3M0GA

Crystal structure of putative farnesyl diphosphate synthase from rhodobacter capsulatus
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
285
structure length
264
Chain Sequence
SLSERLKEVQDAVETAMAAAIGRLPAGDLRDAMAYAAQGGKRLRAFLAIESAAIHGISMAQAMPAALAVEALHAYSLVHDDMPCMDNDDLRRGLPTVHKKWDDATAVLAGDALQTLAFELCTDPVLGSAENRVALVAALAQASGAEGMVYGQALDIAAETAAVPLTLDEIIRLQAGKTGALISFAAQAGAILAGADRGPLTAYATALGLAFQIADDILATFVSLLGLAGAKSRAADLVAEAEAALAPYGEAASTLRACARYVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyl diphosphate synthase
publication title CRYSTAL STRUCTURE OF putative farnesyl diphosphate synthase from Rhodobacter capsulatus
rcsb
source organism Rhodobacter capsulatus
total genus 90
structure length 264
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3m0gA00
1WKZA 4LZ3A 4P0VA 2Z78A 2F8CF 2ONGA 4JVJF 3ACXA 2PS7A 5IK6A 5C05A 2F8ZF 1WL2A 3ASXA 2Z4ZA 3PH7A 2ZCRA 3ZMCA 3ZCDA 3CC9A 4NKEA 5DW7A 5IKHA 2Q9ZA 1YV5A 3KRCA 3NRIA 4F62A 3VJEA 3NPKA 2Q58A 3KRPB 3WCCA 4GP2A 3WCJA 5HN9A 5DHIA 1WL0A 4KVWA 5AFXA 3WJNA 3APZA 4LA6A 3SDRA 1VG2A 4Q23A 3KB9A 4DWBA 4KQUA 3KRAA 3OABA 2E8XA 1V4EA 3RBMA 3DYHA 4KK2A 4DHDA 3WE9A 2PS5A 3LOMA 3ZOUA 1WL1A 1RTRA 3P41A 5AELA 1WY0A 4DWGA 2P1CA 3M02A 5H9DA 3PKOA 2AZJA 5B0MA 3MZVA 4MC3A 1YYQA 3N0GA 3RMGA 5JA0F 5E8LA 2AEKA 3PYBA 3WCGA 3WJKA 1VG7A 3P5RA 4KFAA 4OKZA 4KUXA 3KRCB 1HX9A 2OGDA 3UCAA 3WEJA 3LEEA 3WC9A 3VJAA 4FJQA 4EA1A 2ONHA 5DHKA 3BNXA 2E93A 5E8HA 3S9VA 3TFNA 3EZ3A 3OABB 1YHLA 3WSBA 5ILHA 2OPMA 5HN8A 3KRFB 3LMDA 4KQ5A 4KVYA 1N20A 1UBWA 2F89F 4LPHF 1KIZA 1V4JA 2Q9YA 5DZ2A 3KRPA 5EASA 3ICZA 1HXAA 2PS4A 5HNAA 4LIXA 4JZXA 3LZ9A 1EZFA 1HM7A 5AHUB 5E8KA 3WCAA 5B0IA 4LOBA 4LXWA 4QXSF 1YYTA 4LLTA 5IL3A 3N1WF 3VJ8A 5JV1F 4HD1A 3ID0A 3TFVA 1HXCA 5CG5A 5B0LA 1WL3A 2F92F 3TS7A 4NUAA 5JV0F 1VG4A 4NFKF 5HN7A 1YHKA 4KPJA 3LVSA 2Z7IA 5KSXF 3WEKA 3PYAA 5A0KA 1V4IA 3PDEA 4DEMF 4E9ZA 4N9UA 4LUUA 5IK0A 3KBKA 1V4HA 3BNYA 3M9UA 2I19A 2ZCOA 3MAVA 1N24A 4DXJA 3ZMBA 4DZWA 2ZCSA 2Z7HA 4KKMA 2ZY1A 3SAEA 4P0XA 3G4DA 5DGMF 3ACYA 4OKMA 3CP6A 4OMGA 5B03A 1N23A 5IM1A 2E8WA 3WEGA 4LPGF 3KRFA 2F94F 1UBXA 3SDUA 3KROB 5ERMA 3CKEA 4UMJA 5B0JA 3VJCA 5IL8A 1YHMA 2E8TA 3WCHA 3OACB 1JFGA 2VF6A 5ILDA 1JFAA 3V66A 3N49F 4KVIA 3EGTA 4FP4A 2E91A 5ILZA 4JXNA 4LA5A 2J1OA 5IVGA 5ILYA 4OGUA 4RXDA 1RQJA 4LFGA 4WK5A 3WCIA 4KPDA 3VJBA 5DJPF 5I1UA 3WCLA 4LFVF 5ILIA 3NPRA 2E94A 2Z4YA 4LZ0A 5A0JA 3WSAA 2QISA 5B01A 4RXCA 3W7FA 3AQCB 3LK5A 4RYPA 3NF2A 3RYEA 3VJ9A 4H5CF 3V1VA 4EA2A 3SDTA 4RXAA 2E8UA 1HXGA 5EROA 5B0KA 5DGSF 4JXYA 1YQ7A 3DYFA 1DGPA 2E95A 5EAUA 3ICNA 3N3DA 4E1EA 3Q1OA 2AELA 1N22A 4LTVA 4PVXF 3KROA 3RYWA 3P5PA 3P8LA 3LGKA 4OMHA 4GAXA 1HM4A 3QQVA 5IN8A 4KVDA 3SDQA 4XQRF 3N45F 2F9KF 3N5HF 2PS6A 3OACA 4RNQA 3IBAA 1YYUA 3Q2QA 3TC1A 4KQSA 4ZQ8A 5ILKA 5B00A 3EFQA 4JZBA 4RXEA 5CG6A 4L2XF 3QKCA 3LGZB 3ACWA 4KWDA 4LTZA 4XQSF 3ZL6A 3WCDA 3AQBB 5DJVF 3WCFA 3N6KF 5JUZF 4F6XA 5ERNA 4K10A 2FORA 2F7MF 2E90A 1KIYA 4H5EF 3M00A 5JV2F 1YJ4A 3Q2ZA 2H8OA 4QPFA 1N1ZA 2PS8A 5B02A 1PS1A 4P0WA 2Z4XA 1RQIA 2Z4VA 3Q30A 1UBVA 3N1VF 4MC8A 4NG6A 2EWGA 3WEIA 2AZKA 5DIQF 3LDWA 2RAHA 2E4OA 3N46F 4F6VA 1N21A 2E92A 4LLSA 3IPIA 3WEFA 1UBYA 3V1XA 2J5CA 2Z4WA 2AETA 2O1OA 3AQ0A 4NFIF 1FPSA 3WCEA 1VG6A 3WEHA 1DI1A 2ZEVA 3ICKA 3P8RA 5ER8A 3LG5A 1VG3A 2E8VA 2Z52A 3SDVA 3N5JF 4NFJF 2AZLA 4JYXA 1V4KA 2ZCQA 1WMWA 3ADZA 5A0IA 4XQTF 2Z50A 3DYGA 3N3LF 4EA0A 5IMPA 4E9UA 3KRAB 3OYRA 3LLWA 4LFEA 1YYRA 2DH4A 2OPNA 3S4JA 3WJOA 4DI5A 1N1BA 5ILJA 4N1ZF 3TFPA 4GA3A 3M0GA 1YYSA 2J1PA 3LJIA 3VJDA 3WCBA 3ICMA 4PVYF 2ZEUA 5IKAA 5DJRF 4NKFA 3LSNA 1ZW5A 3AE0A 5DGNF 2Q80A 5IMIA 2FTZA 5AYPA 3N0FA 2OA6A 5IK9A 3WCMA 5EATA 3M01A 3B7LA 3G4FA 4GP1A 4LZCA 4MC0A 4H5DF 5IMNA
chains in the Genus database with same CATH superfamily
1WKZA 4LZ3A 4P0VA 2Z78A 2F8CF 2ONGA 4JVJF 3ACXA 2PS7A 5IK6A 5C05A 2F8ZF 1WL2A 3ASXA 2Z4ZA 3PH7A 2ZCRA 3ZMCA 3ZCDA 3CC9A 4NKEA 5DW7A 5IKHA 2Q9ZA 1YV5A 3KRCA 3NRIA 4F62A 3VJEA 3NPKA 2Q58A 3KRPB 3WCCA 4GP2A 3WCJA 5HN9A 5DHIA 1WL0A 4KVWA 5AFXA 3WJNA 3APZA 4LA6A 3SDRA 1VG2A 4Q23A 3KB9A 4DWBA 4KQUA 3KRAA 3OABA 2E8XA 1V4EA 3RBMA 3DYHA 4KK2A 4DHDA 3WE9A 2PS5A 3LOMA 3ZOUA 1WL1A 1RTRA 3P41A 5AELA 1WY0A 4DWGA 2P1CA 3M02A 5H9DA 3PKOA 2AZJA 5B0MA 3MZVA 4MC3A 1YYQA 3N0GA 3RMGA 5JA0F 5E8LA 2AEKA 3PYBA 3WCGA 3WJKA 1VG7A 3P5RA 4KFAA 4OKZA 4KUXA 3KRCB 1HX9A 2OGDA 3UCAA 3WEJA 3LEEA 3WC9A 3VJAA 4FJQA 4EA1A 2ONHA 5DHKA 3BNXA 2E93A 5E8HA 3S9VA 3TFNA 3EZ3A 3OABB 1YHLA 3WSBA 5ILHA 2OPMA 5HN8A 3KRFB 3LMDA 4KQ5A 4KVYA 1N20A 1UBWA 2F89F 4LPHF 1KIZA 1V4JA 2Q9YA 5DZ2A 3KRPA 5EASA 3ICZA 1HXAA 2PS4A 5HNAA 4LIXA 4JZXA 3LZ9A 1EZFA 1HM7A 5AHUB 5E8KA 3WCAA 5B0IA 4LOBA 4LXWA 4QXSF 1YYTA 4LLTA 5IL3A 3N1WF 3VJ8A 5JV1F 4HD1A 3ID0A 3TFVA 1HXCA 5CG5A 5B0LA 1WL3A 2F92F 3TS7A 4NUAA 5JV0F 1VG4A 4NFKF 5HN7A 1YHKA 4KPJA 3LVSA 2Z7IA 5KSXF 3WEKA 3PYAA 5A0KA 1V4IA 3PDEA 4DEMF 4E9ZA 4N9UA 4LUUA 5IK0A 3KBKA 1V4HA 3BNYA 3M9UA 2I19A 2ZCOA 3MAVA 1N24A 4DXJA 3ZMBA 4DZWA 2ZCSA 2Z7HA 4KKMA 2ZY1A 3SAEA 4P0XA 3G4DA 5DGMF 3ACYA 4OKMA 3CP6A 4OMGA 5B03A 1N23A 5IM1A 2E8WA 3WEGA 4LPGF 3KRFA 2F94F 1UBXA 3SDUA 3KROB 5ERMA 3CKEA 4UMJA 5B0JA 3VJCA 5IL8A 1YHMA 2E8TA 3WCHA 3OACB 1JFGA 2VF6A 5ILDA 1JFAA 3V66A 3N49F 4KVIA 3EGTA 4FP4A 2E91A 5ILZA 4JXNA 4LA5A 2J1OA 5IVGA 5ILYA 4OGUA 4RXDA 1RQJA 4LFGA 4WK5A 3WCIA 4KPDA 3VJBA 5DJPF 5I1UA 3WCLA 4LFVF 5ILIA 3NPRA 2E94A 2Z4YA 4LZ0A 5A0JA 3WSAA 2QISA 5B01A 4RXCA 3W7FA 3AQCB 3LK5A 4RYPA 3NF2A 3RYEA 3VJ9A 4H5CF 3V1VA 4EA2A 3SDTA 4RXAA 2E8UA 1HXGA 5EROA 5B0KA 5DGSF 4JXYA 1YQ7A 3DYFA 1DGPA 2E95A 5EAUA 3ICNA 3N3DA 4E1EA 3Q1OA 2AELA 1N22A 4LTVA 4PVXF 3KROA 3RYWA 3P5PA 3P8LA 3LGKA 4OMHA 4GAXA 1HM4A 3QQVA 5IN8A 4KVDA 3SDQA 4XQRF 3N45F 2F9KF 3N5HF 2PS6A 3OACA 4RNQA 3IBAA 1YYUA 3Q2QA 3TC1A 4KQSA 4ZQ8A 5ILKA 5B00A 3EFQA 4JZBA 4RXEA 5CG6A 4L2XF 3QKCA 3LGZB 3ACWA 4KWDA 4LTZA 4XQSF 3ZL6A 3WCDA 3AQBB 5DJVF 3WCFA 3N6KF 5JUZF 4F6XA 5ERNA 4K10A 2FORA 2F7MF 2E90A 1KIYA 4H5EF 3M00A 5JV2F 1YJ4A 3Q2ZA 2H8OA 4QPFA 1N1ZA 2PS8A 5B02A 1PS1A 4P0WA 2Z4XA 1RQIA 2Z4VA 3Q30A 1UBVA 3N1VF 4MC8A 4NG6A 2EWGA 3WEIA 2AZKA 5DIQF 3LDWA 2RAHA 2E4OA 3N46F 4F6VA 1N21A 2E92A 4LLSA 3IPIA 3WEFA 1UBYA 3V1XA 2J5CA 2Z4WA 2AETA 2O1OA 3AQ0A 4NFIF 1FPSA 3WCEA 1VG6A 3WEHA 1DI1A 2ZEVA 3ICKA 3P8RA 5ER8A 3LG5A 1VG3A 2E8VA 2Z52A 3SDVA 3N5JF 4NFJF 2AZLA 4JYXA 1V4KA 2ZCQA 1WMWA 3ADZA 5A0IA 4XQTF 2Z50A 3DYGA 3N3LF 4EA0A 5IMPA 4E9UA 3KRAB 3OYRA 3LLWA 4LFEA 1YYRA 2DH4A 2OPNA 3S4JA 3WJOA 4DI5A 1N1BA 5ILJA 4N1ZF 3TFPA 4GA3A 3M0GA 1YYSA 2J1PA 3LJIA 3VJDA 3WCBA 3ICMA 4PVYF 2ZEUA 5IKAA 5DJRF 4NKFA 3LSNA 1ZW5A 3AE0A 5DGNF 2Q80A 5IMIA 2FTZA 5AYPA 3N0FA 2OA6A 5IK9A 3WCMA 5EATA 3M01A 3B7LA 3G4FA 4GP1A 4LZCA 4MC0A 4H5DF 5IMNA
chains in the Genus database with same CATH topology
1WKZA 4LZ3A 4P0VA 2Z78A 2F8CF 2ONGA 4JVJF 3ACXA 2PS7A 5IK6A 5C05A 2F8ZF 1WL2A 3ASXA 2Z4ZA 3PH7A 2ZCRA 3ZMCA 3ZCDA 3CC9A 4NKEA 5DW7A 5IKHA 2Q9ZA 1YV5A 3KRCA 3NRIA 4F62A 3VJEA 3NPKA 2Q58A 3KRPB 3WCCA 4GP2A 3WCJA 5HN9A 5DHIA 1WL0A 4KVWA 5AFXA 3WJNA 3APZA 4LA6A 3SDRA 1VG2A 4Q23A 3KB9A 4DWBA 4KQUA 3KRAA 3OABA 2E8XA 1V4EA 3RBMA 3DYHA 4KK2A 4DHDA 3WE9A 2PS5A 3LOMA 3ZOUA 1WL1A 1RTRA 3P41A 5AELA 1WY0A 4DWGA 2P1CA 3M02A 5H9DA 3PKOA 2AZJA 5B0MA 3MZVA 4MC3A 1YYQA 3N0GA 3RMGA 5JA0F 5E8LA 2AEKA 3PYBA 3WCGA 3WJKA 1VG7A 3P5RA 4KFAA 4OKZA 4KUXA 3KRCB 1HX9A 2OGDA 3UCAA 3WEJA 3LEEA 3WC9A 3VJAA 4FJQA 4EA1A 2ONHA 5DHKA 3BNXA 2E93A 5E8HA 3S9VA 3TFNA 3EZ3A 3OABB 1YHLA 3WSBA 5ILHA 2OPMA 5HN8A 3KRFB 3LMDA 4KQ5A 4KVYA 1N20A 1UBWA 2F89F 4LPHF 1KIZA 1V4JA 2Q9YA 5DZ2A 3KRPA 5EASA 3ICZA 1HXAA 2PS4A 5HNAA 4LIXA 4JZXA 3LZ9A 1EZFA 1HM7A 5AHUB 5E8KA 3WCAA 5B0IA 4LOBA 4LXWA 4QXSF 1YYTA 4LLTA 5IL3A 3N1WF 3VJ8A 5JV1F 4HD1A 3ID0A 3TFVA 1HXCA 5CG5A 5B0LA 1WL3A 2F92F 3TS7A 4NUAA 5JV0F 1VG4A 4NFKF 5HN7A 1YHKA 4KPJA 3LVSA 2Z7IA 5KSXF 3WEKA 3PYAA 5A0KA 1V4IA 3PDEA 4DEMF 4E9ZA 4N9UA 4LUUA 5IK0A 3KBKA 1V4HA 3BNYA 3M9UA 2I19A 2ZCOA 3MAVA 1N24A 4DXJA 3ZMBA 4DZWA 2ZCSA 2Z7HA 4KKMA 2ZY1A 3SAEA 4P0XA 3G4DA 5DGMF 3ACYA 4OKMA 3CP6A 4OMGA 5B03A 1N23A 5IM1A 2E8WA 3WEGA 4LPGF 3KRFA 2F94F 1UBXA 3SDUA 3KROB 5ERMA 3CKEA 4UMJA 5B0JA 3VJCA 5IL8A 1YHMA 2E8TA 3WCHA 3OACB 1JFGA 2VF6A 5ILDA 1JFAA 3V66A 3N49F 4KVIA 3EGTA 4FP4A 2E91A 5ILZA 4JXNA 4LA5A 2J1OA 5IVGA 5ILYA 4OGUA 4RXDA 1RQJA 4LFGA 4WK5A 3WCIA 4KPDA 3VJBA 5DJPF 5I1UA 3WCLA 4LFVF 5ILIA 3NPRA 2E94A 2Z4YA 4LZ0A 5A0JA 3WSAA 2QISA 5B01A 4RXCA 3W7FA 3AQCB 3LK5A 4RYPA 3NF2A 3RYEA 3VJ9A 4H5CF 3V1VA 4EA2A 3SDTA 4RXAA 2E8UA 1HXGA 5EROA 5B0KA 5DGSF 4JXYA 1YQ7A 3DYFA 1DGPA 2E95A 5EAUA 3ICNA 3N3DA 4E1EA 3Q1OA 2AELA 1N22A 4LTVA 4PVXF 3KROA 3RYWA 3P5PA 3P8LA 3LGKA 4OMHA 4GAXA 1HM4A 3QQVA 5IN8A 4KVDA 3SDQA 4XQRF 3N45F 2F9KF 3N5HF 2PS6A 3OACA 4RNQA 3IBAA 1YYUA 3Q2QA 3TC1A 4KQSA 4ZQ8A 5ILKA 5B00A 3EFQA 4JZBA 4RXEA 5CG6A 4L2XF 3QKCA 3LGZB 3ACWA 4KWDA 4LTZA 4XQSF 3ZL6A 3WCDA 3AQBB 5DJVF 3WCFA 3N6KF 5JUZF 4F6XA 5ERNA 4K10A 2FORA 2F7MF 2E90A 1KIYA 4H5EF 3M00A 5JV2F 1YJ4A 3Q2ZA 2H8OA 4QPFA 1N1ZA 2PS8A 5B02A 1PS1A 4P0WA 2Z4XA 1RQIA 2Z4VA 3Q30A 1UBVA 3N1VF 4MC8A 4NG6A 2EWGA 3WEIA 2AZKA 5DIQF 3LDWA 2RAHA 2E4OA 3N46F 4F6VA 1N21A 2E92A 4LLSA 3IPIA 3WEFA 1UBYA 3V1XA 2J5CA 2Z4WA 2AETA 2O1OA 3AQ0A 4NFIF 1FPSA 3WCEA 1VG6A 3WEHA 1DI1A 2ZEVA 3ICKA 3P8RA 5ER8A 3LG5A 1VG3A 2E8VA 2Z52A 3SDVA 3N5JF 4NFJF 2AZLA 4JYXA 1V4KA 2ZCQA 1WMWA 3ADZA 5A0IA 4XQTF 2Z50A 3DYGA 3N3LF 4EA0A 5IMPA 4E9UA 3KRAB 3OYRA 3LLWA 4LFEA 1YYRA 2DH4A 2OPNA 3S4JA 3WJOA 4DI5A 1N1BA 5ILJA 4N1ZF 3TFPA 4GA3A 3M0GA 1YYSA 2J1PA 3LJIA 3VJDA 3WCBA 3ICMA 4PVYF 2ZEUA 5IKAA 5DJRF 4NKFA 3LSNA 1ZW5A 3AE0A 5DGNF 2Q80A 5IMIA 2FTZA 5AYPA 3N0FA 2OA6A 5IK9A 3WCMA 5EATA 3M01A 3B7LA 3G4FA 4GP1A 4LZCA 4MC0A 4H5DF 5IMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WKZ A;  4LZ3 A;  4P0V A;  2Z78 A;  2F8C F;  2ONG A;  4JVJ F;  3ACX A;  2PS7 A;  5IK6 A;  5C05 A;  2F8Z F;  1WL2 A;  3ASX A;  2Z4Z A;  3PH7 A;  2ZCR A;  3ZMC A;  3ZCD A;  3CC9 A;  4NKE A;  5DW7 A;  5IKH A;  2Q9Z A;  1YV5 A;  3KRC A;  3NRI A;  4F62 A;  3VJE A;  3NPK A;  2Q58 A;  3KRP B;  3WCC A;  4GP2 A;  3WCJ A;  5HN9 A;  5DHI A;  1WL0 A;  4KVW A;  5AFX A;  3WJN A;  3APZ A;  4LA6 A;  3SDR A;  1VG2 A;  4Q23 A;  3KB9 A;  4DWB A;  4KQU A;  3KRA A;  3OAB A;  2E8X A;  1V4E A;  3RBM A;  3DYH A;  4KK2 A;  4DHD A;  3WE9 A;  2PS5 A;  3LOM A;  3ZOU A;  1WL1 A;  1RTR A;  3P41 A;  5AEL A;  1WY0 A;  4DWG A;  2P1C A;  3M02 A;  5H9D A;  3PKO A;  2AZJ A;  5B0M A;  3MZV A;  4MC3 A;  1YYQ A;  3N0G A;  3RMG A;  5JA0 F;  5E8L A;  2AEK A;  3PYB A;  3WCG A;  3WJK A;  1VG7 A;  3P5R A;  4KFA A;  4OKZ A;  4KUX A;  3KRC B;  1HX9 A;  2OGD A;  3UCA A;  3WEJ A;  3LEE A;  3WC9 A;  3VJA A;  4FJQ A;  4EA1 A;  2ONH A;  5DHK A;  3BNX A;  2E93 A;  5E8H A;  3S9V A;  3TFN A;  3EZ3 A;  3OAB B;  1YHL A;  3WSB A;  5ILH A;  2OPM A;  5HN8 A;  3KRF B;  3LMD A;  4KQ5 A;  4KVY A;  1N20 A;  1UBW A;  2F89 F;  4LPH F;  1KIZ A;  1V4J A;  2Q9Y A;  5DZ2 A;  3KRP A;  5EAS A;  3ICZ A;  1HXA A;  2PS4 A;  5HNA A;  4LIX A;  4JZX A;  3LZ9 A;  1EZF A;  1HM7 A;  5AHU B;  5E8K A;  3WCA A;  5B0I A;  4LOB A;  4LXW A;  4QXS F;  1YYT A;  4LLT A;  5IL3 A;  3N1W F;  3VJ8 A;  5JV1 F;  4HD1 A;  3ID0 A;  3TFV A;  1HXC A;  5CG5 A;  5B0L A;  1WL3 A;  2F92 F;  3TS7 A;  4NUA A;  5JV0 F;  1VG4 A;  4NFK F;  5HN7 A;  1YHK A;  4KPJ A;  3LVS A;  2Z7I A;  5KSX F;  3WEK A;  3PYA A;  5A0K A;  1V4I A;  3PDE A;  4DEM F;  4E9Z A;  4N9U A;  4LUU A;  5IK0 A;  3KBK A;  1V4H A;  3BNY A;  3M9U A;  2I19 A;  2ZCO A;  3MAV A;  1N24 A;  4DXJ A;  3ZMB A;  4DZW A;  2ZCS A;  2Z7H A;  4KKM A;  2ZY1 A;  3SAE A;  4P0X A;  3G4D A;  5DGM F;  3ACY A;  4OKM A;  3CP6 A;  4OMG A;  5B03 A;  1N23 A;  5IM1 A;  2E8W A;  3WEG A;  4LPG F;  3KRF A;  2F94 F;  1UBX A;  3SDU A;  3KRO B;  5ERM A;  3CKE A;  4UMJ A;  5B0J A;  3VJC A;  5IL8 A;  1YHM A;  2E8T A;  3WCH A;  3OAC B;  1JFG A;  2VF6 A;  5ILD A;  1JFA A;  3V66 A;  3N49 F;  4KVI A;  3EGT A;  4FP4 A;  2E91 A;  5ILZ A;  4JXN A;  4LA5 A;  2J1O A;  5IVG A;  5ILY A;  4OGU A;  4RXD A;  1RQJ A;  4LFG A;  4WK5 A;  3WCI A;  4KPD A;  3VJB A;  5DJP F;  5I1U A;  3WCL A;  4LFV F;  5ILI A;  3NPR A;  2E94 A;  2Z4Y A;  4LZ0 A;  5A0J A;  3WSA A;  2QIS A;  5B01 A;  4RXC A;  3W7F A;  3AQC B;  3LK5 A;  4RYP A;  3NF2 A;  3RYE A;  3VJ9 A;  4H5C F;  3V1V A;  4EA2 A;  3SDT A;  4RXA A;  2E8U A;  1HXG A;  5ERO A;  5B0K A;  5DGS F;  4JXY A;  1YQ7 A;  3DYF A;  1DGP A;  2E95 A;  5EAU A;  3ICN A;  3N3D A;  4E1E A;  3Q1O A;  2AEL A;  1N22 A;  4LTV A;  4PVX F;  3KRO A;  3RYW A;  3P5P A;  3P8L A;  3LGK A;  4OMH A;  4GAX A;  1HM4 A;  3QQV A;  5IN8 A;  4KVD A;  3SDQ A;  4XQR F;  3N45 F;  2F9K F;  3N5H F;  2PS6 A;  3OAC A;  4RNQ A;  3IBA A;  1YYU A;  3Q2Q A;  3TC1 A;  4KQS A;  4ZQ8 A;  5ILK A;  5B00 A;  3EFQ A;  4JZB A;  4RXE A;  5CG6 A;  4L2X F;  3QKC A;  3LGZ B;  3ACW A;  4KWD A;  4LTZ A;  4XQS F;  3ZL6 A;  3WCD A;  3AQB B;  5DJV F;  3WCF A;  3N6K F;  5JUZ F;  4F6X A;  5ERN A;  4K10 A;  2FOR A;  2F7M F;  2E90 A;  1KIY A;  4H5E F;  3M00 A;  5JV2 F;  1YJ4 A;  3Q2Z A;  2H8O A;  4QPF A;  1N1Z A;  2PS8 A;  5B02 A;  1PS1 A;  4P0W A;  2Z4X A;  1RQI A;  2Z4V A;  3Q30 A;  1UBV A;  3N1V F;  4MC8 A;  4NG6 A;  2EWG A;  3WEI A;  2AZK A;  5DIQ F;  3LDW A;  2RAH A;  2E4O A;  3N46 F;  4F6V A;  1N21 A;  2E92 A;  4LLS A;  3IPI A;  3WEF A;  1UBY A;  3V1X A;  2J5C A;  2Z4W A;  2AET A;  2O1O A;  3AQ0 A;  4NFI F;  1FPS A;  3WCE A;  1VG6 A;  3WEH A;  1DI1 A;  2ZEV A;  3ICK A;  3P8R A;  5ER8 A;  3LG5 A;  1VG3 A;  2E8V A;  2Z52 A;  3SDV A;  3N5J F;  4NFJ F;  2AZL A;  4JYX A;  1V4K A;  2ZCQ A;  1WMW A;  3ADZ A;  5A0I A;  4XQT F;  2Z50 A;  3DYG A;  3N3L F;  4EA0 A;  5IMP A;  4E9U A;  3KRA B;  3OYR A;  3LLW A;  4LFE A;  1YYR A;  2DH4 A;  2OPN A;  3S4J A;  3WJO A;  4DI5 A;  1N1B A;  5ILJ A;  4N1Z F;  3TFP A;  4GA3 A;  3M0G A;  1YYS A;  2J1P A;  3LJI A;  3VJD A;  3WCB A;  3ICM A;  4PVY F;  2ZEU A;  5IKA A;  5DJR F;  4NKF A;  3LSN A;  1ZW5 A;  3AE0 A;  5DGN F;  2Q80 A;  5IMI A;  2FTZ A;  5AYP A;  3N0F A;  2OA6 A;  5IK9 A;  3WCM A;  5EAT A;  3M01 A;  3B7L A;  3G4F A;  4GP1 A;  4LZC A;  4MC0 A;  4H5D F;  5IMN A; 
#chains in the Genus database with same CATH topology
 1WKZ A;  4LZ3 A;  4P0V A;  2Z78 A;  2F8C F;  2ONG A;  4JVJ F;  3ACX A;  2PS7 A;  5IK6 A;  5C05 A;  2F8Z F;  1WL2 A;  3ASX A;  2Z4Z A;  3PH7 A;  2ZCR A;  3ZMC A;  3ZCD A;  3CC9 A;  4NKE A;  5DW7 A;  5IKH A;  2Q9Z A;  1YV5 A;  3KRC A;  3NRI A;  4F62 A;  3VJE A;  3NPK A;  2Q58 A;  3KRP B;  3WCC A;  4GP2 A;  3WCJ A;  5HN9 A;  5DHI A;  1WL0 A;  4KVW A;  5AFX A;  3WJN A;  3APZ A;  4LA6 A;  3SDR A;  1VG2 A;  4Q23 A;  3KB9 A;  4DWB A;  4KQU A;  3KRA A;  3OAB A;  2E8X A;  1V4E A;  3RBM A;  3DYH A;  4KK2 A;  4DHD A;  3WE9 A;  2PS5 A;  3LOM A;  3ZOU A;  1WL1 A;  1RTR A;  3P41 A;  5AEL A;  1WY0 A;  4DWG A;  2P1C A;  3M02 A;  5H9D A;  3PKO A;  2AZJ A;  5B0M A;  3MZV A;  4MC3 A;  1YYQ A;  3N0G A;  3RMG A;  5JA0 F;  5E8L A;  2AEK A;  3PYB A;  3WCG A;  3WJK A;  1VG7 A;  3P5R A;  4KFA A;  4OKZ A;  4KUX A;  3KRC B;  1HX9 A;  2OGD A;  3UCA A;  3WEJ A;  3LEE A;  3WC9 A;  3VJA A;  4FJQ A;  4EA1 A;  2ONH A;  5DHK A;  3BNX A;  2E93 A;  5E8H A;  3S9V A;  3TFN A;  3EZ3 A;  3OAB B;  1YHL A;  3WSB A;  5ILH A;  2OPM A;  5HN8 A;  3KRF B;  3LMD A;  4KQ5 A;  4KVY A;  1N20 A;  1UBW A;  2F89 F;  4LPH F;  1KIZ A;  1V4J A;  2Q9Y A;  5DZ2 A;  3KRP A;  5EAS A;  3ICZ A;  1HXA A;  2PS4 A;  5HNA A;  4LIX A;  4JZX A;  3LZ9 A;  1EZF A;  1HM7 A;  5AHU B;  5E8K A;  3WCA A;  5B0I A;  4LOB A;  4LXW A;  4QXS F;  1YYT A;  4LLT A;  5IL3 A;  3N1W F;  3VJ8 A;  5JV1 F;  4HD1 A;  3ID0 A;  3TFV A;  1HXC A;  5CG5 A;  5B0L A;  1WL3 A;  2F92 F;  3TS7 A;  4NUA A;  5JV0 F;  1VG4 A;  4NFK F;  5HN7 A;  1YHK A;  4KPJ A;  3LVS A;  2Z7I A;  5KSX F;  3WEK A;  3PYA A;  5A0K A;  1V4I A;  3PDE A;  4DEM F;  4E9Z A;  4N9U A;  4LUU A;  5IK0 A;  3KBK A;  1V4H A;  3BNY A;  3M9U A;  2I19 A;  2ZCO A;  3MAV A;  1N24 A;  4DXJ A;  3ZMB A;  4DZW A;  2ZCS A;  2Z7H A;  4KKM A;  2ZY1 A;  3SAE A;  4P0X A;  3G4D A;  5DGM F;  3ACY A;  4OKM A;  3CP6 A;  4OMG A;  5B03 A;  1N23 A;  5IM1 A;  2E8W A;  3WEG A;  4LPG F;  3KRF A;  2F94 F;  1UBX A;  3SDU A;  3KRO B;  5ERM A;  3CKE A;  4UMJ A;  5B0J A;  3VJC A;  5IL8 A;  1YHM A;  2E8T A;  3WCH A;  3OAC B;  1JFG A;  2VF6 A;  5ILD A;  1JFA A;  3V66 A;  3N49 F;  4KVI A;  3EGT A;  4FP4 A;  2E91 A;  5ILZ A;  4JXN A;  4LA5 A;  2J1O A;  5IVG A;  5ILY A;  4OGU A;  4RXD A;  1RQJ A;  4LFG A;  4WK5 A;  3WCI A;  4KPD A;  3VJB A;  5DJP F;  5I1U A;  3WCL A;  4LFV F;  5ILI A;  3NPR A;  2E94 A;  2Z4Y A;  4LZ0 A;  5A0J A;  3WSA A;  2QIS A;  5B01 A;  4RXC A;  3W7F A;  3AQC B;  3LK5 A;  4RYP A;  3NF2 A;  3RYE A;  3VJ9 A;  4H5C F;  3V1V A;  4EA2 A;  3SDT A;  4RXA A;  2E8U A;  1HXG A;  5ERO A;  5B0K A;  5DGS F;  4JXY A;  1YQ7 A;  3DYF A;  1DGP A;  2E95 A;  5EAU A;  3ICN A;  3N3D A;  4E1E A;  3Q1O A;  2AEL A;  1N22 A;  4LTV A;  4PVX F;  3KRO A;  3RYW A;  3P5P A;  3P8L A;  3LGK A;  4OMH A;  4GAX A;  1HM4 A;  3QQV A;  5IN8 A;  4KVD A;  3SDQ A;  4XQR F;  3N45 F;  2F9K F;  3N5H F;  2PS6 A;  3OAC A;  4RNQ A;  3IBA A;  1YYU A;  3Q2Q A;  3TC1 A;  4KQS A;  4ZQ8 A;  5ILK A;  5B00 A;  3EFQ A;  4JZB A;  4RXE A;  5CG6 A;  4L2X F;  3QKC A;  3LGZ B;  3ACW A;  4KWD A;  4LTZ A;  4XQS F;  3ZL6 A;  3WCD A;  3AQB B;  5DJV F;  3WCF A;  3N6K F;  5JUZ F;  4F6X A;  5ERN A;  4K10 A;  2FOR A;  2F7M F;  2E90 A;  1KIY A;  4H5E F;  3M00 A;  5JV2 F;  1YJ4 A;  3Q2Z A;  2H8O A;  4QPF A;  1N1Z A;  2PS8 A;  5B02 A;  1PS1 A;  4P0W A;  2Z4X A;  1RQI A;  2Z4V A;  3Q30 A;  1UBV A;  3N1V F;  4MC8 A;  4NG6 A;  2EWG A;  3WEI A;  2AZK A;  5DIQ F;  3LDW A;  2RAH A;  2E4O A;  3N46 F;  4F6V A;  1N21 A;  2E92 A;  4LLS A;  3IPI A;  3WEF A;  1UBY A;  3V1X A;  2J5C A;  2Z4W A;  2AET A;  2O1O A;  3AQ0 A;  4NFI F;  1FPS A;  3WCE A;  1VG6 A;  3WEH A;  1DI1 A;  2ZEV A;  3ICK A;  3P8R A;  5ER8 A;  3LG5 A;  1VG3 A;  2E8V A;  2Z52 A;  3SDV A;  3N5J F;  4NFJ F;  2AZL A;  4JYX A;  1V4K A;  2ZCQ A;  1WMW A;  3ADZ A;  5A0I A;  4XQT F;  2Z50 A;  3DYG A;  3N3L F;  4EA0 A;  5IMP A;  4E9U A;  3KRA B;  3OYR A;  3LLW A;  4LFE A;  1YYR A;  2DH4 A;  2OPN A;  3S4J A;  3WJO A;  4DI5 A;  1N1B A;  5ILJ A;  4N1Z F;  3TFP A;  4GA3 A;  3M0G A;  1YYS A;  2J1P A;  3LJI A;  3VJD A;  3WCB A;  3ICM A;  4PVY F;  2ZEU A;  5IKA A;  5DJR F;  4NKF A;  3LSN A;  1ZW5 A;  3AE0 A;  5DGN F;  2Q80 A;  5IMI A;  2FTZ A;  5AYP A;  3N0F A;  2OA6 A;  5IK9 A;  3WCM A;  5EAT A;  3M01 A;  3B7L A;  3G4F A;  4GP1 A;  4LZC A;  4MC0 A;  4H5D F;  5IMN A; 
#chains in the Genus database with same CATH homology
 1WKZ A;  4LZ3 A;  4P0V A;  2Z78 A;  2F8C F;  2ONG A;  4JVJ F;  3ACX A;  2PS7 A;  5IK6 A;  5C05 A;  2F8Z F;  1WL2 A;  3ASX A;  2Z4Z A;  3PH7 A;  2ZCR A;  3ZMC A;  3ZCD A;  3CC9 A;  4NKE A;  5DW7 A;  5IKH A;  2Q9Z A;  1YV5 A;  3KRC A;  3NRI A;  4F62 A;  3VJE A;  3NPK A;  2Q58 A;  3KRP B;  3WCC A;  4GP2 A;  3WCJ A;  5HN9 A;  5DHI A;  1WL0 A;  4KVW A;  5AFX A;  3WJN A;  3APZ A;  4LA6 A;  3SDR A;  1VG2 A;  4Q23 A;  3KB9 A;  4DWB A;  4KQU A;  3KRA A;  3OAB A;  2E8X A;  1V4E A;  3RBM A;  3DYH A;  4KK2 A;  4DHD A;  3WE9 A;  2PS5 A;  3LOM A;  3ZOU A;  1WL1 A;  1RTR A;  3P41 A;  5AEL A;  1WY0 A;  4DWG A;  2P1C A;  3M02 A;  5H9D A;  3PKO A;  2AZJ A;  5B0M A;  3MZV A;  4MC3 A;  1YYQ A;  3N0G A;  3RMG A;  5JA0 F;  5E8L A;  2AEK A;  3PYB A;  3WCG A;  3WJK A;  1VG7 A;  3P5R A;  4KFA A;  4OKZ A;  4KUX A;  3KRC B;  1HX9 A;  2OGD A;  3UCA A;  3WEJ A;  3LEE A;  3WC9 A;  3VJA A;  4FJQ A;  4EA1 A;  2ONH A;  5DHK A;  3BNX A;  2E93 A;  5E8H A;  3S9V A;  3TFN A;  3EZ3 A;  3OAB B;  1YHL A;  3WSB A;  5ILH A;  2OPM A;  5HN8 A;  3KRF B;  3LMD A;  4KQ5 A;  4KVY A;  1N20 A;  1UBW A;  2F89 F;  4LPH F;  1KIZ A;  1V4J A;  2Q9Y A;  5DZ2 A;  3KRP A;  5EAS A;  3ICZ A;  1HXA A;  2PS4 A;  5HNA A;  4LIX A;  4JZX A;  3LZ9 A;  1EZF A;  1HM7 A;  5AHU B;  5E8K A;  3WCA A;  5B0I A;  4LOB A;  4LXW A;  4QXS F;  1YYT A;  4LLT A;  5IL3 A;  3N1W F;  3VJ8 A;  5JV1 F;  4HD1 A;  3ID0 A;  3TFV A;  1HXC A;  5CG5 A;  5B0L A;  1WL3 A;  2F92 F;  3TS7 A;  4NUA A;  5JV0 F;  1VG4 A;  4NFK F;  5HN7 A;  1YHK A;  4KPJ A;  3LVS A;  2Z7I A;  5KSX F;  3WEK A;  3PYA A;  5A0K A;  1V4I A;  3PDE A;  4DEM F;  4E9Z A;  4N9U A;  4LUU A;  5IK0 A;  3KBK A;  1V4H A;  3BNY A;  3M9U A;  2I19 A;  2ZCO A;  3MAV A;  1N24 A;  4DXJ A;  3ZMB A;  4DZW A;  2ZCS A;  2Z7H A;  4KKM A;  2ZY1 A;  3SAE A;  4P0X A;  3G4D A;  5DGM F;  3ACY A;  4OKM A;  3CP6 A;  4OMG A;  5B03 A;  1N23 A;  5IM1 A;  2E8W A;  3WEG A;  4LPG F;  3KRF A;  2F94 F;  1UBX A;  3SDU A;  3KRO B;  5ERM A;  3CKE A;  4UMJ A;  5B0J A;  3VJC A;  5IL8 A;  1YHM A;  2E8T A;  3WCH A;  3OAC B;  1JFG A;  2VF6 A;  5ILD A;  1JFA A;  3V66 A;  3N49 F;  4KVI A;  3EGT A;  4FP4 A;  2E91 A;  5ILZ A;  4JXN A;  4LA5 A;  2J1O A;  5IVG A;  5ILY A;  4OGU A;  4RXD A;  1RQJ A;  4LFG A;  4WK5 A;  3WCI A;  4KPD A;  3VJB A;  5DJP F;  5I1U A;  3WCL A;  4LFV F;  5ILI A;  3NPR A;  2E94 A;  2Z4Y A;  4LZ0 A;  5A0J A;  3WSA A;  2QIS A;  5B01 A;  4RXC A;  3W7F A;  3AQC B;  3LK5 A;  4RYP A;  3NF2 A;  3RYE A;  3VJ9 A;  4H5C F;  3V1V A;  4EA2 A;  3SDT A;  4RXA A;  2E8U A;  1HXG A;  5ERO A;  5B0K A;  5DGS F;  4JXY A;  1YQ7 A;  3DYF A;  1DGP A;  2E95 A;  5EAU A;  3ICN A;  3N3D A;  4E1E A;  3Q1O A;  2AEL A;  1N22 A;  4LTV A;  4PVX F;  3KRO A;  3RYW A;  3P5P A;  3P8L A;  3LGK A;  4OMH A;  4GAX A;  1HM4 A;  3QQV A;  5IN8 A;  4KVD A;  3SDQ A;  4XQR F;  3N45 F;  2F9K F;  3N5H F;  2PS6 A;  3OAC A;  4RNQ A;  3IBA A;  1YYU A;  3Q2Q A;  3TC1 A;  4KQS A;  4ZQ8 A;  5ILK A;  5B00 A;  3EFQ A;  4JZB A;  4RXE A;  5CG6 A;  4L2X F;  3QKC A;  3LGZ B;  3ACW A;  4KWD A;  4LTZ A;  4XQS F;  3ZL6 A;  3WCD A;  3AQB B;  5DJV F;  3WCF A;  3N6K F;  5JUZ F;  4F6X A;  5ERN A;  4K10 A;  2FOR A;  2F7M F;  2E90 A;  1KIY A;  4H5E F;  3M00 A;  5JV2 F;  1YJ4 A;  3Q2Z A;  2H8O A;  4QPF A;  1N1Z A;  2PS8 A;  5B02 A;  1PS1 A;  4P0W A;  2Z4X A;  1RQI A;  2Z4V A;  3Q30 A;  1UBV A;  3N1V F;  4MC8 A;  4NG6 A;  2EWG A;  3WEI A;  2AZK A;  5DIQ F;  3LDW A;  2RAH A;  2E4O A;  3N46 F;  4F6V A;  1N21 A;  2E92 A;  4LLS A;  3IPI A;  3WEF A;  1UBY A;  3V1X A;  2J5C A;  2Z4W A;  2AET A;  2O1O A;  3AQ0 A;  4NFI F;  1FPS A;  3WCE A;  1VG6 A;  3WEH A;  1DI1 A;  2ZEV A;  3ICK A;  3P8R A;  5ER8 A;  3LG5 A;  1VG3 A;  2E8V A;  2Z52 A;  3SDV A;  3N5J F;  4NFJ F;  2AZL A;  4JYX A;  1V4K A;  2ZCQ A;  1WMW A;  3ADZ A;  5A0I A;  4XQT F;  2Z50 A;  3DYG A;  3N3L F;  4EA0 A;  5IMP A;  4E9U A;  3KRA B;  3OYR A;  3LLW A;  4LFE A;  1YYR A;  2DH4 A;  2OPN A;  3S4J A;  3WJO A;  4DI5 A;  1N1B A;  5ILJ A;  4N1Z F;  3TFP A;  4GA3 A;  3M0G A;  1YYS A;  2J1P A;  3LJI A;  3VJD A;  3WCB A;  3ICM A;  4PVY F;  2ZEU A;  5IKA A;  5DJR F;  4NKF A;  3LSN A;  1ZW5 A;  3AE0 A;  5DGN F;  2Q80 A;  5IMI A;  2FTZ A;  5AYP A;  3N0F A;  2OA6 A;  5IK9 A;  3WCM A;  5EAT A;  3M01 A;  3B7L A;  3G4F A;  4GP1 A;  4LZC A;  4MC0 A;  4H5D F;  5IMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...