3DYFA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-461 and isopentyl diphosphate
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
367
structure length
357
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FARNESYL PYROPHOSPHATE SYNTHASE
publication title Lipophilic bisphosphonates as dual farnesyl/geranylgeranyl diphosphate synthase inhibitors: an X-ray and NMR investigation.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 151
structure length 357
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2008-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3dyfA00
3APZA 4LTZA 1YYUA 2I19A 1V4HA 1YYSA 3ACWA 4P0XA 4KQUA 5HN9A 3Q2QA 3TFNA 3NPRA 4GP2A 2Q58A 3ZMBA 3N0FA 3S9VA 4E1EA 1N21A 3B7LA 3N0GA 4Q23A 4RXCA 4JZBA 3SDQA 3M01A 5CG5A 3N45F 4H5EF 4QXSF 4FJQA 3PYAA 1VG6A 2J1PA 3LLWA 1N20A 4F6XA 2E8XA 3BNYA 1WKZA 5DHKA 4XQTF 5E8KA 2VF6A 3VJAA 2F94F 5EROA 4KKMA 1YQ7A 2E4OA 2DH4A 3WEIA 3ASXA 5KSXF 4XQRF 5B0JA 1WY0A 1VG7A 1YHMA 3WCGA 3G4FA 2F7MF 4LXWA 2E95A 3EFQA 4KVYA 1FPSA 2E90A 3PH7A 4RXEA 3ICMA 1YYQA 3WJNA 5DGNF 2E91A 3Q2ZA 5ILZA 3QKCA 4K10A 5C05A 4LOBA 4DWBA 1V4KA 3WCCA 3BNXA 2Z4XA 4OKZA 4KVWA 5EATA 1N1ZA 3ACXA 4EA1A 2Z4VA 2PS4A 5ERNA 3AE0A 3OABB 3TC1A 5IMNA 3WCMA 3ICKA 1HM4A 3UCAA 2F92F 2O1OA 4GP1A 4XQSF 4DHDA 5E8HA 3OABA 3KRPB 3ZL6A 2P1CA 4P0VA 4F6VA 4E9UA 2RAHA 3Q1OA 3KRPA 3N46F 5IK0A 3ICNA 2Q9ZA 4KFAA 5B01A 3LSNA 3P8RA 4LFVF 3RYEA 1V4JA 3WCEA 4P0WA 2ONGA 2OPNA 1N24A 2ZEVA 5ILYA 5DJVF 5IM1A 5IMIA 3PYBA 3WEJA 1HXCA 1UBVA 3LJIA 1N1BA 5ERMA 2ZCQA 5HNAA 1DGPA 1UBYA 3AQ0A 3WCDA 4LFGA 5IKHA 2ZEUA 5B0KA 3M02A 4RYPA 2OPMA 5H9DA 3TFPA 5JA0F 4MC0A 4WK5A 3CC9A 5B0MA 3WJOA 2AETA 4KUXA 4NG6A 3EZ3A 2Z4WA 3LEEA 2AZJA 2AEKA 3OYRA 3ACYA 2OGDA 2Z52A 5AHUB 5IKAA 1DI1A 2J5CA 3WCIA 4KPJA 3WJKA 1EZFA 4H5CF 2Z7IA 3P5RA 2Z78A 1HM7A 3IPIA 4RNQA 5EASA 3RBMA 2Z4ZA 3SDTA 3LDWA 1YYTA 2FORA 5B03A 5ILIA 3WCAA 2ZCSA 3V1VA 3VJDA 3ZOUA 4NUAA 3IBAA 1RQJA 1WL3A 3MZVA 3VJ9A 5B0LA 3WEGA 4OMGA 3WCBA 3KB9A 3WEFA 2ZCRA 1WL0A 3N6KF 5DJPF 2ONHA 5ILJA 2EWGA 1HXGA 3WCHA 2E8TA 3KRAB 5JV0F 4N9UA 4KVDA 1VG4A 1VG3A 4JXNA 3NF2A 4KPDA 2PS7A 3Q30A 2F8CF 3AQCB 4RXDA 2F89F 3KRAA 3ID0A 1YJ4A 3P5PA 4LUUA 3N1WF 4NKEA 5JV2F 4KWDA 4E9ZA 4N1ZF 3WCFA 2E94A 5ILDA 5DIQF 4LZ3A 2Q9YA 3WCLA 2Z7HA 3AQBB 1WMWA 5IL8A 3N3DA 4KVIA 3PKOA 2PS5A 4LTVA 4DEMF 3WC9A 4UMJA 5B00A 2J1OA 3DYHA 2OA6A 2E8WA 4NKFA 2FTZA 4LFEA 5A0KA 4OMHA 1WL2A 4KQ5A 1KIZA 4ZQ8A 1WL1A 3EGTA 1V4EA 1VG2A 5DJRF 3OACB 2ZY1A 5I1UA 4OGUA 5IL3A 3KRCB 2Z4YA 4LPGF 3LMDA 4EA0A 2PS8A 1JFGA 3DYFA 1V4IA 1YHLA 3OACA 5EAUA 3LZ9A 5DZ2A 5ER8A 5HN8A 4KQSA 3KRCA 3V1XA 2Z50A 5DW7A 4DI5A 3WEHA 3W7FA 4L2XF 4JXYA 5DHIA 5AFXA 3TS7A 4F62A 5IK6A 4HD1A 3CKEA 1UBXA 2QISA 4LZCA 5E8LA 3SDUA 2E92A 4LA5A 3ICZA 3SDVA 1JFAA 5DGSF 4GA3A 3M00A 2AELA 3S4JA 3M9UA 1YYRA 1RTRA 3V66A 3KBKA 4DZWA 5B02A 4LLTA 4MC3A 3LGKA 1RQIA 3QQVA 5IVGA 5DGMF 1UBWA 3ZCDA 5IK9A 5IMPA 3CP6A 3VJ8A 3N3LF 2E8UA 4NFIF 1YHKA 3MAVA 4LPHF 3LG5A 4QPFA 4NFKF 3WSBA 5HN7A 1N22A 4LA6A 3WE9A 5IN8A 4FP4A 3ZMCA 3VJCA 3N5JF 5A0IA 2F8ZF 3KROB 5ILHA 3NRIA 2E8VA 1HXAA 3ADZA 4PVXF 3PDEA 3P8LA 3LGZB 5AELA 3N5HF 1HX9A 2H8OA 3RMGA 4EA2A 3KROA 2F9KF 2E93A 3TFVA 4GAXA 3RYWA 5CG6A 2Q80A 4LLSA 3N49F 4PVYF 5JUZF 3SDRA 4NFJF 2AZKA 1ZW5A 4JZXA 3VJBA 4MC8A 1PS1A 4H5DF 2AZLA 5A0JA 3VJEA 3M0GA 1KIYA 4JYXA 5AYPA 5JV1F 2ZCOA 3LVSA 3P41A 3SAEA 3WCJA 1YV5A 3N1VF 3LOMA 4DWGA 4DXJA 3WSAA 2PS6A 3KRFB 5ILKA 1N23A 4KK2A 3LK5A 4OKMA 3G4DA 4LIXA 3NPKA 4JVJF 3KRFA 3DYGA 3WEKA 4RXAA 5B0IA 4LZ0A
chains in the Genus database with same CATH superfamily
3APZA 4LTZA 1YYUA 2I19A 1V4HA 1YYSA 3ACWA 4P0XA 4KQUA 5HN9A 3Q2QA 3TFNA 3NPRA 4GP2A 2Q58A 3ZMBA 3N0FA 3S9VA 4E1EA 1N21A 3B7LA 3N0GA 4Q23A 4RXCA 4JZBA 3SDQA 3M01A 5CG5A 3N45F 4H5EF 4QXSF 4FJQA 3PYAA 1VG6A 2J1PA 3LLWA 1N20A 4F6XA 2E8XA 3BNYA 1WKZA 5DHKA 4XQTF 5E8KA 2VF6A 3VJAA 2F94F 5EROA 4KKMA 1YQ7A 2E4OA 2DH4A 3WEIA 3ASXA 5KSXF 4XQRF 5B0JA 1WY0A 1VG7A 1YHMA 3WCGA 3G4FA 2F7MF 4LXWA 2E95A 3EFQA 4KVYA 1FPSA 2E90A 3PH7A 4RXEA 3ICMA 1YYQA 3WJNA 5DGNF 2E91A 3Q2ZA 5ILZA 3QKCA 4K10A 5C05A 4LOBA 4DWBA 1V4KA 3WCCA 3BNXA 2Z4XA 4OKZA 4KVWA 5EATA 1N1ZA 3ACXA 4EA1A 2Z4VA 2PS4A 5ERNA 3AE0A 3OABB 3TC1A 5IMNA 3WCMA 3ICKA 1HM4A 3UCAA 2F92F 2O1OA 4GP1A 4XQSF 4DHDA 5E8HA 3OABA 3KRPB 3ZL6A 2P1CA 4P0VA 4F6VA 4E9UA 2RAHA 3Q1OA 3KRPA 3N46F 5IK0A 3ICNA 2Q9ZA 4KFAA 5B01A 3LSNA 3P8RA 4LFVF 3RYEA 1V4JA 3WCEA 4P0WA 2ONGA 2OPNA 1N24A 2ZEVA 5ILYA 5DJVF 5IM1A 5IMIA 3PYBA 3WEJA 1HXCA 1UBVA 3LJIA 1N1BA 5ERMA 2ZCQA 5HNAA 1DGPA 1UBYA 3AQ0A 3WCDA 4LFGA 5IKHA 2ZEUA 5B0KA 3M02A 4RYPA 2OPMA 5H9DA 3TFPA 5JA0F 4MC0A 4WK5A 3CC9A 5B0MA 3WJOA 2AETA 4KUXA 4NG6A 3EZ3A 2Z4WA 3LEEA 2AZJA 2AEKA 3OYRA 3ACYA 2OGDA 2Z52A 5AHUB 5IKAA 1DI1A 2J5CA 3WCIA 4KPJA 3WJKA 1EZFA 4H5CF 2Z7IA 3P5RA 2Z78A 1HM7A 3IPIA 4RNQA 5EASA 3RBMA 2Z4ZA 3SDTA 3LDWA 1YYTA 2FORA 5B03A 5ILIA 3WCAA 2ZCSA 3V1VA 3VJDA 3ZOUA 4NUAA 3IBAA 1RQJA 1WL3A 3MZVA 3VJ9A 5B0LA 3WEGA 4OMGA 3WCBA 3KB9A 3WEFA 2ZCRA 1WL0A 3N6KF 5DJPF 2ONHA 5ILJA 2EWGA 1HXGA 3WCHA 2E8TA 3KRAB 5JV0F 4N9UA 4KVDA 1VG4A 1VG3A 4JXNA 3NF2A 4KPDA 2PS7A 3Q30A 2F8CF 3AQCB 4RXDA 2F89F 3KRAA 3ID0A 1YJ4A 3P5PA 4LUUA 3N1WF 4NKEA 5JV2F 4KWDA 4E9ZA 4N1ZF 3WCFA 2E94A 5ILDA 5DIQF 4LZ3A 2Q9YA 3WCLA 2Z7HA 3AQBB 1WMWA 5IL8A 3N3DA 4KVIA 3PKOA 2PS5A 4LTVA 4DEMF 3WC9A 4UMJA 5B00A 2J1OA 3DYHA 2OA6A 2E8WA 4NKFA 2FTZA 4LFEA 5A0KA 4OMHA 1WL2A 4KQ5A 1KIZA 4ZQ8A 1WL1A 3EGTA 1V4EA 1VG2A 5DJRF 3OACB 2ZY1A 5I1UA 4OGUA 5IL3A 3KRCB 2Z4YA 4LPGF 3LMDA 4EA0A 2PS8A 1JFGA 3DYFA 1V4IA 1YHLA 3OACA 5EAUA 3LZ9A 5DZ2A 5ER8A 5HN8A 4KQSA 3KRCA 3V1XA 2Z50A 5DW7A 4DI5A 3WEHA 3W7FA 4L2XF 4JXYA 5DHIA 5AFXA 3TS7A 4F62A 5IK6A 4HD1A 3CKEA 1UBXA 2QISA 4LZCA 5E8LA 3SDUA 2E92A 4LA5A 3ICZA 3SDVA 1JFAA 5DGSF 4GA3A 3M00A 2AELA 3S4JA 3M9UA 1YYRA 1RTRA 3V66A 3KBKA 4DZWA 5B02A 4LLTA 4MC3A 3LGKA 1RQIA 3QQVA 5IVGA 5DGMF 1UBWA 3ZCDA 5IK9A 5IMPA 3CP6A 3VJ8A 3N3LF 2E8UA 4NFIF 1YHKA 3MAVA 4LPHF 3LG5A 4QPFA 4NFKF 3WSBA 5HN7A 1N22A 4LA6A 3WE9A 5IN8A 4FP4A 3ZMCA 3VJCA 3N5JF 5A0IA 2F8ZF 3KROB 5ILHA 3NRIA 2E8VA 1HXAA 3ADZA 4PVXF 3PDEA 3P8LA 3LGZB 5AELA 3N5HF 1HX9A 2H8OA 3RMGA 4EA2A 3KROA 2F9KF 2E93A 3TFVA 4GAXA 3RYWA 5CG6A 2Q80A 4LLSA 3N49F 4PVYF 5JUZF 3SDRA 4NFJF 2AZKA 1ZW5A 4JZXA 3VJBA 4MC8A 1PS1A 4H5DF 2AZLA 5A0JA 3VJEA 3M0GA 1KIYA 4JYXA 5AYPA 5JV1F 2ZCOA 3LVSA 3P41A 3SAEA 3WCJA 1YV5A 3N1VF 3LOMA 4DWGA 4DXJA 3WSAA 2PS6A 3KRFB 5ILKA 1N23A 4KK2A 3LK5A 4OKMA 3G4DA 4LIXA 3NPKA 4JVJF 3KRFA 3DYGA 3WEKA 4RXAA 5B0IA 4LZ0A
chains in the Genus database with same CATH topology
3APZA 4LTZA 1YYUA 2I19A 1V4HA 1YYSA 3ACWA 4P0XA 4KQUA 5HN9A 3Q2QA 3TFNA 3NPRA 4GP2A 2Q58A 3ZMBA 3N0FA 3S9VA 4E1EA 1N21A 3B7LA 3N0GA 4Q23A 4RXCA 4JZBA 3SDQA 3M01A 5CG5A 3N45F 4H5EF 4QXSF 4FJQA 3PYAA 1VG6A 2J1PA 3LLWA 1N20A 4F6XA 2E8XA 3BNYA 1WKZA 5DHKA 4XQTF 5E8KA 2VF6A 3VJAA 2F94F 5EROA 4KKMA 1YQ7A 2E4OA 2DH4A 3WEIA 3ASXA 5KSXF 4XQRF 5B0JA 1WY0A 1VG7A 1YHMA 3WCGA 3G4FA 2F7MF 4LXWA 2E95A 3EFQA 4KVYA 1FPSA 2E90A 3PH7A 4RXEA 3ICMA 1YYQA 3WJNA 5DGNF 2E91A 3Q2ZA 5ILZA 3QKCA 4K10A 5C05A 4LOBA 4DWBA 1V4KA 3WCCA 3BNXA 2Z4XA 4OKZA 4KVWA 5EATA 1N1ZA 3ACXA 4EA1A 2Z4VA 2PS4A 5ERNA 3AE0A 3OABB 3TC1A 5IMNA 3WCMA 3ICKA 1HM4A 3UCAA 2F92F 2O1OA 4GP1A 4XQSF 4DHDA 5E8HA 3OABA 3KRPB 3ZL6A 2P1CA 4P0VA 4F6VA 4E9UA 2RAHA 3Q1OA 3KRPA 3N46F 5IK0A 3ICNA 2Q9ZA 4KFAA 5B01A 3LSNA 3P8RA 4LFVF 3RYEA 1V4JA 3WCEA 4P0WA 2ONGA 2OPNA 1N24A 2ZEVA 5ILYA 5DJVF 5IM1A 5IMIA 3PYBA 3WEJA 1HXCA 1UBVA 3LJIA 1N1BA 5ERMA 2ZCQA 5HNAA 1DGPA 1UBYA 3AQ0A 3WCDA 4LFGA 5IKHA 2ZEUA 5B0KA 3M02A 4RYPA 2OPMA 5H9DA 3TFPA 5JA0F 4MC0A 4WK5A 3CC9A 5B0MA 3WJOA 2AETA 4KUXA 4NG6A 3EZ3A 2Z4WA 3LEEA 2AZJA 2AEKA 3OYRA 3ACYA 2OGDA 2Z52A 5AHUB 5IKAA 1DI1A 2J5CA 3WCIA 4KPJA 3WJKA 1EZFA 4H5CF 2Z7IA 3P5RA 2Z78A 1HM7A 3IPIA 4RNQA 5EASA 3RBMA 2Z4ZA 3SDTA 3LDWA 1YYTA 2FORA 5B03A 5ILIA 3WCAA 2ZCSA 3V1VA 3VJDA 3ZOUA 4NUAA 3IBAA 1RQJA 1WL3A 3MZVA 3VJ9A 5B0LA 3WEGA 4OMGA 3WCBA 3KB9A 3WEFA 2ZCRA 1WL0A 3N6KF 5DJPF 2ONHA 5ILJA 2EWGA 1HXGA 3WCHA 2E8TA 3KRAB 5JV0F 4N9UA 4KVDA 1VG4A 1VG3A 4JXNA 3NF2A 4KPDA 2PS7A 3Q30A 2F8CF 3AQCB 4RXDA 2F89F 3KRAA 3ID0A 1YJ4A 3P5PA 4LUUA 3N1WF 4NKEA 5JV2F 4KWDA 4E9ZA 4N1ZF 3WCFA 2E94A 5ILDA 5DIQF 4LZ3A 2Q9YA 3WCLA 2Z7HA 3AQBB 1WMWA 5IL8A 3N3DA 4KVIA 3PKOA 2PS5A 4LTVA 4DEMF 3WC9A 4UMJA 5B00A 2J1OA 3DYHA 2OA6A 2E8WA 4NKFA 2FTZA 4LFEA 5A0KA 4OMHA 1WL2A 4KQ5A 1KIZA 4ZQ8A 1WL1A 3EGTA 1V4EA 1VG2A 5DJRF 3OACB 2ZY1A 5I1UA 4OGUA 5IL3A 3KRCB 2Z4YA 4LPGF 3LMDA 4EA0A 2PS8A 1JFGA 3DYFA 1V4IA 1YHLA 3OACA 5EAUA 3LZ9A 5DZ2A 5ER8A 5HN8A 4KQSA 3KRCA 3V1XA 2Z50A 5DW7A 4DI5A 3WEHA 3W7FA 4L2XF 4JXYA 5DHIA 5AFXA 3TS7A 4F62A 5IK6A 4HD1A 3CKEA 1UBXA 2QISA 4LZCA 5E8LA 3SDUA 2E92A 4LA5A 3ICZA 3SDVA 1JFAA 5DGSF 4GA3A 3M00A 2AELA 3S4JA 3M9UA 1YYRA 1RTRA 3V66A 3KBKA 4DZWA 5B02A 4LLTA 4MC3A 3LGKA 1RQIA 3QQVA 5IVGA 5DGMF 1UBWA 3ZCDA 5IK9A 5IMPA 3CP6A 3VJ8A 3N3LF 2E8UA 4NFIF 1YHKA 3MAVA 4LPHF 3LG5A 4QPFA 4NFKF 3WSBA 5HN7A 1N22A 4LA6A 3WE9A 5IN8A 4FP4A 3ZMCA 3VJCA 3N5JF 5A0IA 2F8ZF 3KROB 5ILHA 3NRIA 2E8VA 1HXAA 3ADZA 4PVXF 3PDEA 3P8LA 3LGZB 5AELA 3N5HF 1HX9A 2H8OA 3RMGA 4EA2A 3KROA 2F9KF 2E93A 3TFVA 4GAXA 3RYWA 5CG6A 2Q80A 4LLSA 3N49F 4PVYF 5JUZF 3SDRA 4NFJF 2AZKA 1ZW5A 4JZXA 3VJBA 4MC8A 1PS1A 4H5DF 2AZLA 5A0JA 3VJEA 3M0GA 1KIYA 4JYXA 5AYPA 5JV1F 2ZCOA 3LVSA 3P41A 3SAEA 3WCJA 1YV5A 3N1VF 3LOMA 4DWGA 4DXJA 3WSAA 2PS6A 3KRFB 5ILKA 1N23A 4KK2A 3LK5A 4OKMA 3G4DA 4LIXA 3NPKA 4JVJF 3KRFA 3DYGA 3WEKA 4RXAA 5B0IA 4LZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3APZ A;  4LTZ A;  1YYU A;  2I19 A;  1V4H A;  1YYS A;  3ACW A;  4P0X A;  4KQU A;  5HN9 A;  3Q2Q A;  3TFN A;  3NPR A;  4GP2 A;  2Q58 A;  3ZMB A;  3N0F A;  3S9V A;  4E1E A;  1N21 A;  3B7L A;  3N0G A;  4Q23 A;  4RXC A;  4JZB A;  3SDQ A;  3M01 A;  5CG5 A;  3N45 F;  4H5E F;  4QXS F;  4FJQ A;  3PYA A;  1VG6 A;  2J1P A;  3LLW A;  1N20 A;  4F6X A;  2E8X A;  3BNY A;  1WKZ A;  5DHK A;  4XQT F;  5E8K A;  2VF6 A;  3VJA A;  2F94 F;  5ERO A;  4KKM A;  1YQ7 A;  2E4O A;  2DH4 A;  3WEI A;  3ASX A;  5KSX F;  4XQR F;  5B0J A;  1WY0 A;  1VG7 A;  1YHM A;  3WCG A;  3G4F A;  2F7M F;  4LXW A;  2E95 A;  3EFQ A;  4KVY A;  1FPS A;  2E90 A;  3PH7 A;  4RXE A;  3ICM A;  1YYQ A;  3WJN A;  5DGN F;  2E91 A;  3Q2Z A;  5ILZ A;  3QKC A;  4K10 A;  5C05 A;  4LOB A;  4DWB A;  1V4K A;  3WCC A;  3BNX A;  2Z4X A;  4OKZ A;  4KVW A;  5EAT A;  1N1Z A;  3ACX A;  4EA1 A;  2Z4V A;  2PS4 A;  5ERN A;  3AE0 A;  3OAB B;  3TC1 A;  5IMN A;  3WCM A;  3ICK A;  1HM4 A;  3UCA A;  2F92 F;  2O1O A;  4GP1 A;  4XQS F;  4DHD A;  5E8H A;  3OAB A;  3KRP B;  3ZL6 A;  2P1C A;  4P0V A;  4F6V A;  4E9U A;  2RAH A;  3Q1O A;  3KRP A;  3N46 F;  5IK0 A;  3ICN A;  2Q9Z A;  4KFA A;  5B01 A;  3LSN A;  3P8R A;  4LFV F;  3RYE A;  1V4J A;  3WCE A;  4P0W A;  2ONG A;  2OPN A;  1N24 A;  2ZEV A;  5ILY A;  5DJV F;  5IM1 A;  5IMI A;  3PYB A;  3WEJ A;  1HXC A;  1UBV A;  3LJI A;  1N1B A;  5ERM A;  2ZCQ A;  5HNA A;  1DGP A;  1UBY A;  3AQ0 A;  3WCD A;  4LFG A;  5IKH A;  2ZEU A;  5B0K A;  3M02 A;  4RYP A;  2OPM A;  5H9D A;  3TFP A;  5JA0 F;  4MC0 A;  4WK5 A;  3CC9 A;  5B0M A;  3WJO A;  2AET A;  4KUX A;  4NG6 A;  3EZ3 A;  2Z4W A;  3LEE A;  2AZJ A;  2AEK A;  3OYR A;  3ACY A;  2OGD A;  2Z52 A;  5AHU B;  5IKA A;  1DI1 A;  2J5C A;  3WCI A;  4KPJ A;  3WJK A;  1EZF A;  4H5C F;  2Z7I A;  3P5R A;  2Z78 A;  1HM7 A;  3IPI A;  4RNQ A;  5EAS A;  3RBM A;  2Z4Z A;  3SDT A;  3LDW A;  1YYT A;  2FOR A;  5B03 A;  5ILI A;  3WCA A;  2ZCS A;  3V1V A;  3VJD A;  3ZOU A;  4NUA A;  3IBA A;  1RQJ A;  1WL3 A;  3MZV A;  3VJ9 A;  5B0L A;  3WEG A;  4OMG A;  3WCB A;  3KB9 A;  3WEF A;  2ZCR A;  1WL0 A;  3N6K F;  5DJP F;  2ONH A;  5ILJ A;  2EWG A;  1HXG A;  3WCH A;  2E8T A;  3KRA B;  5JV0 F;  4N9U A;  4KVD A;  1VG4 A;  1VG3 A;  4JXN A;  3NF2 A;  4KPD A;  2PS7 A;  3Q30 A;  2F8C F;  3AQC B;  4RXD A;  2F89 F;  3KRA A;  3ID0 A;  1YJ4 A;  3P5P A;  4LUU A;  3N1W F;  4NKE A;  5JV2 F;  4KWD A;  4E9Z A;  4N1Z F;  3WCF A;  2E94 A;  5ILD A;  5DIQ F;  4LZ3 A;  2Q9Y A;  3WCL A;  2Z7H A;  3AQB B;  1WMW A;  5IL8 A;  3N3D A;  4KVI A;  3PKO A;  2PS5 A;  4LTV A;  4DEM F;  3WC9 A;  4UMJ A;  5B00 A;  2J1O A;  3DYH A;  2OA6 A;  2E8W A;  4NKF A;  2FTZ A;  4LFE A;  5A0K A;  4OMH A;  1WL2 A;  4KQ5 A;  1KIZ A;  4ZQ8 A;  1WL1 A;  3EGT A;  1V4E A;  1VG2 A;  5DJR F;  3OAC B;  2ZY1 A;  5I1U A;  4OGU A;  5IL3 A;  3KRC B;  2Z4Y A;  4LPG F;  3LMD A;  4EA0 A;  2PS8 A;  1JFG A;  3DYF A;  1V4I A;  1YHL A;  3OAC A;  5EAU A;  3LZ9 A;  5DZ2 A;  5ER8 A;  5HN8 A;  4KQS A;  3KRC A;  3V1X A;  2Z50 A;  5DW7 A;  4DI5 A;  3WEH A;  3W7F A;  4L2X F;  4JXY A;  5DHI A;  5AFX A;  3TS7 A;  4F62 A;  5IK6 A;  4HD1 A;  3CKE A;  1UBX A;  2QIS A;  4LZC A;  5E8L A;  3SDU A;  2E92 A;  4LA5 A;  3ICZ A;  3SDV A;  1JFA A;  5DGS F;  4GA3 A;  3M00 A;  2AEL A;  3S4J A;  3M9U A;  1YYR A;  1RTR A;  3V66 A;  3KBK A;  4DZW A;  5B02 A;  4LLT A;  4MC3 A;  3LGK A;  1RQI A;  3QQV A;  5IVG A;  5DGM F;  1UBW A;  3ZCD A;  5IK9 A;  5IMP A;  3CP6 A;  3VJ8 A;  3N3L F;  2E8U A;  4NFI F;  1YHK A;  3MAV A;  4LPH F;  3LG5 A;  4QPF A;  4NFK F;  3WSB A;  5HN7 A;  1N22 A;  4LA6 A;  3WE9 A;  5IN8 A;  4FP4 A;  3ZMC A;  3VJC A;  3N5J F;  5A0I A;  2F8Z F;  3KRO B;  5ILH A;  3NRI A;  2E8V A;  1HXA A;  3ADZ A;  4PVX F;  3PDE A;  3P8L A;  3LGZ B;  5AEL A;  3N5H F;  1HX9 A;  2H8O A;  3RMG A;  4EA2 A;  3KRO A;  2F9K F;  2E93 A;  3TFV A;  4GAX A;  3RYW A;  5CG6 A;  2Q80 A;  4LLS A;  3N49 F;  4PVY F;  5JUZ F;  3SDR A;  4NFJ F;  2AZK A;  1ZW5 A;  4JZX A;  3VJB A;  4MC8 A;  1PS1 A;  4H5D F;  2AZL A;  5A0J A;  3VJE A;  3M0G A;  1KIY A;  4JYX A;  5AYP A;  5JV1 F;  2ZCO A;  3LVS A;  3P41 A;  3SAE A;  3WCJ A;  1YV5 A;  3N1V F;  3LOM A;  4DWG A;  4DXJ A;  3WSA A;  2PS6 A;  3KRF B;  5ILK A;  1N23 A;  4KK2 A;  3LK5 A;  4OKM A;  3G4D A;  4LIX A;  3NPK A;  4JVJ F;  3KRF A;  3DYG A;  3WEK A;  4RXA A;  5B0I A;  4LZ0 A; 
#chains in the Genus database with same CATH topology
 3APZ A;  4LTZ A;  1YYU A;  2I19 A;  1V4H A;  1YYS A;  3ACW A;  4P0X A;  4KQU A;  5HN9 A;  3Q2Q A;  3TFN A;  3NPR A;  4GP2 A;  2Q58 A;  3ZMB A;  3N0F A;  3S9V A;  4E1E A;  1N21 A;  3B7L A;  3N0G A;  4Q23 A;  4RXC A;  4JZB A;  3SDQ A;  3M01 A;  5CG5 A;  3N45 F;  4H5E F;  4QXS F;  4FJQ A;  3PYA A;  1VG6 A;  2J1P A;  3LLW A;  1N20 A;  4F6X A;  2E8X A;  3BNY A;  1WKZ A;  5DHK A;  4XQT F;  5E8K A;  2VF6 A;  3VJA A;  2F94 F;  5ERO A;  4KKM A;  1YQ7 A;  2E4O A;  2DH4 A;  3WEI A;  3ASX A;  5KSX F;  4XQR F;  5B0J A;  1WY0 A;  1VG7 A;  1YHM A;  3WCG A;  3G4F A;  2F7M F;  4LXW A;  2E95 A;  3EFQ A;  4KVY A;  1FPS A;  2E90 A;  3PH7 A;  4RXE A;  3ICM A;  1YYQ A;  3WJN A;  5DGN F;  2E91 A;  3Q2Z A;  5ILZ A;  3QKC A;  4K10 A;  5C05 A;  4LOB A;  4DWB A;  1V4K A;  3WCC A;  3BNX A;  2Z4X A;  4OKZ A;  4KVW A;  5EAT A;  1N1Z A;  3ACX A;  4EA1 A;  2Z4V A;  2PS4 A;  5ERN A;  3AE0 A;  3OAB B;  3TC1 A;  5IMN A;  3WCM A;  3ICK A;  1HM4 A;  3UCA A;  2F92 F;  2O1O A;  4GP1 A;  4XQS F;  4DHD A;  5E8H A;  3OAB A;  3KRP B;  3ZL6 A;  2P1C A;  4P0V A;  4F6V A;  4E9U A;  2RAH A;  3Q1O A;  3KRP A;  3N46 F;  5IK0 A;  3ICN A;  2Q9Z A;  4KFA A;  5B01 A;  3LSN A;  3P8R A;  4LFV F;  3RYE A;  1V4J A;  3WCE A;  4P0W A;  2ONG A;  2OPN A;  1N24 A;  2ZEV A;  5ILY A;  5DJV F;  5IM1 A;  5IMI A;  3PYB A;  3WEJ A;  1HXC A;  1UBV A;  3LJI A;  1N1B A;  5ERM A;  2ZCQ A;  5HNA A;  1DGP A;  1UBY A;  3AQ0 A;  3WCD A;  4LFG A;  5IKH A;  2ZEU A;  5B0K A;  3M02 A;  4RYP A;  2OPM A;  5H9D A;  3TFP A;  5JA0 F;  4MC0 A;  4WK5 A;  3CC9 A;  5B0M A;  3WJO A;  2AET A;  4KUX A;  4NG6 A;  3EZ3 A;  2Z4W A;  3LEE A;  2AZJ A;  2AEK A;  3OYR A;  3ACY A;  2OGD A;  2Z52 A;  5AHU B;  5IKA A;  1DI1 A;  2J5C A;  3WCI A;  4KPJ A;  3WJK A;  1EZF A;  4H5C F;  2Z7I A;  3P5R A;  2Z78 A;  1HM7 A;  3IPI A;  4RNQ A;  5EAS A;  3RBM A;  2Z4Z A;  3SDT A;  3LDW A;  1YYT A;  2FOR A;  5B03 A;  5ILI A;  3WCA A;  2ZCS A;  3V1V A;  3VJD A;  3ZOU A;  4NUA A;  3IBA A;  1RQJ A;  1WL3 A;  3MZV A;  3VJ9 A;  5B0L A;  3WEG A;  4OMG A;  3WCB A;  3KB9 A;  3WEF A;  2ZCR A;  1WL0 A;  3N6K F;  5DJP F;  2ONH A;  5ILJ A;  2EWG A;  1HXG A;  3WCH A;  2E8T A;  3KRA B;  5JV0 F;  4N9U A;  4KVD A;  1VG4 A;  1VG3 A;  4JXN A;  3NF2 A;  4KPD A;  2PS7 A;  3Q30 A;  2F8C F;  3AQC B;  4RXD A;  2F89 F;  3KRA A;  3ID0 A;  1YJ4 A;  3P5P A;  4LUU A;  3N1W F;  4NKE A;  5JV2 F;  4KWD A;  4E9Z A;  4N1Z F;  3WCF A;  2E94 A;  5ILD A;  5DIQ F;  4LZ3 A;  2Q9Y A;  3WCL A;  2Z7H A;  3AQB B;  1WMW A;  5IL8 A;  3N3D A;  4KVI A;  3PKO A;  2PS5 A;  4LTV A;  4DEM F;  3WC9 A;  4UMJ A;  5B00 A;  2J1O A;  3DYH A;  2OA6 A;  2E8W A;  4NKF A;  2FTZ A;  4LFE A;  5A0K A;  4OMH A;  1WL2 A;  4KQ5 A;  1KIZ A;  4ZQ8 A;  1WL1 A;  3EGT A;  1V4E A;  1VG2 A;  5DJR F;  3OAC B;  2ZY1 A;  5I1U A;  4OGU A;  5IL3 A;  3KRC B;  2Z4Y A;  4LPG F;  3LMD A;  4EA0 A;  2PS8 A;  1JFG A;  3DYF A;  1V4I A;  1YHL A;  3OAC A;  5EAU A;  3LZ9 A;  5DZ2 A;  5ER8 A;  5HN8 A;  4KQS A;  3KRC A;  3V1X A;  2Z50 A;  5DW7 A;  4DI5 A;  3WEH A;  3W7F A;  4L2X F;  4JXY A;  5DHI A;  5AFX A;  3TS7 A;  4F62 A;  5IK6 A;  4HD1 A;  3CKE A;  1UBX A;  2QIS A;  4LZC A;  5E8L A;  3SDU A;  2E92 A;  4LA5 A;  3ICZ A;  3SDV A;  1JFA A;  5DGS F;  4GA3 A;  3M00 A;  2AEL A;  3S4J A;  3M9U A;  1YYR A;  1RTR A;  3V66 A;  3KBK A;  4DZW A;  5B02 A;  4LLT A;  4MC3 A;  3LGK A;  1RQI A;  3QQV A;  5IVG A;  5DGM F;  1UBW A;  3ZCD A;  5IK9 A;  5IMP A;  3CP6 A;  3VJ8 A;  3N3L F;  2E8U A;  4NFI F;  1YHK A;  3MAV A;  4LPH F;  3LG5 A;  4QPF A;  4NFK F;  3WSB A;  5HN7 A;  1N22 A;  4LA6 A;  3WE9 A;  5IN8 A;  4FP4 A;  3ZMC A;  3VJC A;  3N5J F;  5A0I A;  2F8Z F;  3KRO B;  5ILH A;  3NRI A;  2E8V A;  1HXA A;  3ADZ A;  4PVX F;  3PDE A;  3P8L A;  3LGZ B;  5AEL A;  3N5H F;  1HX9 A;  2H8O A;  3RMG A;  4EA2 A;  3KRO A;  2F9K F;  2E93 A;  3TFV A;  4GAX A;  3RYW A;  5CG6 A;  2Q80 A;  4LLS A;  3N49 F;  4PVY F;  5JUZ F;  3SDR A;  4NFJ F;  2AZK A;  1ZW5 A;  4JZX A;  3VJB A;  4MC8 A;  1PS1 A;  4H5D F;  2AZL A;  5A0J A;  3VJE A;  3M0G A;  1KIY A;  4JYX A;  5AYP A;  5JV1 F;  2ZCO A;  3LVS A;  3P41 A;  3SAE A;  3WCJ A;  1YV5 A;  3N1V F;  3LOM A;  4DWG A;  4DXJ A;  3WSA A;  2PS6 A;  3KRF B;  5ILK A;  1N23 A;  4KK2 A;  3LK5 A;  4OKM A;  3G4D A;  4LIX A;  3NPK A;  4JVJ F;  3KRF A;  3DYG A;  3WEK A;  4RXA A;  5B0I A;  4LZ0 A; 
#chains in the Genus database with same CATH homology
 3APZ A;  4LTZ A;  1YYU A;  2I19 A;  1V4H A;  1YYS A;  3ACW A;  4P0X A;  4KQU A;  5HN9 A;  3Q2Q A;  3TFN A;  3NPR A;  4GP2 A;  2Q58 A;  3ZMB A;  3N0F A;  3S9V A;  4E1E A;  1N21 A;  3B7L A;  3N0G A;  4Q23 A;  4RXC A;  4JZB A;  3SDQ A;  3M01 A;  5CG5 A;  3N45 F;  4H5E F;  4QXS F;  4FJQ A;  3PYA A;  1VG6 A;  2J1P A;  3LLW A;  1N20 A;  4F6X A;  2E8X A;  3BNY A;  1WKZ A;  5DHK A;  4XQT F;  5E8K A;  2VF6 A;  3VJA A;  2F94 F;  5ERO A;  4KKM A;  1YQ7 A;  2E4O A;  2DH4 A;  3WEI A;  3ASX A;  5KSX F;  4XQR F;  5B0J A;  1WY0 A;  1VG7 A;  1YHM A;  3WCG A;  3G4F A;  2F7M F;  4LXW A;  2E95 A;  3EFQ A;  4KVY A;  1FPS A;  2E90 A;  3PH7 A;  4RXE A;  3ICM A;  1YYQ A;  3WJN A;  5DGN F;  2E91 A;  3Q2Z A;  5ILZ A;  3QKC A;  4K10 A;  5C05 A;  4LOB A;  4DWB A;  1V4K A;  3WCC A;  3BNX A;  2Z4X A;  4OKZ A;  4KVW A;  5EAT A;  1N1Z A;  3ACX A;  4EA1 A;  2Z4V A;  2PS4 A;  5ERN A;  3AE0 A;  3OAB B;  3TC1 A;  5IMN A;  3WCM A;  3ICK A;  1HM4 A;  3UCA A;  2F92 F;  2O1O A;  4GP1 A;  4XQS F;  4DHD A;  5E8H A;  3OAB A;  3KRP B;  3ZL6 A;  2P1C A;  4P0V A;  4F6V A;  4E9U A;  2RAH A;  3Q1O A;  3KRP A;  3N46 F;  5IK0 A;  3ICN A;  2Q9Z A;  4KFA A;  5B01 A;  3LSN A;  3P8R A;  4LFV F;  3RYE A;  1V4J A;  3WCE A;  4P0W A;  2ONG A;  2OPN A;  1N24 A;  2ZEV A;  5ILY A;  5DJV F;  5IM1 A;  5IMI A;  3PYB A;  3WEJ A;  1HXC A;  1UBV A;  3LJI A;  1N1B A;  5ERM A;  2ZCQ A;  5HNA A;  1DGP A;  1UBY A;  3AQ0 A;  3WCD A;  4LFG A;  5IKH A;  2ZEU A;  5B0K A;  3M02 A;  4RYP A;  2OPM A;  5H9D A;  3TFP A;  5JA0 F;  4MC0 A;  4WK5 A;  3CC9 A;  5B0M A;  3WJO A;  2AET A;  4KUX A;  4NG6 A;  3EZ3 A;  2Z4W A;  3LEE A;  2AZJ A;  2AEK A;  3OYR A;  3ACY A;  2OGD A;  2Z52 A;  5AHU B;  5IKA A;  1DI1 A;  2J5C A;  3WCI A;  4KPJ A;  3WJK A;  1EZF A;  4H5C F;  2Z7I A;  3P5R A;  2Z78 A;  1HM7 A;  3IPI A;  4RNQ A;  5EAS A;  3RBM A;  2Z4Z A;  3SDT A;  3LDW A;  1YYT A;  2FOR A;  5B03 A;  5ILI A;  3WCA A;  2ZCS A;  3V1V A;  3VJD A;  3ZOU A;  4NUA A;  3IBA A;  1RQJ A;  1WL3 A;  3MZV A;  3VJ9 A;  5B0L A;  3WEG A;  4OMG A;  3WCB A;  3KB9 A;  3WEF A;  2ZCR A;  1WL0 A;  3N6K F;  5DJP F;  2ONH A;  5ILJ A;  2EWG A;  1HXG A;  3WCH A;  2E8T A;  3KRA B;  5JV0 F;  4N9U A;  4KVD A;  1VG4 A;  1VG3 A;  4JXN A;  3NF2 A;  4KPD A;  2PS7 A;  3Q30 A;  2F8C F;  3AQC B;  4RXD A;  2F89 F;  3KRA A;  3ID0 A;  1YJ4 A;  3P5P A;  4LUU A;  3N1W F;  4NKE A;  5JV2 F;  4KWD A;  4E9Z A;  4N1Z F;  3WCF A;  2E94 A;  5ILD A;  5DIQ F;  4LZ3 A;  2Q9Y A;  3WCL A;  2Z7H A;  3AQB B;  1WMW A;  5IL8 A;  3N3D A;  4KVI A;  3PKO A;  2PS5 A;  4LTV A;  4DEM F;  3WC9 A;  4UMJ A;  5B00 A;  2J1O A;  3DYH A;  2OA6 A;  2E8W A;  4NKF A;  2FTZ A;  4LFE A;  5A0K A;  4OMH A;  1WL2 A;  4KQ5 A;  1KIZ A;  4ZQ8 A;  1WL1 A;  3EGT A;  1V4E A;  1VG2 A;  5DJR F;  3OAC B;  2ZY1 A;  5I1U A;  4OGU A;  5IL3 A;  3KRC B;  2Z4Y A;  4LPG F;  3LMD A;  4EA0 A;  2PS8 A;  1JFG A;  3DYF A;  1V4I A;  1YHL A;  3OAC A;  5EAU A;  3LZ9 A;  5DZ2 A;  5ER8 A;  5HN8 A;  4KQS A;  3KRC A;  3V1X A;  2Z50 A;  5DW7 A;  4DI5 A;  3WEH A;  3W7F A;  4L2X F;  4JXY A;  5DHI A;  5AFX A;  3TS7 A;  4F62 A;  5IK6 A;  4HD1 A;  3CKE A;  1UBX A;  2QIS A;  4LZC A;  5E8L A;  3SDU A;  2E92 A;  4LA5 A;  3ICZ A;  3SDV A;  1JFA A;  5DGS F;  4GA3 A;  3M00 A;  2AEL A;  3S4J A;  3M9U A;  1YYR A;  1RTR A;  3V66 A;  3KBK A;  4DZW A;  5B02 A;  4LLT A;  4MC3 A;  3LGK A;  1RQI A;  3QQV A;  5IVG A;  5DGM F;  1UBW A;  3ZCD A;  5IK9 A;  5IMP A;  3CP6 A;  3VJ8 A;  3N3L F;  2E8U A;  4NFI F;  1YHK A;  3MAV A;  4LPH F;  3LG5 A;  4QPF A;  4NFK F;  3WSB A;  5HN7 A;  1N22 A;  4LA6 A;  3WE9 A;  5IN8 A;  4FP4 A;  3ZMC A;  3VJC A;  3N5J F;  5A0I A;  2F8Z F;  3KRO B;  5ILH A;  3NRI A;  2E8V A;  1HXA A;  3ADZ A;  4PVX F;  3PDE A;  3P8L A;  3LGZ B;  5AEL A;  3N5H F;  1HX9 A;  2H8O A;  3RMG A;  4EA2 A;  3KRO A;  2F9K F;  2E93 A;  3TFV A;  4GAX A;  3RYW A;  5CG6 A;  2Q80 A;  4LLS A;  3N49 F;  4PVY F;  5JUZ F;  3SDR A;  4NFJ F;  2AZK A;  1ZW5 A;  4JZX A;  3VJB A;  4MC8 A;  1PS1 A;  4H5D F;  2AZL A;  5A0J A;  3VJE A;  3M0G A;  1KIY A;  4JYX A;  5AYP A;  5JV1 F;  2ZCO A;  3LVS A;  3P41 A;  3SAE A;  3WCJ A;  1YV5 A;  3N1V F;  3LOM A;  4DWG A;  4DXJ A;  3WSA A;  2PS6 A;  3KRF B;  5ILK A;  1N23 A;  4KK2 A;  3LK5 A;  4OKM A;  3G4D A;  4LIX A;  3NPK A;  4JVJ F;  3KRF A;  3DYG A;  3WEK A;  4RXA A;  5B0I A;  4LZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...