3DYFA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-461 and isopentyl diphosphate
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
367
structure length
357
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FARNESYL PYROPHOSPHATE SYNTHASE
publication title Lipophilic bisphosphonates as dual farnesyl/geranylgeranyl diphosphate synthase inhibitors: an X-ray and NMR investigation.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 151
structure length 357
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2008-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3dyfA00
2ZEUA 5B0LA 4LPGF 1WL0A 2ZY1A 5ILKA 2PS7A 3CC9A 3KRFB 4KPDA 3ACXA 2OPNA 3ID0A 5JV2F 3IPIA 2QISA 3KRAB 3WEGA 3PDEA 4E1EA 5IK0A 4XQRF 4KUXA 2ZCRA 4LZ3A 5ILDA 2O1OA 3N45F 3KROA 5JA0F 3OABB 3TS7A 3V1XA 4GP2A 3LOMA 3WJNA 3WCAA 4LZ0A 4MC3A 4RXDA 3EFQA 3NRIA 2VF6A 5IVGA 5AHUB 5IMPA 3DYGA 1ZW5A 2E92A 3NF2A 1UBWA 2E8VA 4DEMF 2F92F 4P0XA 3ZMBA 2DH4A 3EZ3A 3VJ8A 3WCFA 2E8TA 2OPMA 5B0IA 4MC8A 3ICKA 2J1PA 5ERNA 4DHDA 3VJAA 3LK5A 5C05A 1VG7A 2OGDA 2E94A 3P8RA 2P1CA 4F62A 2Z7IA 3Q1OA 5EAUA 4GAXA 2AZJA 4N9UA 1WY0A 3VJEA 4Q23A 3KBKA 4KVYA 1N22A 2ONGA 4LTZA 1YQ7A 5ILJA 3DYFA 3N1WF 3WCCA 3VJCA 3N3LF 4MC0A 4NFIF 4KQSA 3B7LA 4OKMA 5DHIA 1FPSA 5B02A 3ASXA 3SDTA 1VG2A 1N1ZA 4KFAA 4WK5A 2F94F 5IL8A 1VG6A 4DWGA 5CG5A 4KQ5A 5DW7A 3KRFA 5I1UA 5HN8A 2ZCQA 1HXGA 4KPJA 2Z4VA 4F6XA 4H5DF 4F6VA 4JZBA 1EZFA 3N46F 4H5EF 2J1OA 1YHLA 1JFGA 2I19A 3P5PA 3RBMA 1WL2A 3WJKA 4DXJA 5EATA 1YV5A 3LJIA 1WL1A 2E91A 5DZ2A 3M9UA 4L2XF 3WC9A 2AEKA 2AZKA 3N3DA 3PKOA 5DHKA 3LZ9A 1V4EA 5DGNF 3S9VA 2E4OA 1HM7A 4EA2A 3PH7A 5B03A 3Q2QA 4JXNA 4OKZA 4DI5A 3CP6A 5ILYA 3KRPA 3KRCA 5CG6A 3N6KF 1YYQA 4QPFA 4RXEA 5E8LA 3WCLA 3RMGA 3TC1A 2Z7HA 1WMWA 2Z4YA 1KIYA 3P8LA 4LFGA 3M0GA 3AE0A 2J5CA 3TFNA 5JV0F 3DYHA 5A0JA 1WL3A 3ICMA 4OMGA 3LGZB 3WCJA 4LOBA 5E8KA 3WSAA 2PS4A 3LLWA 3P5RA 4KKMA 2Z52A 1HM4A 3MAVA 2FTZA 3N5HF 3ZCDA 2E8XA 1YJ4A 4RYPA 3ICNA 3N0FA 4OMHA 1DI1A 3G4FA 3LMDA 1JFAA 3OACA 2ZEVA 5ERMA 3ZL6A 4E9ZA 3ACYA 4LIXA 3VJBA 3M00A 3AQBB 3WCIA 3PYAA 3WEHA 3G4DA 5DGMF 3WJOA 1YYUA 1RTRA 1UBYA 3Q2ZA 3SDQA 1YHMA 3TFVA 3Q30A 4FJQA 1PS1A 1VG4A 1V4HA 3NPKA 3NPRA 5JV1F 5EROA 3LDWA 4HD1A 4LXWA 4JYXA 3WEFA 2PS8A 3BNYA 3WEIA 1HXCA 4P0WA 4H5CF 3WCEA 2Z4ZA 5JUZF 3KRAA 4NUAA 4OGUA 4LZCA 3IBAA 4LLSA 5IK9A 5DIQF 5A0IA 3ICZA 2EWGA 4LA5A 3WEJA 5DJRF 3WE9A 3OABA 4DZWA 3M01A 5B0MA 3VJ9A 3LSNA 2Q9YA 5IL3A 2ZCSA 1V4IA 3EGTA 2F7MF 5DJVF 5HN7A 2OA6A 2FORA 5ER8A 2PS5A 5H9DA 3S4JA 1N24A 4LA6A 4K10A 2Z4XA 4KQUA 4KVIA 5E8HA 3V66A 2E93A 4RXAA 1YYTA 4RXCA 4LUUA 4LFEA 2Z50A 4FP4A 3CKEA 1DGPA 4KK2A 3SDUA 4KWDA 5EASA 4LTVA 3APZA 4XQSF 5DGSF 5AFXA 3N5JF 3LVSA 2AELA 3M02A 2F89F 5IK6A 2E8WA 3WCBA 2F8ZF 4DWBA 3ADZA 5KSXF 2F8CF 5B0KA 3BNXA 3VJDA 4UMJA 2E8UA 2RAHA 2F9KF 4KVWA 4LPHF 1N23A 4JZXA 5IMNA 1N1BA 2AZLA 2E95A 4RNQA 4JVJF 1N21A 3ACWA 3RYEA 3SAEA 4GP1A 3W7FA 5IMIA 3LG5A 3ZMCA 5ILIA 3KROB 2Z4WA 3LGKA 4EA1A 3KRPB 4QXSF 3KRCB 3SDRA 2Q80A 4NFKF 4NKFA 4ZQ8A 1HXAA 3P41A 4PVXF 4LLTA 4KVDA 1UBVA 3QKCA 1YHKA 1RQIA 1V4KA 1N20A 2Q58A 3N1VF 3N49F 3SDVA 5HN9A 3AQ0A 4JXYA 1YYSA 4NKEA 3UCAA 5HNAA 2H8OA 3RYWA 4GA3A 5ILZA 1V4JA 2ONHA 3WCDA 4NFJF 4N1ZF 3AQCB 3WCHA 4P0VA 1WKZA 5IN8A 3QQVA 3OYRA 3KB9A 5AELA 5B0JA 5A0KA 1YYRA 3WEKA 2E90A 3OACB 2PS6A 1RQJA 1KIZA 3V1VA 4E9UA 4LFVF 4PVYF 3PYBA 1UBXA 3MZVA 5IKHA 5ILHA 5AYPA 5IKAA 3N0GA 3LEEA 1VG3A 2Q9ZA 2AETA 4NG6A 3ZOUA 4XQTF 3WSBA 5B01A 2ZCOA 5B00A 3WCGA 5IM1A 4EA0A 2Z78A 3WCMA 1HX9A 5DJPF 3TFPA
chains in the Genus database with same CATH superfamily
2ZEUA 5B0LA 4LPGF 1WL0A 2ZY1A 5ILKA 2PS7A 3CC9A 3KRFB 4KPDA 3ACXA 2OPNA 3ID0A 5JV2F 3IPIA 2QISA 3KRAB 3WEGA 3PDEA 4E1EA 5IK0A 4XQRF 4KUXA 2ZCRA 4LZ3A 5ILDA 2O1OA 3N45F 3KROA 5JA0F 3OABB 3TS7A 3V1XA 4GP2A 3LOMA 3WJNA 3WCAA 4LZ0A 4MC3A 4RXDA 3EFQA 3NRIA 2VF6A 5IVGA 5AHUB 5IMPA 3DYGA 1ZW5A 2E92A 3NF2A 1UBWA 2E8VA 4DEMF 2F92F 4P0XA 3ZMBA 2DH4A 3EZ3A 3VJ8A 3WCFA 2E8TA 2OPMA 5B0IA 4MC8A 3ICKA 2J1PA 5ERNA 4DHDA 3VJAA 3LK5A 5C05A 1VG7A 2OGDA 2E94A 3P8RA 2P1CA 4F62A 2Z7IA 3Q1OA 5EAUA 4GAXA 2AZJA 4N9UA 1WY0A 3VJEA 4Q23A 3KBKA 4KVYA 1N22A 2ONGA 4LTZA 1YQ7A 5ILJA 3DYFA 3N1WF 3WCCA 3VJCA 3N3LF 4MC0A 4NFIF 4KQSA 3B7LA 4OKMA 5DHIA 1FPSA 5B02A 3ASXA 3SDTA 1VG2A 1N1ZA 4KFAA 4WK5A 2F94F 5IL8A 1VG6A 4DWGA 5CG5A 4KQ5A 5DW7A 3KRFA 5I1UA 5HN8A 2ZCQA 1HXGA 4KPJA 2Z4VA 4F6XA 4H5DF 4F6VA 4JZBA 1EZFA 3N46F 4H5EF 2J1OA 1YHLA 1JFGA 2I19A 3P5PA 3RBMA 1WL2A 3WJKA 4DXJA 5EATA 1YV5A 3LJIA 1WL1A 2E91A 5DZ2A 3M9UA 4L2XF 3WC9A 2AEKA 2AZKA 3N3DA 3PKOA 5DHKA 3LZ9A 1V4EA 5DGNF 3S9VA 2E4OA 1HM7A 4EA2A 3PH7A 5B03A 3Q2QA 4JXNA 4OKZA 4DI5A 3CP6A 5ILYA 3KRPA 3KRCA 5CG6A 3N6KF 1YYQA 4QPFA 4RXEA 5E8LA 3WCLA 3RMGA 3TC1A 2Z7HA 1WMWA 2Z4YA 1KIYA 3P8LA 4LFGA 3M0GA 3AE0A 2J5CA 3TFNA 5JV0F 3DYHA 5A0JA 1WL3A 3ICMA 4OMGA 3LGZB 3WCJA 4LOBA 5E8KA 3WSAA 2PS4A 3LLWA 3P5RA 4KKMA 2Z52A 1HM4A 3MAVA 2FTZA 3N5HF 3ZCDA 2E8XA 1YJ4A 4RYPA 3ICNA 3N0FA 4OMHA 1DI1A 3G4FA 3LMDA 1JFAA 3OACA 2ZEVA 5ERMA 3ZL6A 4E9ZA 3ACYA 4LIXA 3VJBA 3M00A 3AQBB 3WCIA 3PYAA 3WEHA 3G4DA 5DGMF 3WJOA 1YYUA 1RTRA 1UBYA 3Q2ZA 3SDQA 1YHMA 3TFVA 3Q30A 4FJQA 1PS1A 1VG4A 1V4HA 3NPKA 3NPRA 5JV1F 5EROA 3LDWA 4HD1A 4LXWA 4JYXA 3WEFA 2PS8A 3BNYA 3WEIA 1HXCA 4P0WA 4H5CF 3WCEA 2Z4ZA 5JUZF 3KRAA 4NUAA 4OGUA 4LZCA 3IBAA 4LLSA 5IK9A 5DIQF 5A0IA 3ICZA 2EWGA 4LA5A 3WEJA 5DJRF 3WE9A 3OABA 4DZWA 3M01A 5B0MA 3VJ9A 3LSNA 2Q9YA 5IL3A 2ZCSA 1V4IA 3EGTA 2F7MF 5DJVF 5HN7A 2OA6A 2FORA 5ER8A 2PS5A 5H9DA 3S4JA 1N24A 4LA6A 4K10A 2Z4XA 4KQUA 4KVIA 5E8HA 3V66A 2E93A 4RXAA 1YYTA 4RXCA 4LUUA 4LFEA 2Z50A 4FP4A 3CKEA 1DGPA 4KK2A 3SDUA 4KWDA 5EASA 4LTVA 3APZA 4XQSF 5DGSF 5AFXA 3N5JF 3LVSA 2AELA 3M02A 2F89F 5IK6A 2E8WA 3WCBA 2F8ZF 4DWBA 3ADZA 5KSXF 2F8CF 5B0KA 3BNXA 3VJDA 4UMJA 2E8UA 2RAHA 2F9KF 4KVWA 4LPHF 1N23A 4JZXA 5IMNA 1N1BA 2AZLA 2E95A 4RNQA 4JVJF 1N21A 3ACWA 3RYEA 3SAEA 4GP1A 3W7FA 5IMIA 3LG5A 3ZMCA 5ILIA 3KROB 2Z4WA 3LGKA 4EA1A 3KRPB 4QXSF 3KRCB 3SDRA 2Q80A 4NFKF 4NKFA 4ZQ8A 1HXAA 3P41A 4PVXF 4LLTA 4KVDA 1UBVA 3QKCA 1YHKA 1RQIA 1V4KA 1N20A 2Q58A 3N1VF 3N49F 3SDVA 5HN9A 3AQ0A 4JXYA 1YYSA 4NKEA 3UCAA 5HNAA 2H8OA 3RYWA 4GA3A 5ILZA 1V4JA 2ONHA 3WCDA 4NFJF 4N1ZF 3AQCB 3WCHA 4P0VA 1WKZA 5IN8A 3QQVA 3OYRA 3KB9A 5AELA 5B0JA 5A0KA 1YYRA 3WEKA 2E90A 3OACB 2PS6A 1RQJA 1KIZA 3V1VA 4E9UA 4LFVF 4PVYF 3PYBA 1UBXA 3MZVA 5IKHA 5ILHA 5AYPA 5IKAA 3N0GA 3LEEA 1VG3A 2Q9ZA 2AETA 4NG6A 3ZOUA 4XQTF 3WSBA 5B01A 2ZCOA 5B00A 3WCGA 5IM1A 4EA0A 2Z78A 3WCMA 1HX9A 5DJPF 3TFPA
chains in the Genus database with same CATH topology
2ZEUA 5B0LA 4LPGF 1WL0A 2ZY1A 5ILKA 2PS7A 3CC9A 3KRFB 4KPDA 3ACXA 2OPNA 3ID0A 5JV2F 3IPIA 2QISA 3KRAB 3WEGA 3PDEA 4E1EA 5IK0A 4XQRF 4KUXA 2ZCRA 4LZ3A 5ILDA 2O1OA 3N45F 3KROA 5JA0F 3OABB 3TS7A 3V1XA 4GP2A 3LOMA 3WJNA 3WCAA 4LZ0A 4MC3A 4RXDA 3EFQA 3NRIA 2VF6A 5IVGA 5AHUB 5IMPA 3DYGA 1ZW5A 2E92A 3NF2A 1UBWA 2E8VA 4DEMF 2F92F 4P0XA 3ZMBA 2DH4A 3EZ3A 3VJ8A 3WCFA 2E8TA 2OPMA 5B0IA 4MC8A 3ICKA 2J1PA 5ERNA 4DHDA 3VJAA 3LK5A 5C05A 1VG7A 2OGDA 2E94A 3P8RA 2P1CA 4F62A 2Z7IA 3Q1OA 5EAUA 4GAXA 2AZJA 4N9UA 1WY0A 3VJEA 4Q23A 3KBKA 4KVYA 1N22A 2ONGA 4LTZA 1YQ7A 5ILJA 3DYFA 3N1WF 3WCCA 3VJCA 3N3LF 4MC0A 4NFIF 4KQSA 3B7LA 4OKMA 5DHIA 1FPSA 5B02A 3ASXA 3SDTA 1VG2A 1N1ZA 4KFAA 4WK5A 2F94F 5IL8A 1VG6A 4DWGA 5CG5A 4KQ5A 5DW7A 3KRFA 5I1UA 5HN8A 2ZCQA 1HXGA 4KPJA 2Z4VA 4F6XA 4H5DF 4F6VA 4JZBA 1EZFA 3N46F 4H5EF 2J1OA 1YHLA 1JFGA 2I19A 3P5PA 3RBMA 1WL2A 3WJKA 4DXJA 5EATA 1YV5A 3LJIA 1WL1A 2E91A 5DZ2A 3M9UA 4L2XF 3WC9A 2AEKA 2AZKA 3N3DA 3PKOA 5DHKA 3LZ9A 1V4EA 5DGNF 3S9VA 2E4OA 1HM7A 4EA2A 3PH7A 5B03A 3Q2QA 4JXNA 4OKZA 4DI5A 3CP6A 5ILYA 3KRPA 3KRCA 5CG6A 3N6KF 1YYQA 4QPFA 4RXEA 5E8LA 3WCLA 3RMGA 3TC1A 2Z7HA 1WMWA 2Z4YA 1KIYA 3P8LA 4LFGA 3M0GA 3AE0A 2J5CA 3TFNA 5JV0F 3DYHA 5A0JA 1WL3A 3ICMA 4OMGA 3LGZB 3WCJA 4LOBA 5E8KA 3WSAA 2PS4A 3LLWA 3P5RA 4KKMA 2Z52A 1HM4A 3MAVA 2FTZA 3N5HF 3ZCDA 2E8XA 1YJ4A 4RYPA 3ICNA 3N0FA 4OMHA 1DI1A 3G4FA 3LMDA 1JFAA 3OACA 2ZEVA 5ERMA 3ZL6A 4E9ZA 3ACYA 4LIXA 3VJBA 3M00A 3AQBB 3WCIA 3PYAA 3WEHA 3G4DA 5DGMF 3WJOA 1YYUA 1RTRA 1UBYA 3Q2ZA 3SDQA 1YHMA 3TFVA 3Q30A 4FJQA 1PS1A 1VG4A 1V4HA 3NPKA 3NPRA 5JV1F 5EROA 3LDWA 4HD1A 4LXWA 4JYXA 3WEFA 2PS8A 3BNYA 3WEIA 1HXCA 4P0WA 4H5CF 3WCEA 2Z4ZA 5JUZF 3KRAA 4NUAA 4OGUA 4LZCA 3IBAA 4LLSA 5IK9A 5DIQF 5A0IA 3ICZA 2EWGA 4LA5A 3WEJA 5DJRF 3WE9A 3OABA 4DZWA 3M01A 5B0MA 3VJ9A 3LSNA 2Q9YA 5IL3A 2ZCSA 1V4IA 3EGTA 2F7MF 5DJVF 5HN7A 2OA6A 2FORA 5ER8A 2PS5A 5H9DA 3S4JA 1N24A 4LA6A 4K10A 2Z4XA 4KQUA 4KVIA 5E8HA 3V66A 2E93A 4RXAA 1YYTA 4RXCA 4LUUA 4LFEA 2Z50A 4FP4A 3CKEA 1DGPA 4KK2A 3SDUA 4KWDA 5EASA 4LTVA 3APZA 4XQSF 5DGSF 5AFXA 3N5JF 3LVSA 2AELA 3M02A 2F89F 5IK6A 2E8WA 3WCBA 2F8ZF 4DWBA 3ADZA 5KSXF 2F8CF 5B0KA 3BNXA 3VJDA 4UMJA 2E8UA 2RAHA 2F9KF 4KVWA 4LPHF 1N23A 4JZXA 5IMNA 1N1BA 2AZLA 2E95A 4RNQA 4JVJF 1N21A 3ACWA 3RYEA 3SAEA 4GP1A 3W7FA 5IMIA 3LG5A 3ZMCA 5ILIA 3KROB 2Z4WA 3LGKA 4EA1A 3KRPB 4QXSF 3KRCB 3SDRA 2Q80A 4NFKF 4NKFA 4ZQ8A 1HXAA 3P41A 4PVXF 4LLTA 4KVDA 1UBVA 3QKCA 1YHKA 1RQIA 1V4KA 1N20A 2Q58A 3N1VF 3N49F 3SDVA 5HN9A 3AQ0A 4JXYA 1YYSA 4NKEA 3UCAA 5HNAA 2H8OA 3RYWA 4GA3A 5ILZA 1V4JA 2ONHA 3WCDA 4NFJF 4N1ZF 3AQCB 3WCHA 4P0VA 1WKZA 5IN8A 3QQVA 3OYRA 3KB9A 5AELA 5B0JA 5A0KA 1YYRA 3WEKA 2E90A 3OACB 2PS6A 1RQJA 1KIZA 3V1VA 4E9UA 4LFVF 4PVYF 3PYBA 1UBXA 3MZVA 5IKHA 5ILHA 5AYPA 5IKAA 3N0GA 3LEEA 1VG3A 2Q9ZA 2AETA 4NG6A 3ZOUA 4XQTF 3WSBA 5B01A 2ZCOA 5B00A 3WCGA 5IM1A 4EA0A 2Z78A 3WCMA 1HX9A 5DJPF 3TFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEU A;  5B0L A;  4LPG F;  1WL0 A;  2ZY1 A;  5ILK A;  2PS7 A;  3CC9 A;  3KRF B;  4KPD A;  3ACX A;  2OPN A;  3ID0 A;  5JV2 F;  3IPI A;  2QIS A;  3KRA B;  3WEG A;  3PDE A;  4E1E A;  5IK0 A;  4XQR F;  4KUX A;  2ZCR A;  4LZ3 A;  5ILD A;  2O1O A;  3N45 F;  3KRO A;  5JA0 F;  3OAB B;  3TS7 A;  3V1X A;  4GP2 A;  3LOM A;  3WJN A;  3WCA A;  4LZ0 A;  4MC3 A;  4RXD A;  3EFQ A;  3NRI A;  2VF6 A;  5IVG A;  5AHU B;  5IMP A;  3DYG A;  1ZW5 A;  2E92 A;  3NF2 A;  1UBW A;  2E8V A;  4DEM F;  2F92 F;  4P0X A;  3ZMB A;  2DH4 A;  3EZ3 A;  3VJ8 A;  3WCF A;  2E8T A;  2OPM A;  5B0I A;  4MC8 A;  3ICK A;  2J1P A;  5ERN A;  4DHD A;  3VJA A;  3LK5 A;  5C05 A;  1VG7 A;  2OGD A;  2E94 A;  3P8R A;  2P1C A;  4F62 A;  2Z7I A;  3Q1O A;  5EAU A;  4GAX A;  2AZJ A;  4N9U A;  1WY0 A;  3VJE A;  4Q23 A;  3KBK A;  4KVY A;  1N22 A;  2ONG A;  4LTZ A;  1YQ7 A;  5ILJ A;  3DYF A;  3N1W F;  3WCC A;  3VJC A;  3N3L F;  4MC0 A;  4NFI F;  4KQS A;  3B7L A;  4OKM A;  5DHI A;  1FPS A;  5B02 A;  3ASX A;  3SDT A;  1VG2 A;  1N1Z A;  4KFA A;  4WK5 A;  2F94 F;  5IL8 A;  1VG6 A;  4DWG A;  5CG5 A;  4KQ5 A;  5DW7 A;  3KRF A;  5I1U A;  5HN8 A;  2ZCQ A;  1HXG A;  4KPJ A;  2Z4V A;  4F6X A;  4H5D F;  4F6V A;  4JZB A;  1EZF A;  3N46 F;  4H5E F;  2J1O A;  1YHL A;  1JFG A;  2I19 A;  3P5P A;  3RBM A;  1WL2 A;  3WJK A;  4DXJ A;  5EAT A;  1YV5 A;  3LJI A;  1WL1 A;  2E91 A;  5DZ2 A;  3M9U A;  4L2X F;  3WC9 A;  2AEK A;  2AZK A;  3N3D A;  3PKO A;  5DHK A;  3LZ9 A;  1V4E A;  5DGN F;  3S9V A;  2E4O A;  1HM7 A;  4EA2 A;  3PH7 A;  5B03 A;  3Q2Q A;  4JXN A;  4OKZ A;  4DI5 A;  3CP6 A;  5ILY A;  3KRP A;  3KRC A;  5CG6 A;  3N6K F;  1YYQ A;  4QPF A;  4RXE A;  5E8L A;  3WCL A;  3RMG A;  3TC1 A;  2Z7H A;  1WMW A;  2Z4Y A;  1KIY A;  3P8L A;  4LFG A;  3M0G A;  3AE0 A;  2J5C A;  3TFN A;  5JV0 F;  3DYH A;  5A0J A;  1WL3 A;  3ICM A;  4OMG A;  3LGZ B;  3WCJ A;  4LOB A;  5E8K A;  3WSA A;  2PS4 A;  3LLW A;  3P5R A;  4KKM A;  2Z52 A;  1HM4 A;  3MAV A;  2FTZ A;  3N5H F;  3ZCD A;  2E8X A;  1YJ4 A;  4RYP A;  3ICN A;  3N0F A;  4OMH A;  1DI1 A;  3G4F A;  3LMD A;  1JFA A;  3OAC A;  2ZEV A;  5ERM A;  3ZL6 A;  4E9Z A;  3ACY A;  4LIX A;  3VJB A;  3M00 A;  3AQB B;  3WCI A;  3PYA A;  3WEH A;  3G4D A;  5DGM F;  3WJO A;  1YYU A;  1RTR A;  1UBY A;  3Q2Z A;  3SDQ A;  1YHM A;  3TFV A;  3Q30 A;  4FJQ A;  1PS1 A;  1VG4 A;  1V4H A;  3NPK A;  3NPR A;  5JV1 F;  5ERO A;  3LDW A;  4HD1 A;  4LXW A;  4JYX A;  3WEF A;  2PS8 A;  3BNY A;  3WEI A;  1HXC A;  4P0W A;  4H5C F;  3WCE A;  2Z4Z A;  5JUZ F;  3KRA A;  4NUA A;  4OGU A;  4LZC A;  3IBA A;  4LLS A;  5IK9 A;  5DIQ F;  5A0I A;  3ICZ A;  2EWG A;  4LA5 A;  3WEJ A;  5DJR F;  3WE9 A;  3OAB A;  4DZW A;  3M01 A;  5B0M A;  3VJ9 A;  3LSN A;  2Q9Y A;  5IL3 A;  2ZCS A;  1V4I A;  3EGT A;  2F7M F;  5DJV F;  5HN7 A;  2OA6 A;  2FOR A;  5ER8 A;  2PS5 A;  5H9D A;  3S4J A;  1N24 A;  4LA6 A;  4K10 A;  2Z4X A;  4KQU A;  4KVI A;  5E8H A;  3V66 A;  2E93 A;  4RXA A;  1YYT A;  4RXC A;  4LUU A;  4LFE A;  2Z50 A;  4FP4 A;  3CKE A;  1DGP A;  4KK2 A;  3SDU A;  4KWD A;  5EAS A;  4LTV A;  3APZ A;  4XQS F;  5DGS F;  5AFX A;  3N5J F;  3LVS A;  2AEL A;  3M02 A;  2F89 F;  5IK6 A;  2E8W A;  3WCB A;  2F8Z F;  4DWB A;  3ADZ A;  5KSX F;  2F8C F;  5B0K A;  3BNX A;  3VJD A;  4UMJ A;  2E8U A;  2RAH A;  2F9K F;  4KVW A;  4LPH F;  1N23 A;  4JZX A;  5IMN A;  1N1B A;  2AZL A;  2E95 A;  4RNQ A;  4JVJ F;  1N21 A;  3ACW A;  3RYE A;  3SAE A;  4GP1 A;  3W7F A;  5IMI A;  3LG5 A;  3ZMC A;  5ILI A;  3KRO B;  2Z4W A;  3LGK A;  4EA1 A;  3KRP B;  4QXS F;  3KRC B;  3SDR A;  2Q80 A;  4NFK F;  4NKF A;  4ZQ8 A;  1HXA A;  3P41 A;  4PVX F;  4LLT A;  4KVD A;  1UBV A;  3QKC A;  1YHK A;  1RQI A;  1V4K A;  1N20 A;  2Q58 A;  3N1V F;  3N49 F;  3SDV A;  5HN9 A;  3AQ0 A;  4JXY A;  1YYS A;  4NKE A;  3UCA A;  5HNA A;  2H8O A;  3RYW A;  4GA3 A;  5ILZ A;  1V4J A;  2ONH A;  3WCD A;  4NFJ F;  4N1Z F;  3AQC B;  3WCH A;  4P0V A;  1WKZ A;  5IN8 A;  3QQV A;  3OYR A;  3KB9 A;  5AEL A;  5B0J A;  5A0K A;  1YYR A;  3WEK A;  2E90 A;  3OAC B;  2PS6 A;  1RQJ A;  1KIZ A;  3V1V A;  4E9U A;  4LFV F;  4PVY F;  3PYB A;  1UBX A;  3MZV A;  5IKH A;  5ILH A;  5AYP A;  5IKA A;  3N0G A;  3LEE A;  1VG3 A;  2Q9Z A;  2AET A;  4NG6 A;  3ZOU A;  4XQT F;  3WSB A;  5B01 A;  2ZCO A;  5B00 A;  3WCG A;  5IM1 A;  4EA0 A;  2Z78 A;  3WCM A;  1HX9 A;  5DJP F;  3TFP A; 
#chains in the Genus database with same CATH topology
 2ZEU A;  5B0L A;  4LPG F;  1WL0 A;  2ZY1 A;  5ILK A;  2PS7 A;  3CC9 A;  3KRF B;  4KPD A;  3ACX A;  2OPN A;  3ID0 A;  5JV2 F;  3IPI A;  2QIS A;  3KRA B;  3WEG A;  3PDE A;  4E1E A;  5IK0 A;  4XQR F;  4KUX A;  2ZCR A;  4LZ3 A;  5ILD A;  2O1O A;  3N45 F;  3KRO A;  5JA0 F;  3OAB B;  3TS7 A;  3V1X A;  4GP2 A;  3LOM A;  3WJN A;  3WCA A;  4LZ0 A;  4MC3 A;  4RXD A;  3EFQ A;  3NRI A;  2VF6 A;  5IVG A;  5AHU B;  5IMP A;  3DYG A;  1ZW5 A;  2E92 A;  3NF2 A;  1UBW A;  2E8V A;  4DEM F;  2F92 F;  4P0X A;  3ZMB A;  2DH4 A;  3EZ3 A;  3VJ8 A;  3WCF A;  2E8T A;  2OPM A;  5B0I A;  4MC8 A;  3ICK A;  2J1P A;  5ERN A;  4DHD A;  3VJA A;  3LK5 A;  5C05 A;  1VG7 A;  2OGD A;  2E94 A;  3P8R A;  2P1C A;  4F62 A;  2Z7I A;  3Q1O A;  5EAU A;  4GAX A;  2AZJ A;  4N9U A;  1WY0 A;  3VJE A;  4Q23 A;  3KBK A;  4KVY A;  1N22 A;  2ONG A;  4LTZ A;  1YQ7 A;  5ILJ A;  3DYF A;  3N1W F;  3WCC A;  3VJC A;  3N3L F;  4MC0 A;  4NFI F;  4KQS A;  3B7L A;  4OKM A;  5DHI A;  1FPS A;  5B02 A;  3ASX A;  3SDT A;  1VG2 A;  1N1Z A;  4KFA A;  4WK5 A;  2F94 F;  5IL8 A;  1VG6 A;  4DWG A;  5CG5 A;  4KQ5 A;  5DW7 A;  3KRF A;  5I1U A;  5HN8 A;  2ZCQ A;  1HXG A;  4KPJ A;  2Z4V A;  4F6X A;  4H5D F;  4F6V A;  4JZB A;  1EZF A;  3N46 F;  4H5E F;  2J1O A;  1YHL A;  1JFG A;  2I19 A;  3P5P A;  3RBM A;  1WL2 A;  3WJK A;  4DXJ A;  5EAT A;  1YV5 A;  3LJI A;  1WL1 A;  2E91 A;  5DZ2 A;  3M9U A;  4L2X F;  3WC9 A;  2AEK A;  2AZK A;  3N3D A;  3PKO A;  5DHK A;  3LZ9 A;  1V4E A;  5DGN F;  3S9V A;  2E4O A;  1HM7 A;  4EA2 A;  3PH7 A;  5B03 A;  3Q2Q A;  4JXN A;  4OKZ A;  4DI5 A;  3CP6 A;  5ILY A;  3KRP A;  3KRC A;  5CG6 A;  3N6K F;  1YYQ A;  4QPF A;  4RXE A;  5E8L A;  3WCL A;  3RMG A;  3TC1 A;  2Z7H A;  1WMW A;  2Z4Y A;  1KIY A;  3P8L A;  4LFG A;  3M0G A;  3AE0 A;  2J5C A;  3TFN A;  5JV0 F;  3DYH A;  5A0J A;  1WL3 A;  3ICM A;  4OMG A;  3LGZ B;  3WCJ A;  4LOB A;  5E8K A;  3WSA A;  2PS4 A;  3LLW A;  3P5R A;  4KKM A;  2Z52 A;  1HM4 A;  3MAV A;  2FTZ A;  3N5H F;  3ZCD A;  2E8X A;  1YJ4 A;  4RYP A;  3ICN A;  3N0F A;  4OMH A;  1DI1 A;  3G4F A;  3LMD A;  1JFA A;  3OAC A;  2ZEV A;  5ERM A;  3ZL6 A;  4E9Z A;  3ACY A;  4LIX A;  3VJB A;  3M00 A;  3AQB B;  3WCI A;  3PYA A;  3WEH A;  3G4D A;  5DGM F;  3WJO A;  1YYU A;  1RTR A;  1UBY A;  3Q2Z A;  3SDQ A;  1YHM A;  3TFV A;  3Q30 A;  4FJQ A;  1PS1 A;  1VG4 A;  1V4H A;  3NPK A;  3NPR A;  5JV1 F;  5ERO A;  3LDW A;  4HD1 A;  4LXW A;  4JYX A;  3WEF A;  2PS8 A;  3BNY A;  3WEI A;  1HXC A;  4P0W A;  4H5C F;  3WCE A;  2Z4Z A;  5JUZ F;  3KRA A;  4NUA A;  4OGU A;  4LZC A;  3IBA A;  4LLS A;  5IK9 A;  5DIQ F;  5A0I A;  3ICZ A;  2EWG A;  4LA5 A;  3WEJ A;  5DJR F;  3WE9 A;  3OAB A;  4DZW A;  3M01 A;  5B0M A;  3VJ9 A;  3LSN A;  2Q9Y A;  5IL3 A;  2ZCS A;  1V4I A;  3EGT A;  2F7M F;  5DJV F;  5HN7 A;  2OA6 A;  2FOR A;  5ER8 A;  2PS5 A;  5H9D A;  3S4J A;  1N24 A;  4LA6 A;  4K10 A;  2Z4X A;  4KQU A;  4KVI A;  5E8H A;  3V66 A;  2E93 A;  4RXA A;  1YYT A;  4RXC A;  4LUU A;  4LFE A;  2Z50 A;  4FP4 A;  3CKE A;  1DGP A;  4KK2 A;  3SDU A;  4KWD A;  5EAS A;  4LTV A;  3APZ A;  4XQS F;  5DGS F;  5AFX A;  3N5J F;  3LVS A;  2AEL A;  3M02 A;  2F89 F;  5IK6 A;  2E8W A;  3WCB A;  2F8Z F;  4DWB A;  3ADZ A;  5KSX F;  2F8C F;  5B0K A;  3BNX A;  3VJD A;  4UMJ A;  2E8U A;  2RAH A;  2F9K F;  4KVW A;  4LPH F;  1N23 A;  4JZX A;  5IMN A;  1N1B A;  2AZL A;  2E95 A;  4RNQ A;  4JVJ F;  1N21 A;  3ACW A;  3RYE A;  3SAE A;  4GP1 A;  3W7F A;  5IMI A;  3LG5 A;  3ZMC A;  5ILI A;  3KRO B;  2Z4W A;  3LGK A;  4EA1 A;  3KRP B;  4QXS F;  3KRC B;  3SDR A;  2Q80 A;  4NFK F;  4NKF A;  4ZQ8 A;  1HXA A;  3P41 A;  4PVX F;  4LLT A;  4KVD A;  1UBV A;  3QKC A;  1YHK A;  1RQI A;  1V4K A;  1N20 A;  2Q58 A;  3N1V F;  3N49 F;  3SDV A;  5HN9 A;  3AQ0 A;  4JXY A;  1YYS A;  4NKE A;  3UCA A;  5HNA A;  2H8O A;  3RYW A;  4GA3 A;  5ILZ A;  1V4J A;  2ONH A;  3WCD A;  4NFJ F;  4N1Z F;  3AQC B;  3WCH A;  4P0V A;  1WKZ A;  5IN8 A;  3QQV A;  3OYR A;  3KB9 A;  5AEL A;  5B0J A;  5A0K A;  1YYR A;  3WEK A;  2E90 A;  3OAC B;  2PS6 A;  1RQJ A;  1KIZ A;  3V1V A;  4E9U A;  4LFV F;  4PVY F;  3PYB A;  1UBX A;  3MZV A;  5IKH A;  5ILH A;  5AYP A;  5IKA A;  3N0G A;  3LEE A;  1VG3 A;  2Q9Z A;  2AET A;  4NG6 A;  3ZOU A;  4XQT F;  3WSB A;  5B01 A;  2ZCO A;  5B00 A;  3WCG A;  5IM1 A;  4EA0 A;  2Z78 A;  3WCM A;  1HX9 A;  5DJP F;  3TFP A; 
#chains in the Genus database with same CATH homology
 2ZEU A;  5B0L A;  4LPG F;  1WL0 A;  2ZY1 A;  5ILK A;  2PS7 A;  3CC9 A;  3KRF B;  4KPD A;  3ACX A;  2OPN A;  3ID0 A;  5JV2 F;  3IPI A;  2QIS A;  3KRA B;  3WEG A;  3PDE A;  4E1E A;  5IK0 A;  4XQR F;  4KUX A;  2ZCR A;  4LZ3 A;  5ILD A;  2O1O A;  3N45 F;  3KRO A;  5JA0 F;  3OAB B;  3TS7 A;  3V1X A;  4GP2 A;  3LOM A;  3WJN A;  3WCA A;  4LZ0 A;  4MC3 A;  4RXD A;  3EFQ A;  3NRI A;  2VF6 A;  5IVG A;  5AHU B;  5IMP A;  3DYG A;  1ZW5 A;  2E92 A;  3NF2 A;  1UBW A;  2E8V A;  4DEM F;  2F92 F;  4P0X A;  3ZMB A;  2DH4 A;  3EZ3 A;  3VJ8 A;  3WCF A;  2E8T A;  2OPM A;  5B0I A;  4MC8 A;  3ICK A;  2J1P A;  5ERN A;  4DHD A;  3VJA A;  3LK5 A;  5C05 A;  1VG7 A;  2OGD A;  2E94 A;  3P8R A;  2P1C A;  4F62 A;  2Z7I A;  3Q1O A;  5EAU A;  4GAX A;  2AZJ A;  4N9U A;  1WY0 A;  3VJE A;  4Q23 A;  3KBK A;  4KVY A;  1N22 A;  2ONG A;  4LTZ A;  1YQ7 A;  5ILJ A;  3DYF A;  3N1W F;  3WCC A;  3VJC A;  3N3L F;  4MC0 A;  4NFI F;  4KQS A;  3B7L A;  4OKM A;  5DHI A;  1FPS A;  5B02 A;  3ASX A;  3SDT A;  1VG2 A;  1N1Z A;  4KFA A;  4WK5 A;  2F94 F;  5IL8 A;  1VG6 A;  4DWG A;  5CG5 A;  4KQ5 A;  5DW7 A;  3KRF A;  5I1U A;  5HN8 A;  2ZCQ A;  1HXG A;  4KPJ A;  2Z4V A;  4F6X A;  4H5D F;  4F6V A;  4JZB A;  1EZF A;  3N46 F;  4H5E F;  2J1O A;  1YHL A;  1JFG A;  2I19 A;  3P5P A;  3RBM A;  1WL2 A;  3WJK A;  4DXJ A;  5EAT A;  1YV5 A;  3LJI A;  1WL1 A;  2E91 A;  5DZ2 A;  3M9U A;  4L2X F;  3WC9 A;  2AEK A;  2AZK A;  3N3D A;  3PKO A;  5DHK A;  3LZ9 A;  1V4E A;  5DGN F;  3S9V A;  2E4O A;  1HM7 A;  4EA2 A;  3PH7 A;  5B03 A;  3Q2Q A;  4JXN A;  4OKZ A;  4DI5 A;  3CP6 A;  5ILY A;  3KRP A;  3KRC A;  5CG6 A;  3N6K F;  1YYQ A;  4QPF A;  4RXE A;  5E8L A;  3WCL A;  3RMG A;  3TC1 A;  2Z7H A;  1WMW A;  2Z4Y A;  1KIY A;  3P8L A;  4LFG A;  3M0G A;  3AE0 A;  2J5C A;  3TFN A;  5JV0 F;  3DYH A;  5A0J A;  1WL3 A;  3ICM A;  4OMG A;  3LGZ B;  3WCJ A;  4LOB A;  5E8K A;  3WSA A;  2PS4 A;  3LLW A;  3P5R A;  4KKM A;  2Z52 A;  1HM4 A;  3MAV A;  2FTZ A;  3N5H F;  3ZCD A;  2E8X A;  1YJ4 A;  4RYP A;  3ICN A;  3N0F A;  4OMH A;  1DI1 A;  3G4F A;  3LMD A;  1JFA A;  3OAC A;  2ZEV A;  5ERM A;  3ZL6 A;  4E9Z A;  3ACY A;  4LIX A;  3VJB A;  3M00 A;  3AQB B;  3WCI A;  3PYA A;  3WEH A;  3G4D A;  5DGM F;  3WJO A;  1YYU A;  1RTR A;  1UBY A;  3Q2Z A;  3SDQ A;  1YHM A;  3TFV A;  3Q30 A;  4FJQ A;  1PS1 A;  1VG4 A;  1V4H A;  3NPK A;  3NPR A;  5JV1 F;  5ERO A;  3LDW A;  4HD1 A;  4LXW A;  4JYX A;  3WEF A;  2PS8 A;  3BNY A;  3WEI A;  1HXC A;  4P0W A;  4H5C F;  3WCE A;  2Z4Z A;  5JUZ F;  3KRA A;  4NUA A;  4OGU A;  4LZC A;  3IBA A;  4LLS A;  5IK9 A;  5DIQ F;  5A0I A;  3ICZ A;  2EWG A;  4LA5 A;  3WEJ A;  5DJR F;  3WE9 A;  3OAB A;  4DZW A;  3M01 A;  5B0M A;  3VJ9 A;  3LSN A;  2Q9Y A;  5IL3 A;  2ZCS A;  1V4I A;  3EGT A;  2F7M F;  5DJV F;  5HN7 A;  2OA6 A;  2FOR A;  5ER8 A;  2PS5 A;  5H9D A;  3S4J A;  1N24 A;  4LA6 A;  4K10 A;  2Z4X A;  4KQU A;  4KVI A;  5E8H A;  3V66 A;  2E93 A;  4RXA A;  1YYT A;  4RXC A;  4LUU A;  4LFE A;  2Z50 A;  4FP4 A;  3CKE A;  1DGP A;  4KK2 A;  3SDU A;  4KWD A;  5EAS A;  4LTV A;  3APZ A;  4XQS F;  5DGS F;  5AFX A;  3N5J F;  3LVS A;  2AEL A;  3M02 A;  2F89 F;  5IK6 A;  2E8W A;  3WCB A;  2F8Z F;  4DWB A;  3ADZ A;  5KSX F;  2F8C F;  5B0K A;  3BNX A;  3VJD A;  4UMJ A;  2E8U A;  2RAH A;  2F9K F;  4KVW A;  4LPH F;  1N23 A;  4JZX A;  5IMN A;  1N1B A;  2AZL A;  2E95 A;  4RNQ A;  4JVJ F;  1N21 A;  3ACW A;  3RYE A;  3SAE A;  4GP1 A;  3W7F A;  5IMI A;  3LG5 A;  3ZMC A;  5ILI A;  3KRO B;  2Z4W A;  3LGK A;  4EA1 A;  3KRP B;  4QXS F;  3KRC B;  3SDR A;  2Q80 A;  4NFK F;  4NKF A;  4ZQ8 A;  1HXA A;  3P41 A;  4PVX F;  4LLT A;  4KVD A;  1UBV A;  3QKC A;  1YHK A;  1RQI A;  1V4K A;  1N20 A;  2Q58 A;  3N1V F;  3N49 F;  3SDV A;  5HN9 A;  3AQ0 A;  4JXY A;  1YYS A;  4NKE A;  3UCA A;  5HNA A;  2H8O A;  3RYW A;  4GA3 A;  5ILZ A;  1V4J A;  2ONH A;  3WCD A;  4NFJ F;  4N1Z F;  3AQC B;  3WCH A;  4P0V A;  1WKZ A;  5IN8 A;  3QQV A;  3OYR A;  3KB9 A;  5AEL A;  5B0J A;  5A0K A;  1YYR A;  3WEK A;  2E90 A;  3OAC B;  2PS6 A;  1RQJ A;  1KIZ A;  3V1V A;  4E9U A;  4LFV F;  4PVY F;  3PYB A;  1UBX A;  3MZV A;  5IKH A;  5ILH A;  5AYP A;  5IKA A;  3N0G A;  3LEE A;  1VG3 A;  2Q9Z A;  2AET A;  4NG6 A;  3ZOU A;  4XQT F;  3WSB A;  5B01 A;  2ZCO A;  5B00 A;  3WCG A;  5IM1 A;  4EA0 A;  2Z78 A;  3WCM A;  1HX9 A;  5DJP F;  3TFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...