCHA 3WEGA 1HXAA 3KRCA 2QISA 4NFJF 4KWDA 4Q23A 5DIQF 4RXDA 3M01A 3KRFB 5IK0A 4GA3A 3LGKA 2E8WA 2ZCRA 3WEHA 1N22A 3AQCB 5DHKA 2EWGA 4OMGA 5DJRF 3WCJA 3SDTA 4LLTA 2O1OA 1DI1A 2Z50A 4P0XA 1N23A 3WCMA 2E90A 3N5JF 3EZ3A 3TFVA 3SDRA 5IL3A 3PYAA 1WY0A 3KRPB 3ZCDA 5ILYA 4QXSF 3M9UA 3VJ9A 2ZCOA 2AETA 3DYHA 1WKZA 3KB9A 1ZW5A 5HNAA 4JVJF 3P41A 4XQSF 5EAUA 3EGTA 3ICMA 3AQ0A 4KK2A 3WJNA 3OABB 5B0KA 5CG6A 3VJAA 5ILZA 1UBYA 5IMIA 3PYBA 4LFEA 3WCFA 5DW7A 3BNXA 1VG6A 5DJPF 3N1VF 3WCDA 4DEMF 2J5CA 1WL1A 3LLWA 2E92A 5IM1A 3KBKA 3EFQA 4H5CF 5DZ2A 2E8UA 3ZMBA 3DYFA 3LDWA 1JFGA 5ILKA 1VG2A 4JYXA 5HN7A 4OGUA 3M02A 1WMWA 3WCGA 2E8VA 3P5PA 5IKHA 3SDUA 3TFNA 4N9UA 2OPNA 5B00A 3WCCA 2J1OA 4RXCA 3M0GA 3SDQA 1N1BA 2F94F 4MC3A 5JA0F 1UBXA 5IN8A 3N5HF 1V4KA 2E4OA 1RQIA 4NFKF 3G4DA 5IMPA 3N1WF 3WJKA 1KIZA 3RYEA 4NKFA 1WL0A 3N0GA 3TS7A 4LFVF 4JZXA 3MZVA 5B02A 4DI5A 2OA6A 4KUXA 3N45F 3KRAA 3VJDA 2Z52A 1RTRA 3VJEA 5H9DA 2FORA 2OPMA 3ASXA 4KQ5A 4E9UA 4LA5A 1YYTA 3LSNA 4F62A 4PVXF 2F8ZF 1KIYA 2AZKA 2F92F 5DGNF 4E9ZA 2J1PA 2PS8A 2FTZA 3ID0A 3ADZA 4KVYA 4LFGA 2Q9ZA 4K10A 3IBAA 5DGSF 3SDVA 3KROB 1VG4A 3Q1OA 3WSBA 4JXNA 4ZQ8A 3ZMCA 3KRFA 2AEKA 3TFPA 5IL8A 3WSAA 3LVSA 3NPKA 4P0WA 4GP1A 3CKEA 5B0IA 5IMNA 3ZL6A 3ZOUA 4JXYA 3ACXA 1JFAA 1WL2A 5ER8A 3PKOA 1YYUA 3VJCA 3M00A 3S9VA 4EA2A 3CC9A 2F8CF 5IK6A 4KQUA 4LZ3A 3KRPA 1EZFA 3V66A 2Z4VA 4OMHA 3DYGA 3AQBB 3OACB 4KVDA 2RAHA 3G4FA 1UBWA 3NF2A 1RQJA 4H5DF 5HN8A 5B01A 3WCLA 1UBVA 3OABA 2OGDA 2Z4XA 4KKMA 3OYRA 2Z7HA 4RYPA 3WEFA 4PVYF 3ICNA 2I19A 2PS6A 5HN9A 4KQSA 2E8XA 4LTVA 4F6VA 4DHDA 4OKZA 3N46F 4FP4A 1YYSA 2ONGA 5EASA 3N3DA 3UCAA 5AELA 1N24A 1N1ZA 2DH4A 4MC8A 5DJVF 5ILDA 3WC9A 3WJOA 5B0MA 4KPJA 4LIXA 2E94A 4RXEA 4F6XA 5JV2F 5A0KA 4LOBA 5B0LA 4GAXA 3LG5A 3IPIA 4L2XF 3RBMA 5JV1F 2H8OA 3PDEA 4HD1A 4P0VA 3CP6A 3PH7A 2ZCSA 3QKCA 4NG6A 4EA1A 2Z4YA 1V4JA 2P1CA 1DGPA 4N1ZF 4RXAA 3LGZB 2PS5A 2AZJA 5IKAA 3SAEA 5ERMA 2AELA 3KRCB 2E8TA 5I1UA 3Q2QA 5DHIA 3Q2ZA 1YQ7A 4LA6A 3WCIA 3APZA 4XQTF 4UMJA 3N49F 5AHUB 5EATA 3KROA 4MC0A 3B7LA 1HM7A 4KVIA 3AE0A 3WE9A 5CG5A 4NFIF 1N20A 1YHMA 2PS7A 5A0IA 3ICZA 3LJIA 5ILIA 5JV0F 1V4EA 4LZCA 5AYPA 3V1XA 5ERNA 3S4JA 4XQRF 2F7MF 1HX9A 1N21A 4LZ0A 4LPGF 3VJ8A 4DWGA 3N6KF 2ZEVA 4JZBA 3W7FA 3LK5A 3TC1A 3ACYA 1FPSA 3NPRA 3WCBA 5ILJA 1VG7A 4GP2A 4EA0A 5JUZF 5E8KA 3WCEA 3P8LA 2ZCQA 3ACWA
chains in the Genus database with same CATH topology
4LLSA 1YHKA 3NRIA 4LXWA 2F89F 2F9KF 1VG3A 3OACA 4QPFA 1HXCA 1PS1A 2ZEUA 2Q58A 2PS4A 5IK9A 2Z4WA 3WCAA 2Q9YA 5C05A 5B03A 3N0FA 4DWBA 5IVGA 5B0JA 3ICKA 2ONHA 3LEEA 2AZLA 1HXGA 3VJBA 3P8RA 4KFAA 5EROA 1V4HA 5E8LA 4OKMA 4LUUA 5DGMF 2Q80A 5E8HA 3MAVA 4NUAA 4DZWA 2E93A 2VF6A 3QQVA 4H5EF 1YYRA 4RNQA 4FJQA 4KPDA 4WK5A 3RYWA 3Q30A 1YHLA 1YJ4A 5AFXA 4E1EA 4LTZA 3RMGA 2Z4ZA 5ILHA 2E91A 3KRAB 3LZ9A 3LMDA 4NKEA 4LPHF 2ZY1A 4KVWA 4DXJA 2E95A 1V4IA 3BNYA 3WEJA 1WL3A 2Z7IA 3WEKA 5A0JA 3V1VA 2Z78A 3P5RA 5KSXF 1HM4A 3WEIA 1YV5A 3N3LF 1YYQA 3LOMA 3WCHA 3WEGA 1HXAA 3KRCA 2QISA 4NFJF 4KWDA 4Q23A 5DIQF 4RXDA 3M01A 3KRFB 5IK0A 4GA3A 3LGKA 2E8WA 2ZCRA 3WEHA 1N22A 3AQCB 5DHKA 2EWGA 4OMGA 5DJRF 3WCJA 3SDTA 4LLTA 2O1OA 1DI1A 2Z50A 4P0XA 1N23A 3WCMA 2E90A 3N5JF 3EZ3A 3TFVA 3SDRA 5IL3A 3PYAA 1WY0A 3KRPB 3ZCDA 5ILYA 4QXSF 3M9UA 3VJ9A 2ZCOA 2AETA 3DYHA 1WKZA 3KB9A 1ZW5A 5HNAA 4JVJF 3P41A 4XQSF 5EAUA 3EGTA 3ICMA 3AQ0A 4KK2A 3WJNA 3OABB 5B0KA 5CG6A 3VJAA 5ILZA 1UBYA 5IMIA 3PYBA 4LFEA 3WCFA 5DW7A 3BNXA 1VG6A 5DJPF 3N1VF 3WCDA 4DEMF 2J5CA 1WL1A 3LLWA 2E92A 5IM1A 3KBKA 3EFQA 4H5CF 5DZ2A 2E8UA 3ZMBA 3DYFA 3LDWA 1JFGA 5ILKA 1VG2A 4JYXA 5HN7A 4OGUA 3M02A 1WMWA 3WCGA 2E8VA 3P5PA 5IKHA 3SDUA 3TFNA 4N9UA 2OPNA 5B00A 3WCCA 2J1OA 4RXCA 3M0GA 3SDQA 1N1BA 2F94F 4MC3A 5JA0F 1UBXA 5IN8A 3N5HF 1V4KA 2E4OA 1RQIA 4NFKF 3G4DA 5IMPA 3N1WF 3WJKA 1KIZA 3RYEA 4NKFA 1WL0A 3N0GA 3TS7A 4LFVF 4JZXA 3MZVA 5B02A 4DI5A 2OA6A 4KUXA 3N45F 3KRAA 3VJDA 2Z52A 1RTRA 3VJEA 5H9DA 2FORA 2OPMA 3ASXA 4KQ5A 4E9UA 4LA5A 1YYTA 3LSNA 4F62A 4PVXF 2F8ZF 1KIYA 2AZKA 2F92F 5DGNF 4E9ZA 2J1PA 2PS8A 2FTZA 3ID0A 3ADZA 4KVYA 4LFGA 2Q9ZA 4K10A 3IBAA 5DGSF 3SDVA 3KROB 1VG4A 3Q1OA 3WSBA 4JXNA 4ZQ8A 3ZMCA 3KRFA 2AEKA 3TFPA 5IL8A 3WSAA 3LVSA 3NPKA 4P0WA 4GP1A 3CKEA 5B0IA 5IMNA 3ZL6A 3ZOUA 4JXYA 3ACXA 1JFAA 1WL2A 5ER8A 3PKOA 1YYUA 3VJCA 3M00A 3S9VA 4EA2A 3CC9A 2F8CF 5IK6A 4KQUA 4LZ3A 3KRPA 1EZFA 3V66A 2Z4VA 4OMHA 3DYGA 3AQBB 3OACB 4KVDA 2RAHA 3G4FA 1UBWA 3NF2A 1RQJA 4H5DF 5HN8A 5B01A 3WCLA 1UBVA 3OABA 2OGDA 2Z4XA 4KKMA 3OYRA 2Z7HA 4RYPA 3WEFA 4PVYF 3ICNA 2I19A 2PS6A 5HN9A 4KQSA 2E8XA 4LTVA 4F6VA 4DHDA 4OKZA 3N46F 4FP4A 1YYSA 2ONGA 5EASA 3N3DA 3UCAA 5AELA 1N24A 1N1ZA 2DH4A 4MC8A 5DJVF 5ILDA 3WC9A 3WJOA 5B0MA 4KPJA 4LIXA 2E94A 4RXEA 4F6XA 5JV2F 5A0KA 4LOBA 5B0LA 4GAXA 3LG5A 3IPIA 4L2XF 3RBMA 5JV1F 2H8OA 3PDEA 4HD1A 4P0VA 3CP6A 3PH7A 2ZCSA 3QKCA 4NG6A 4EA1A 2Z4YA 1V4JA 2P1CA 1DGPA 4N1ZF 4RXAA 3LGZB 2PS5A 2AZJA 5IKAA 3SAEA 5ERMA 2AELA 3KRCB 2E8TA 5I1UA 3Q2QA 5DHIA 3Q2ZA 1YQ7A 4LA6A 3WCIA 3APZA 4XQTF 4UMJA 3N49F 5AHUB 5EATA 3KROA 4MC0A 3B7LA 1HM7A 4KVIA 3AE0A 3WE9A 5CG5A 4NFIF 1N20A 1YHMA 2PS7A 5A0IA 3ICZA 3LJIA 5ILIA 5JV0F 1V4EA 4LZCA 5AYPA 3V1XA 5ERNA 3S4JA 4XQRF 2F7MF 1HX9A 1N21A 4LZ0A 4LPGF 3VJ8A 4DWGA 3N6KF 2ZEVA 4JZBA 3W7FA 3LK5A 3TC1A 3ACYA 1FPSA 3NPRA 3WCBA 5ILJA 1VG7A 4GP2A 4EA0A 5JUZF 5E8KA 3WCEA 3P8LA 2ZCQA 3ACWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LLS A;  1YHK A;  3NRI A;  4LXW A;  2F89 F;  2F9K F;  1VG3 A;  3OAC A;  4QPF A;  1HXC A;  1PS1 A;  2ZEU A;  2Q58 A;  2PS4 A;  5IK9 A;  2Z4W A;  3WCA A;  2Q9Y A;  5C05 A;  5B03 A;  3N0F A;  4DWB A;  5IVG A;  5B0J A;  3ICK A;  2ONH A;  3LEE A;  2AZL A;  1HXG A;  3VJB A;  3P8R A;  4KFA A;  5ERO A;  1V4H A;  5E8L A;  4OKM A;  4LUU A;  5DGM F;  2Q80 A;  5E8H A;  3MAV A;  4NUA A;  4DZW A;  2E93 A;  2VF6 A;  3QQV A;  4H5E F;  1YYR A;  4RNQ A;  4FJQ A;  4KPD A;  4WK5 A;  3RYW A;  3Q30 A;  1YHL A;  1YJ4 A;  5AFX A;  4E1E A;  4LTZ A;  3RMG A;  2Z4Z A;  5ILH A;  2E91 A;  3KRA B;  3LZ9 A;  3LMD A;  4NKE A;  4LPH F;  2ZY1 A;  4KVW A;  4DXJ A;  2E95 A;  1V4I A;  3BNY A;  3WEJ A;  1WL3 A;  2Z7I A;  3WEK A;  5A0J A;  3V1V A;  2Z78 A;  3P5R A;  5KSX F;  1HM4 A;  3WEI A;  1YV5 A;  3N3L F;  1YYQ A;  3LOM A;  3WCH A;  3WEG A;  1HXA A;  3KRC A;  2QIS A;  4NFJ F;  4KWD A;  4Q23 A;  5DIQ F;  4RXD A;  3M01 A;  3KRF B;  5IK0 A;  4GA3 A;  3LGK A;  2E8W A;  2ZCR A;  3WEH A;  1N22 A;  3AQC B;  5DHK A;  2EWG A;  4OMG A;  5DJR F;  3WCJ A;  3SDT A;  4LLT A;  2O1O A;  1DI1 A;  2Z50 A;  4P0X A;  1N23 A;  3WCM A;  2E90 A;  3N5J F;  3EZ3 A;  3TFV A;  3SDR A;  5IL3 A;  3PYA A;  1WY0 A;  3KRP B;  3ZCD A;  5ILY A;  4QXS F;  3M9U A;  3VJ9 A;  2ZCO A;  2AET A;  3DYH A;  1WKZ A;  3KB9 A;  1ZW5 A;  5HNA A;  4JVJ F;  3P41 A;  4XQS F;  5EAU A;  3EGT A;  3ICM A;  3AQ0 A;  4KK2 A;  3WJN A;  3OAB B;  5B0K A;  5CG6 A;  3VJA A;  5ILZ A;  1UBY A;  5IMI A;  3PYB A;  4LFE A;  3WCF A;  5DW7 A;  3BNX A;  1VG6 A;  5DJP F;  3N1V F;  3WCD A;  4DEM F;  2J5C A;  1WL1 A;  3LLW A;  2E92 A;  5IM1 A;  3KBK A;  3EFQ A;  4H5C F;  5DZ2 A;  2E8U A;  3ZMB A;  3DYF A;  3LDW A;  1JFG A;  5ILK A;  1VG2 A;  4JYX A;  5HN7 A;  4OGU A;  3M02 A;  1WMW A;  3WCG A;  2E8V A;  3P5P A;  5IKH A;  3SDU A;  3TFN A;  4N9U A;  2OPN A;  5B00 A;  3WCC A;  2J1O A;  4RXC A;  3M0G A;  3SDQ A;  1N1B A;  2F94 F;  4MC3 A;  5JA0 F;  1UBX A;  5IN8 A;  3N5H F;  1V4K A;  2E4O A;  1RQI A;  4NFK F;  3G4D A;  5IMP A;  3N1W F;  3WJK A;  1KIZ A;  3RYE A;  4NKF A;  1WL0 A;  3N0G A;  3TS7 A;  4LFV F;  4JZX A;  3MZV A;  5B02 A;  4DI5 A;  2OA6 A;  4KUX A;  3N45 F;  3KRA A;  3VJD A;  2Z52 A;  1RTR A;  3VJE A;  5H9D A;  2FOR A;  2OPM A;  3ASX A;  4KQ5 A;  4E9U A;  4LA5 A;  1YYT A;  3LSN A;  4F62 A;  4PVX F;  2F8Z F;  1KIY A;  2AZK A;  2F92 F;  5DGN F;  4E9Z A;  2J1P A;  2PS8 A;  2FTZ A;  3ID0 A;  3ADZ A;  4KVY A;  4LFG A;  2Q9Z A;  4K10 A;  3IBA A;  5DGS F;  3SDV A;  3KRO B;  1VG4 A;  3Q1O A;  3WSB A;  4JXN A;  4ZQ8 A;  3ZMC A;  3KRF A;  2AEK A;  3TFP A;  5IL8 A;  3WSA A;  3LVS A;  3NPK A;  4P0W A;  4GP1 A;  3CKE A;  5B0I A;  5IMN A;  3ZL6 A;  3ZOU A;  4JXY A;  3ACX A;  1JFA A;  1WL2 A;  5ER8 A;  3PKO A;  1YYU A;  3VJC A;  3M00 A;  3S9V A;  4EA2 A;  3CC9 A;  2F8C F;  5IK6 A;  4KQU A;  4LZ3 A;  3KRP A;  1EZF A;  3V66 A;  2Z4V A;  4OMH A;  3DYG A;  3AQB B;  3OAC B;  4KVD A;  2RAH A;  3G4F A;  1UBW A;  3NF2 A;  1RQJ A;  4H5D F;  5HN8 A;  5B01 A;  3WCL A;  1UBV A;  3OAB A;  2OGD A;  2Z4X A;  4KKM A;  3OYR A;  2Z7H A;  4RYP A;  3WEF A;  4PVY F;  3ICN A;  2I19 A;  2PS6 A;  5HN9 A;  4KQS A;  2E8X A;  4LTV A;  4F6V A;  4DHD A;  4OKZ A;  3N46 F;  4FP4 A;  1YYS A;  2ONG A;  5EAS A;  3N3D A;  3UCA A;  5AEL A;  1N24 A;  1N1Z A;  2DH4 A;  4MC8 A;  5DJV F;  5ILD A;  3WC9 A;  3WJO A;  5B0M A;  4KPJ A;  4LIX A;  2E94 A;  4RXE A;  4F6X A;  5JV2 F;  5A0K A;  4LOB A;  5B0L A;  4GAX A;  3LG5 A;  3IPI A;  4L2X F;  3RBM A;  5JV1 F;  2H8O A;  3PDE A;  4HD1 A;  4P0V A;  3CP6 A;  3PH7 A;  2ZCS A;  3QKC A;  4NG6 A;  4EA1 A;  2Z4Y A;  1V4J A;  2P1C A;  1DGP A;  4N1Z F;  4RXA A;  3LGZ B;  2PS5 A;  2AZJ A;  5IKA A;  3SAE A;  5ERM A;  2AEL A;  3KRC B;  2E8T A;  5I1U A;  3Q2Q A;  5DHI A;  3Q2Z A;  1YQ7 A;  4LA6 A;  3WCI A;  3APZ A;  4XQT F;  4UMJ A;  3N49 F;  5AHU B;  5EAT A;  3KRO A;  4MC0 A;  3B7L A;  1HM7 A;  4KVI A;  3AE0 A;  3WE9 A;  5CG5 A;  4NFI F;  1N20 A;  1YHM A;  2PS7 A;  5A0I A;  3ICZ A;  3LJI A;  5ILI A;  5JV0 F;  1V4E A;  4LZC A;  5AYP A;  3V1X A;  5ERN A;  3S4J A;  4XQR F;  2F7M F;  1HX9 A;  1N21 A;  4LZ0 A;  4LPG F;  3VJ8 A;  4DWG A;  3N6K F;  2ZEV A;  4JZB A;  3W7F A;  3LK5 A;  3TC1 A;  3ACY A;  1FPS A;  3NPR A;  3WCB A;  5ILJ A;  1VG7 A;  4GP2 A;  4EA0 A;  5JUZ F;  5E8K A;  3WCE A;  3P8L A;  2ZCQ A;  3ACW A; 
#chains in the Genus database with same CATH topology
 4LLS A;  1YHK A;  3NRI A;  4LXW A;  2F89 F;  2F9K F;  1VG3 A;  3OAC A;  4QPF A;  1HXC A;  1PS1 A;  2ZEU A;  2Q58 A;  2PS4 A;  5IK9 A;  2Z4W A;  3WCA A;  2Q9Y A;  5C05 A;  5B03 A;  3N0F A;  4DWB A;  5IVG A;  5B0J A;  3ICK A;  2ONH A;  3LEE A;  2AZL A;  1HXG A;  3VJB A;  3P8R A;  4KFA A;  5ERO A;  1V4H A;  5E8L A;  4OKM A;  4LUU A;  5DGM F;  2Q80 A;  5E8H A;  3MAV A;  4NUA A;  4DZW A;  2E93 A;  2VF6 A;  3QQV A;  4H5E F;  1YYR A;  4RNQ A;  4FJQ A;  4KPD A;  4WK5 A;  3RYW A;  3Q30 A;  1YHL A;  1YJ4 A;  5AFX A;  4E1E A;  4LTZ A;  3RMG A;  2Z4Z A;  5ILH A;  2E91 A;  3KRA B;  3LZ9 A;  3LMD A;  4NKE A;  4LPH F;  2ZY1 A;  4KVW A;  4DXJ A;  2E95 A;  1V4I A;  3BNY A;  3WEJ A;  1WL3 A;  2Z7I A;  3WEK A;  5A0J A;  3V1V A;  2Z78 A;  3P5R A;  5KSX F;  1HM4 A;  3WEI A;  1YV5 A;  3N3L F;  1YYQ A;  3LOM A;  3WCH A;  3WEG A;  1HXA A;  3KRC A;  2QIS A;  4NFJ F;  4KWD A;  4Q23 A;  5DIQ F;  4RXD A;  3M01 A;  3KRF B;  5IK0 A;  4GA3 A;  3LGK A;  2E8W A;  2ZCR A;  3WEH A;  1N22 A;  3AQC B;  5DHK A;  2EWG A;  4OMG A;  5DJR F;  3WCJ A;  3SDT A;  4LLT A;  2O1O A;  1DI1 A;  2Z50 A;  4P0X A;  1N23 A;  3WCM A;  2E90 A;  3N5J F;  3EZ3 A;  3TFV A;  3SDR A;  5IL3 A;  3PYA A;  1WY0 A;  3KRP B;  3ZCD A;  5ILY A;  4QXS F;  3M9U A;  3VJ9 A;  2ZCO A;  2AET A;  3DYH A;  1WKZ A;  3KB9 A;  1ZW5 A;  5HNA A;  4JVJ F;  3P41 A;  4XQS F;  5EAU A;  3EGT A;  3ICM A;  3AQ0 A;  4KK2 A;  3WJN A;  3OAB B;  5B0K A;  5CG6 A;  3VJA A;  5ILZ A;  1UBY A;  5IMI A;  3PYB A;  4LFE A;  3WCF A;  5DW7 A;  3BNX A;  1VG6 A;  5DJP F;  3N1V F;  3WCD A;  4DEM F;  2J5C A;  1WL1 A;  3LLW A;  2E92 A;  5IM1 A;  3KBK A;  3EFQ A;  4H5C F;  5DZ2 A;  2E8U A;  3ZMB A;  3DYF A;  3LDW A;  1JFG A;  5ILK A;  1VG2 A;  4JYX A;  5HN7 A;  4OGU A;  3M02 A;  1WMW A;  3WCG A;  2E8V A;  3P5P A;  5IKH A;  3SDU A;  3TFN A;  4N9U A;  2OPN A;  5B00 A;  3WCC A;  2J1O A;  4RXC A;  3M0G A;  3SDQ A;  1N1B A;  2F94 F;  4MC3 A;  5JA0 F;  1UBX A;  5IN8 A;  3N5H F;  1V4K A;  2E4O A;  1RQI A;  4NFK F;  3G4D A;  5IMP A;  3N1W F;  3WJK A;  1KIZ A;  3RYE A;  4NKF A;  1WL0 A;  3N0G A;  3TS7 A;  4LFV F;  4JZX A;  3MZV A;  5B02 A;  4DI5 A;  2OA6 A;  4KUX A;  3N45 F;  3KRA A;  3VJD A;  2Z52 A;  1RTR A;  3VJE A;  5H9D A;  2FOR A;  2OPM A;  3ASX A;  4KQ5 A;  4E9U A;  4LA5 A;  1YYT A;  3LSN A;  4F62 A;  4PVX F;  2F8Z F;  1KIY A;  2AZK A;  2F92 F;  5DGN F;  4E9Z A;  2J1P A;  2PS8 A;  2FTZ A;  3ID0 A;  3ADZ A;  4KVY A;  4LFG A;  2Q9Z A;  4K10 A;  3IBA A;  5DGS F;  3SDV A;  3KRO B;  1VG4 A;  3Q1O A;  3WSB A;  4JXN A;  4ZQ8 A;  3ZMC A;  3KRF A;  2AEK A;  3TFP A;  5IL8 A;  3WSA A;  3LVS A;  3NPK A;  4P0W A;  4GP1 A;  3CKE A;  5B0I A;  5IMN A;  3ZL6 A;  3ZOU A;  4JXY A;  3ACX A;  1JFA A;  1WL2 A;  5ER8 A;  3PKO A;  1YYU A;  3VJC A;  3M00 A;  3S9V A;  4EA2 A;  3CC9 A;  2F8C F;  5IK6 A;  4KQU A;  4LZ3 A;  3KRP A;  1EZF A;  3V66 A;  2Z4V A;  4OMH A;  3DYG A;  3AQB B;  3OAC B;  4KVD A;  2RAH A;  3G4F A;  1UBW A;  3NF2 A;  1RQJ A;  4H5D F;  5HN8 A;  5B01 A;  3WCL A;  1UBV A;  3OAB A;  2OGD A;  2Z4X A;  4KKM A;  3OYR A;  2Z7H A;  4RYP A;  3WEF A;  4PVY F;  3ICN A;  2I19 A;  2PS6 A;  5HN9 A;  4KQS A;  2E8X A;  4LTV A;  4F6V A;  4DHD A;  4OKZ A;  3N46 F;  4FP4 A;  1YYS A;  2ONG A;  5EAS A;  3N3D A;  3UCA A;  5AEL A;  1N24 A;  1N1Z A;  2DH4 A;  4MC8 A;  5DJV F;  5ILD A;  3WC9 A;  3WJO A;  5B0M A;  4KPJ A;  4LIX A;  2E94 A;  4RXE A;  4F6X A;  5JV2 F;  5A0K A;  4LOB A;  5B0L A;  4GAX A;  3LG5 A;  3IPI A;  4L2X F;  3RBM A;  5JV1 F;  2H8O A;  3PDE A;  4HD1 A;  4P0V A;  3CP6 A;  3PH7 A;  2ZCS A;  3QKC A;  4NG6 A;  4EA1 A;  2Z4Y A;  1V4J A;  2P1C A;  1DGP A;  4N1Z F;  4RXA A;  3LGZ B;  2PS5 A;  2AZJ A;  5IKA A;  3SAE A;  5ERM A;  2AEL A;  3KRC B;  2E8T A;  5I1U A;  3Q2Q A;  5DHI A;  3Q2Z A;  1YQ7 A;  4LA6 A;  3WCI A;  3APZ A;  4XQT F;  4UMJ A;  3N49 F;  5AHU B;  5EAT A;  3KRO A;  4MC0 A;  3B7L A;  1HM7 A;  4KVI A;  3AE0 A;  3WE9 A;  5CG5 A;  4NFI F;  1N20 A;  1YHM A;  2PS7 A;  5A0I A;  3ICZ A;  3LJI A;  5ILI A;  5JV0 F;  1V4E A;  4LZC A;  5AYP A;  3V1X A;  5ERN A;  3S4J A;  4XQR F;  2F7M F;  1HX9 A;  1N21 A;  4LZ0 A;  4LPG F;  3VJ8 A;  4DWG A;  3N6K F;  2ZEV A;  4JZB A;  3W7F A;  3LK5 A;  3TC1 A;  3ACY A;  1FPS A;  3NPR A;  3WCB A;  5ILJ A;  1VG7 A;  4GP2 A;  4EA0 A;  5JUZ F;  5E8K A;  3WCE A;  3P8L A;  2ZCQ A;  3ACW A; 
#chains in the Genus database with same CATH homology
 4LLS A;  1YHK A;  3NRI A;  4LXW A;  2F89 F;  2F9K F;  1VG3 A;  3OAC A;  4QPF A;  1HXC A;  1PS1 A;  2ZEU A;  2Q58 A;  2PS4 A;  5IK9 A;  2Z4W A;  3WCA A;  2Q9Y A;  5C05 A;  5B03 A;  3N0F A;  4DWB A;  5IVG A;  5B0J A;  3ICK A;  2ONH A;  3LEE A;  2AZL A;  1HXG A;  3VJB A;  3P8R A;  4KFA A;  5ERO A;  1V4H A;  5E8L A;  4OKM A;  4LUU A;  5DGM F;  2Q80 A;  5E8H A;  3MAV A;  4NUA A;  4DZW A;  2E93 A;  2VF6 A;  3QQV A;  4H5E F;  1YYR A;  4RNQ A;  4FJQ A;  4KPD A;  4WK5 A;  3RYW A;  3Q30 A;  1YHL A;  1YJ4 A;  5AFX A;  4E1E A;  4LTZ A;  3RMG A;  2Z4Z A;  5ILH A;  2E91 A;  3KRA B;  3LZ9 A;  3LMD A;  4NKE A;  4LPH F;  2ZY1 A;  4KVW A;  4DXJ A;  2E95 A;  1V4I A;  3BNY A;  3WEJ A;  1WL3 A;  2Z7I A;  3WEK A;  5A0J A;  3V1V A;  2Z78 A;  3P5R A;  5KSX F;  1HM4 A;  3WEI A;  1YV5 A;  3N3L F;  1YYQ A;  3LOM A;  3WCH A;  3WEG A;  1HXA A;  3KRC A;  2QIS A;  4NFJ F;  4KWD A;  4Q23 A;  5DIQ F;  4RXD A;  3M01 A;  3KRF B;  5IK0 A;  4GA3 A;  3LGK A;  2E8W A;  2ZCR A;  3WEH A;  1N22 A;  3AQC B;  5DHK A;  2EWG A;  4OMG A;  5DJR F;  3WCJ A;  3SDT A;  4LLT A;  2O1O A;  1DI1 A;  2Z50 A;  4P0X A;  1N23 A;  3WCM A;  2E90 A;  3N5J F;  3EZ3 A;  3TFV A;  3SDR A;  5IL3 A;  3PYA A;  1WY0 A;  3KRP B;  3ZCD A;  5ILY A;  4QXS F;  3M9U A;  3VJ9 A;  2ZCO A;  2AET A;  3DYH A;  1WKZ A;  3KB9 A;  1ZW5 A;  5HNA A;  4JVJ F;  3P41 A;  4XQS F;  5EAU A;  3EGT A;  3ICM A;  3AQ0 A;  4KK2 A;  3WJN A;  3OAB B;  5B0K A;  5CG6 A;  3VJA A;  5ILZ A;  1UBY A;  5IMI A;  3PYB A;  4LFE A;  3WCF A;  5DW7 A;  3BNX A;  1VG6 A;  5DJP F;  3N1V F;  3WCD A;  4DEM F;  2J5C A;  1WL1 A;  3LLW A;  2E92 A;  5IM1 A;  3KBK A;  3EFQ A;  4H5C F;  5DZ2 A;  2E8U A;  3ZMB A;  3DYF A;  3LDW A;  1JFG A;  5ILK A;  1VG2 A;  4JYX A;  5HN7 A;  4OGU A;  3M02 A;  1WMW A;  3WCG A;  2E8V A;  3P5P A;  5IKH A;  3SDU A;  3TFN A;  4N9U A;  2OPN A;  5B00 A;  3WCC A;  2J1O A;  4RXC A;  3M0G A;  3SDQ A;  1N1B A;  2F94 F;  4MC3 A;  5JA0 F;  1UBX A;  5IN8 A;  3N5H F;  1V4K A;  2E4O A;  1RQI A;  4NFK F;  3G4D A;  5IMP A;  3N1W F;  3WJK A;  1KIZ A;  3RYE A;  4NKF A;  1WL0 A;  3N0G A;  3TS7 A;  4LFV F;  4JZX A;  3MZV A;  5B02 A;  4DI5 A;  2OA6 A;  4KUX A;  3N45 F;  3KRA A;  3VJD A;  2Z52 A;  1RTR A;  3VJE A;  5H9D A;  2FOR A;  2OPM A;  3ASX A;  4KQ5 A;  4E9U A;  4LA5 A;  1YYT A;  3LSN A;  4F62 A;  4PVX F;  2F8Z F;  1KIY A;  2AZK A;  2F92 F;  5DGN F;  4E9Z A;  2J1P A;  2PS8 A;  2FTZ A;  3ID0 A;  3ADZ A;  4KVY A;  4LFG A;  2Q9Z A;  4K10 A;  3IBA A;  5DGS F;  3SDV A;  3KRO B;  1VG4 A;  3Q1O A;  3WSB A;  4JXN A;  4ZQ8 A;  3ZMC A;  3KRF A;  2AEK A;  3TFP A;  5IL8 A;  3WSA A;  3LVS A;  3NPK A;  4P0W A;  4GP1 A;  3CKE A;  5B0I A;  5IMN A;  3ZL6 A;  3ZOU A;  4JXY A;  3ACX A;  1JFA A;  1WL2 A;  5ER8 A;  3PKO A;  1YYU A;  3VJC A;  3M00 A;  3S9V A;  4EA2 A;  3CC9 A;  2F8C F;  5IK6 A;  4KQU A;  4LZ3 A;  3KRP A;  1EZF A;  3V66 A;  2Z4V A;  4OMH A;  3DYG A;  3AQB B;  3OAC B;  4KVD A;  2RAH A;  3G4F A;  1UBW A;  3NF2 A;  1RQJ A;  4H5D F;  5HN8 A;  5B01 A;  3WCL A;  1UBV A;  3OAB A;  2OGD A;  2Z4X A;  4KKM A;  3OYR A;  2Z7H A;  4RYP A;  3WEF A;  4PVY F;  3ICN A;  2I19 A;  2PS6 A;  5HN9 A;  4KQS A;  2E8X A;  4LTV A;  4F6V A;  4DHD A;  4OKZ A;  3N46 F;  4FP4 A;  1YYS A;  2ONG A;  5EAS A;  3N3D A;  3UCA A;  5AEL A;  1N24 A;  1N1Z A;  2DH4 A;  4MC8 A;  5DJV F;  5ILD A;  3WC9 A;  3WJO A;  5B0M A;  4KPJ A;  4LIX A;  2E94 A;  4RXE A;  4F6X A;  5JV2 F;  5A0K A;  4LOB A;  5B0L A;  4GAX A;  3LG5 A;  3IPI A;  4L2X F;  3RBM A;  5JV1 F;  2H8O A;  3PDE A;  4HD1 A;  4P0V A;  3CP6 A;  3PH7 A;  2ZCS A;  3QKC A;  4NG6 A;  4EA1 A;  2Z4Y A;  1V4J A;  2P1C A;  1DGP A;  4N1Z F;  4RXA A;  3LGZ B;  2PS5 A;  2AZJ A;  5IKA A;  3SAE A;  5ERM A;  2AEL A;  3KRC B;  2E8T A;  5I1U A;  3Q2Q A;  5DHI A;  3Q2Z A;  1YQ7 A;  4LA6 A;  3WCI A;  3APZ A;  4XQT F;  4UMJ A;  3N49 F;  5AHU B;  5EAT A;  3KRO A;  4MC0 A;  3B7L A;  1HM7 A;  4KVI A;  3AE0 A;  3WE9 A;  5CG5 A;  4NFI F;  1N20 A;  1YHM A;  2PS7 A;  5A0I A;  3ICZ A;  3LJI A;  5ILI A;  5JV0 F;  1V4E A;  4LZC A;  5AYP A;  3V1X A;  5ERN A;  3S4J A;  4XQR F;  2F7M F;  1HX9 A;  1N21 A;  4LZ0 A;  4LPG F;  3VJ8 A;  4DWG A;  3N6K F;  2ZEV A;  4JZB A;  3W7F A;  3LK5 A;  3TC1 A;  3ACY A;  1FPS A;  3NPR A;  3WCB A;  5ILJ A;  1VG7 A;  4GP2 A;  4EA0 A;  5JUZ F;  5E8K A;  3WCE A;  3P8L A;  2ZCQ A;  3ACW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...