3PKOA

Crystal structure of geranylgeranyl pyrophosphate synthase from lactobacillus brevis atcc 367 complexed with citrate
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
332
structure length
331
Chain Sequence
AHHHHHHSLRQLWRQFPQVEPQLTALQDYLLRTVQLDNQPIHHKILALLKSGGKLLRPGYFYLFSTFGNAATPAQLQAGAAAIEILHVGTLIHDDVIDDSPTRRGVRTIQMTYGQRNAIYAGDFMFTVYFDQVLKSTTDRSLIQNHIDAMHRILQGELHQMDLNYREDITLDAYLNEIAGKTAELFALSCYQGAQLAGAPQSVIDRTRDIGIAIGCAYQMLDDILDYAGDPKRTQKPVLEDLRSGVYSLPLLLSLSHAPRDFHKLLKKKQAMTLEDIKHVQALVAQYDGVGAAKQLAQDYTDRALTLIQQLPVGSAQQSLEQLTRLLLRRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl pyrophosphate synthase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Lactobacillus brevis
total genus 136
structure length 331
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3pkoA00
1DGPA 3NRIA 4XQSF 5IN8A 4NFJF 3SDQA 2J1PA 4JZXA 4JVJF 2Z4VA 3ZOUA 3LGKA 1UBYA 3LG5A 3KRCA 1N23A 3AQCB 4P0XA 2J5CA 3P41A 1WY0A 3RBMA 3N1VF 1EZFA 3WCHA 4DEMF 3LK5A 4E1EA 2AEKA 3V1VA 3SDVA 4P0VA 5ILHA 2Z7IA 3ID0A 5DIQF 4RXDA 1YQ7A 4NKEA 2H8OA 4KVYA 3WEGA 2DH4A 4PVXF 5IMPA 5I1UA 5ERMA 3MAVA 5IM1A 1VG2A 3LMDA 2ZEUA 4NKFA 3DYFA 1RQIA 4DXJA 5AHUB 1N24A 1YYRA 3WSBA 4DZWA 4ZQ8A 1V4KA 2E93A 3KROB 1VG7A 4RXEA 4EA2A 3VJAA 3WCCA 4LFVF 5JA0F 3ACYA 1YHLA 2E91A 2AZJA 1YJ4A 2F8ZF 4LFEA 4LFGA 2Q58A 1UBWA 2Q9YA 1HXGA 3SDRA 5E8LA 2PS6A 4QXSF 3P5RA 2ZCSA 3RMGA 5JV1F 5ILYA 2RAHA 3G4FA 3VJCA 3ADZA 2O1OA 4RXCA 4OMGA 3WCLA 2P1CA 3TFNA 3S9VA 4DHDA 3S4JA 4NFIF 1N21A 3ICNA 2F92F 3WCDA 3OYRA 2E8WA 4JYXA 5B03A 3LSNA 3WJKA 3QKCA 3IPIA 4WK5A 3B7LA 3P8RA 4E9ZA 3WCEA 5IKAA 3N46F 4P0WA 4UMJA 1VG6A 5DHIA 1N20A 3IBAA 4NFKF 5DJRF 4LXWA 3KRAA 4Q23A 4LZ0A 3ASXA 3N1WF 4GAXA 1HXAA 2ONGA 4H5EF 3WCBA 5E8HA 4DWBA 5B02A 2PS7A 1YHMA 4FJQA 2AZLA 4NUAA 1DI1A 4OGUA 1WL0A 4KQ5A 3OACA 3VJ8A 2OPNA 5DGSF 2EWGA 3AE0A 2E92A 2Z4WA 4F62A 3WEFA 1N1BA 3DYHA 3M01A 5ERNA 4KQUA 2AZKA 3ZL6A 1HX9A 4FP4A 4LTVA 4F6VA 3LLWA 5HNAA 3CKEA 3NF2A 3TFVA 5AYPA 3KBKA 4JXNA 1HXCA 3N45F 3ICZA 4RYPA 1WMWA 3Q1OA 3MZVA 3WE9A 3LGZB 3DYGA 5IMNA 4LLSA 1WL3A 3M00A 2Z4XA 2E8UA 4MC3A 5DGNF 1JFAA 3WCIA 3WCJA 2AELA 5ILKA 1JFGA 4H5DF 5IK6A 2PS5A 5B01A 2Z4ZA 2E95A 2Z50A 3LEEA 4EA0A 4LUUA 5EAUA 3M9UA 2ZEVA 3NPRA 4N1ZF 3WEIA 4OKZA 1HM4A 2I19A 3N49F 4HD1A 3TFPA 1WL2A 3VJDA 5A0IA 2ZY1A 5EASA 2E4OA 3OABA 5JV2F 2Z4YA 5B0IA 5IL3A 4KKMA 2OPMA 3LDWA 5AFXA 5IVGA 3KRAB 3ICKA 2PS8A 5IMIA 4MC0A 4KWDA 3WSAA 1WL1A 4NG6A 5IKHA 1RQJA 5ILZA 3UCAA 3WCMA 2ZCOA 5EATA 3KRCB 4F6XA 1KIZA 1YV5A 3PKOA 1V4IA 5C05A 3KB9A 3G4DA 3OACB 3AQ0A 4LIXA 3PYBA 5DW7A 5B0KA 2Z78A 3ZCDA 4JZBA 4K10A 5KSXF 3Q30A 1V4HA 4LOBA 3M0GA 3LVSA 3WEHA 3LOMA 2F9KF 3TS7A 4XQTF 3N0GA 1WKZA 2F8CF 3BNXA 4RNQA 4KVDA 5H9DA 3ZMCA 2Q9ZA 3W7FA 2OA6A 3TC1A 2E94A 3WJNA 2E8XA 3KRFA 3QQVA 2FTZA 2QISA 2E90A 3LZ9A 5JV0F 5CG6A 3N0FA 5B0JA 3PH7A 1YYQA 4LTZA 1PS1A 3ACXA 4EA1A 3N3LF 1YYTA 3V1XA 4KFAA 4LLTA 2FORA 4KK2A 4OKMA 3N6KF 3WCAA 1YYSA 2F7MF 4KUXA 4GP1A 2ZCRA 5HN8A 4LZCA 3SDTA 3KRPA 4KPDA 3WEKA 3EGTA 1V4JA 4KVWA 3RYEA 2AETA 5CG5A 1HM7A 2PS4A 4E9UA 3SDUA 4MC8A 2OGDA 3LJIA 3CP6A 2ONHA 1UBXA 3OABB 1VG4A 3RYWA 5DGMF 5IK9A 5IK0A 4L2XF 3VJBA 4JXYA 3WC9A 3WEJA 3V66A 5A0JA 5B0LA 1V4EA 1YHKA 5DJPF 4H5CF 3VJEA 5ILJA 3N5JF 2E8TA 3ACWA 4KQSA 3Q2QA 3PDEA 3N5HF 4KVIA 1N1ZA 1ZW5A 4LPGF 3WJOA 5EROA 4QPFA 3P8LA 5B0MA 3CC9A 1YYUA 4KPJA 4LZ3A 5DHKA 3P5PA 2ZCQA 4RXAA 5DJVF 3Q2ZA 3NPKA 4PVYF 4DWGA 5A0KA 5HN7A 5DZ2A 3M02A 4LA6A 3KRFB 2J1OA 5HN9A 2F89F 4OMHA 3APZA 5AELA 5ER8A 2E8VA 3EZ3A 5ILDA 3WCFA 4LA5A 2F94F 5B00A 3SAEA 1KIYA 3KROA 3BNYA 2Z52A 3N3DA 3VJ9A 5JUZF 1N22A 4GP2A 3AQBB 3ICMA 1UBVA 2VF6A 2Z7HA 3KRPB 5IL8A 4GA3A 5ILIA 4LPHF 5E8KA 2Q80A 3ZMBA 4N9UA 1VG3A 1FPSA 1RTRA 3WCGA 4DI5A 3PYAA 4XQRF 3EFQA
chains in the Genus database with same CATH superfamily
1DGPA 3NRIA 4XQSF 5IN8A 4NFJF 3SDQA 2J1PA 4JZXA 4JVJF 2Z4VA 3ZOUA 3LGKA 1UBYA 3LG5A 3KRCA 1N23A 3AQCB 4P0XA 2J5CA 3P41A 1WY0A 3RBMA 3N1VF 1EZFA 3WCHA 4DEMF 3LK5A 4E1EA 2AEKA 3V1VA 3SDVA 4P0VA 5ILHA 2Z7IA 3ID0A 5DIQF 4RXDA 1YQ7A 4NKEA 2H8OA 4KVYA 3WEGA 2DH4A 4PVXF 5IMPA 5I1UA 5ERMA 3MAVA 5IM1A 1VG2A 3LMDA 2ZEUA 4NKFA 3DYFA 1RQIA 4DXJA 5AHUB 1N24A 1YYRA 3WSBA 4DZWA 4ZQ8A 1V4KA 2E93A 3KROB 1VG7A 4RXEA 4EA2A 3VJAA 3WCCA 4LFVF 5JA0F 3ACYA 1YHLA 2E91A 2AZJA 1YJ4A 2F8ZF 4LFEA 4LFGA 2Q58A 1UBWA 2Q9YA 1HXGA 3SDRA 5E8LA 2PS6A 4QXSF 3P5RA 2ZCSA 3RMGA 5JV1F 5ILYA 2RAHA 3G4FA 3VJCA 3ADZA 2O1OA 4RXCA 4OMGA 3WCLA 2P1CA 3TFNA 3S9VA 4DHDA 3S4JA 4NFIF 1N21A 3ICNA 2F92F 3WCDA 3OYRA 2E8WA 4JYXA 5B03A 3LSNA 3WJKA 3QKCA 3IPIA 4WK5A 3B7LA 3P8RA 4E9ZA 3WCEA 5IKAA 3N46F 4P0WA 4UMJA 1VG6A 5DHIA 1N20A 3IBAA 4NFKF 5DJRF 4LXWA 3KRAA 4Q23A 4LZ0A 3ASXA 3N1WF 4GAXA 1HXAA 2ONGA 4H5EF 3WCBA 5E8HA 4DWBA 5B02A 2PS7A 1YHMA 4FJQA 2AZLA 4NUAA 1DI1A 4OGUA 1WL0A 4KQ5A 3OACA 3VJ8A 2OPNA 5DGSF 2EWGA 3AE0A 2E92A 2Z4WA 4F62A 3WEFA 1N1BA 3DYHA 3M01A 5ERNA 4KQUA 2AZKA 3ZL6A 1HX9A 4FP4A 4LTVA 4F6VA 3LLWA 5HNAA 3CKEA 3NF2A 3TFVA 5AYPA 3KBKA 4JXNA 1HXCA 3N45F 3ICZA 4RYPA 1WMWA 3Q1OA 3MZVA 3WE9A 3LGZB 3DYGA 5IMNA 4LLSA 1WL3A 3M00A 2Z4XA 2E8UA 4MC3A 5DGNF 1JFAA 3WCIA 3WCJA 2AELA 5ILKA 1JFGA 4H5DF 5IK6A 2PS5A 5B01A 2Z4ZA 2E95A 2Z50A 3LEEA 4EA0A 4LUUA 5EAUA 3M9UA 2ZEVA 3NPRA 4N1ZF 3WEIA 4OKZA 1HM4A 2I19A 3N49F 4HD1A 3TFPA 1WL2A 3VJDA 5A0IA 2ZY1A 5EASA 2E4OA 3OABA 5JV2F 2Z4YA 5B0IA 5IL3A 4KKMA 2OPMA 3LDWA 5AFXA 5IVGA 3KRAB 3ICKA 2PS8A 5IMIA 4MC0A 4KWDA 3WSAA 1WL1A 4NG6A 5IKHA 1RQJA 5ILZA 3UCAA 3WCMA 2ZCOA 5EATA 3KRCB 4F6XA 1KIZA 1YV5A 3PKOA 1V4IA 5C05A 3KB9A 3G4DA 3OACB 3AQ0A 4LIXA 3PYBA 5DW7A 5B0KA 2Z78A 3ZCDA 4JZBA 4K10A 5KSXF 3Q30A 1V4HA 4LOBA 3M0GA 3LVSA 3WEHA 3LOMA 2F9KF 3TS7A 4XQTF 3N0GA 1WKZA 2F8CF 3BNXA 4RNQA 4KVDA 5H9DA 3ZMCA 2Q9ZA 3W7FA 2OA6A 3TC1A 2E94A 3WJNA 2E8XA 3KRFA 3QQVA 2FTZA 2QISA 2E90A 3LZ9A 5JV0F 5CG6A 3N0FA 5B0JA 3PH7A 1YYQA 4LTZA 1PS1A 3ACXA 4EA1A 3N3LF 1YYTA 3V1XA 4KFAA 4LLTA 2FORA 4KK2A 4OKMA 3N6KF 3WCAA 1YYSA 2F7MF 4KUXA 4GP1A 2ZCRA 5HN8A 4LZCA 3SDTA 3KRPA 4KPDA 3WEKA 3EGTA 1V4JA 4KVWA 3RYEA 2AETA 5CG5A 1HM7A 2PS4A 4E9UA 3SDUA 4MC8A 2OGDA 3LJIA 3CP6A 2ONHA 1UBXA 3OABB 1VG4A 3RYWA 5DGMF 5IK9A 5IK0A 4L2XF 3VJBA 4JXYA 3WC9A 3WEJA 3V66A 5A0JA 5B0LA 1V4EA 1YHKA 5DJPF 4H5CF 3VJEA 5ILJA 3N5JF 2E8TA 3ACWA 4KQSA 3Q2QA 3PDEA 3N5HF 4KVIA 1N1ZA 1ZW5A 4LPGF 3WJOA 5EROA 4QPFA 3P8LA 5B0MA 3CC9A 1YYUA 4KPJA 4LZ3A 5DHKA 3P5PA 2ZCQA 4RXAA 5DJVF 3Q2ZA 3NPKA 4PVYF 4DWGA 5A0KA 5HN7A 5DZ2A 3M02A 4LA6A 3KRFB 2J1OA 5HN9A 2F89F 4OMHA 3APZA 5AELA 5ER8A 2E8VA 3EZ3A 5ILDA 3WCFA 4LA5A 2F94F 5B00A 3SAEA 1KIYA 3KROA 3BNYA 2Z52A 3N3DA 3VJ9A 5JUZF 1N22A 4GP2A 3AQBB 3ICMA 1UBVA 2VF6A 2Z7HA 3KRPB 5IL8A 4GA3A 5ILIA 4LPHF 5E8KA 2Q80A 3ZMBA 4N9UA 1VG3A 1FPSA 1RTRA 3WCGA 4DI5A 3PYAA 4XQRF 3EFQA
chains in the Genus database with same CATH topology
1DGPA 3NRIA 4XQSF 5IN8A 4NFJF 3SDQA 2J1PA 4JZXA 4JVJF 2Z4VA 3ZOUA 3LGKA 1UBYA 3LG5A 3KRCA 1N23A 3AQCB 4P0XA 2J5CA 3P41A 1WY0A 3RBMA 3N1VF 1EZFA 3WCHA 4DEMF 3LK5A 4E1EA 2AEKA 3V1VA 3SDVA 4P0VA 5ILHA 2Z7IA 3ID0A 5DIQF 4RXDA 1YQ7A 4NKEA 2H8OA 4KVYA 3WEGA 2DH4A 4PVXF 5IMPA 5I1UA 5ERMA 3MAVA 5IM1A 1VG2A 3LMDA 2ZEUA 4NKFA 3DYFA 1RQIA 4DXJA 5AHUB 1N24A 1YYRA 3WSBA 4DZWA 4ZQ8A 1V4KA 2E93A 3KROB 1VG7A 4RXEA 4EA2A 3VJAA 3WCCA 4LFVF 5JA0F 3ACYA 1YHLA 2E91A 2AZJA 1YJ4A 2F8ZF 4LFEA 4LFGA 2Q58A 1UBWA 2Q9YA 1HXGA 3SDRA 5E8LA 2PS6A 4QXSF 3P5RA 2ZCSA 3RMGA 5JV1F 5ILYA 2RAHA 3G4FA 3VJCA 3ADZA 2O1OA 4RXCA 4OMGA 3WCLA 2P1CA 3TFNA 3S9VA 4DHDA 3S4JA 4NFIF 1N21A 3ICNA 2F92F 3WCDA 3OYRA 2E8WA 4JYXA 5B03A 3LSNA 3WJKA 3QKCA 3IPIA 4WK5A 3B7LA 3P8RA 4E9ZA 3WCEA 5IKAA 3N46F 4P0WA 4UMJA 1VG6A 5DHIA 1N20A 3IBAA 4NFKF 5DJRF 4LXWA 3KRAA 4Q23A 4LZ0A 3ASXA 3N1WF 4GAXA 1HXAA 2ONGA 4H5EF 3WCBA 5E8HA 4DWBA 5B02A 2PS7A 1YHMA 4FJQA 2AZLA 4NUAA 1DI1A 4OGUA 1WL0A 4KQ5A 3OACA 3VJ8A 2OPNA 5DGSF 2EWGA 3AE0A 2E92A 2Z4WA 4F62A 3WEFA 1N1BA 3DYHA 3M01A 5ERNA 4KQUA 2AZKA 3ZL6A 1HX9A 4FP4A 4LTVA 4F6VA 3LLWA 5HNAA 3CKEA 3NF2A 3TFVA 5AYPA 3KBKA 4JXNA 1HXCA 3N45F 3ICZA 4RYPA 1WMWA 3Q1OA 3MZVA 3WE9A 3LGZB 3DYGA 5IMNA 4LLSA 1WL3A 3M00A 2Z4XA 2E8UA 4MC3A 5DGNF 1JFAA 3WCIA 3WCJA 2AELA 5ILKA 1JFGA 4H5DF 5IK6A 2PS5A 5B01A 2Z4ZA 2E95A 2Z50A 3LEEA 4EA0A 4LUUA 5EAUA 3M9UA 2ZEVA 3NPRA 4N1ZF 3WEIA 4OKZA 1HM4A 2I19A 3N49F 4HD1A 3TFPA 1WL2A 3VJDA 5A0IA 2ZY1A 5EASA 2E4OA 3OABA 5JV2F 2Z4YA 5B0IA 5IL3A 4KKMA 2OPMA 3LDWA 5AFXA 5IVGA 3KRAB 3ICKA 2PS8A 5IMIA 4MC0A 4KWDA 3WSAA 1WL1A 4NG6A 5IKHA 1RQJA 5ILZA 3UCAA 3WCMA 2ZCOA 5EATA 3KRCB 4F6XA 1KIZA 1YV5A 3PKOA 1V4IA 5C05A 3KB9A 3G4DA 3OACB 3AQ0A 4LIXA 3PYBA 5DW7A 5B0KA 2Z78A 3ZCDA 4JZBA 4K10A 5KSXF 3Q30A 1V4HA 4LOBA 3M0GA 3LVSA 3WEHA 3LOMA 2F9KF 3TS7A 4XQTF 3N0GA 1WKZA 2F8CF 3BNXA 4RNQA 4KVDA 5H9DA 3ZMCA 2Q9ZA 3W7FA 2OA6A 3TC1A 2E94A 3WJNA 2E8XA 3KRFA 3QQVA 2FTZA 2QISA 2E90A 3LZ9A 5JV0F 5CG6A 3N0FA 5B0JA 3PH7A 1YYQA 4LTZA 1PS1A 3ACXA 4EA1A 3N3LF 1YYTA 3V1XA 4KFAA 4LLTA 2FORA 4KK2A 4OKMA 3N6KF 3WCAA 1YYSA 2F7MF 4KUXA 4GP1A 2ZCRA 5HN8A 4LZCA 3SDTA 3KRPA 4KPDA 3WEKA 3EGTA 1V4JA 4KVWA 3RYEA 2AETA 5CG5A 1HM7A 2PS4A 4E9UA 3SDUA 4MC8A 2OGDA 3LJIA 3CP6A 2ONHA 1UBXA 3OABB 1VG4A 3RYWA 5DGMF 5IK9A 5IK0A 4L2XF 3VJBA 4JXYA 3WC9A 3WEJA 3V66A 5A0JA 5B0LA 1V4EA 1YHKA 5DJPF 4H5CF 3VJEA 5ILJA 3N5JF 2E8TA 3ACWA 4KQSA 3Q2QA 3PDEA 3N5HF 4KVIA 1N1ZA 1ZW5A 4LPGF 3WJOA 5EROA 4QPFA 3P8LA 5B0MA 3CC9A 1YYUA 4KPJA 4LZ3A 5DHKA 3P5PA 2ZCQA 4RXAA 5DJVF 3Q2ZA 3NPKA 4PVYF 4DWGA 5A0KA 5HN7A 5DZ2A 3M02A 4LA6A 3KRFB 2J1OA 5HN9A 2F89F 4OMHA 3APZA 5AELA 5ER8A 2E8VA 3EZ3A 5ILDA 3WCFA 4LA5A 2F94F 5B00A 3SAEA 1KIYA 3KROA 3BNYA 2Z52A 3N3DA 3VJ9A 5JUZF 1N22A 4GP2A 3AQBB 3ICMA 1UBVA 2VF6A 2Z7HA 3KRPB 5IL8A 4GA3A 5ILIA 4LPHF 5E8KA 2Q80A 3ZMBA 4N9UA 1VG3A 1FPSA 1RTRA 3WCGA 4DI5A 3PYAA 4XQRF 3EFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGP A;  3NRI A;  4XQS F;  5IN8 A;  4NFJ F;  3SDQ A;  2J1P A;  4JZX A;  4JVJ F;  2Z4V A;  3ZOU A;  3LGK A;  1UBY A;  3LG5 A;  3KRC A;  1N23 A;  3AQC B;  4P0X A;  2J5C A;  3P41 A;  1WY0 A;  3RBM A;  3N1V F;  1EZF A;  3WCH A;  4DEM F;  3LK5 A;  4E1E A;  2AEK A;  3V1V A;  3SDV A;  4P0V A;  5ILH A;  2Z7I A;  3ID0 A;  5DIQ F;  4RXD A;  1YQ7 A;  4NKE A;  2H8O A;  4KVY A;  3WEG A;  2DH4 A;  4PVX F;  5IMP A;  5I1U A;  5ERM A;  3MAV A;  5IM1 A;  1VG2 A;  3LMD A;  2ZEU A;  4NKF A;  3DYF A;  1RQI A;  4DXJ A;  5AHU B;  1N24 A;  1YYR A;  3WSB A;  4DZW A;  4ZQ8 A;  1V4K A;  2E93 A;  3KRO B;  1VG7 A;  4RXE A;  4EA2 A;  3VJA A;  3WCC A;  4LFV F;  5JA0 F;  3ACY A;  1YHL A;  2E91 A;  2AZJ A;  1YJ4 A;  2F8Z F;  4LFE A;  4LFG A;  2Q58 A;  1UBW A;  2Q9Y A;  1HXG A;  3SDR A;  5E8L A;  2PS6 A;  4QXS F;  3P5R A;  2ZCS A;  3RMG A;  5JV1 F;  5ILY A;  2RAH A;  3G4F A;  3VJC A;  3ADZ A;  2O1O A;  4RXC A;  4OMG A;  3WCL A;  2P1C A;  3TFN A;  3S9V A;  4DHD A;  3S4J A;  4NFI F;  1N21 A;  3ICN A;  2F92 F;  3WCD A;  3OYR A;  2E8W A;  4JYX A;  5B03 A;  3LSN A;  3WJK A;  3QKC A;  3IPI A;  4WK5 A;  3B7L A;  3P8R A;  4E9Z A;  3WCE A;  5IKA A;  3N46 F;  4P0W A;  4UMJ A;  1VG6 A;  5DHI A;  1N20 A;  3IBA A;  4NFK F;  5DJR F;  4LXW A;  3KRA A;  4Q23 A;  4LZ0 A;  3ASX A;  3N1W F;  4GAX A;  1HXA A;  2ONG A;  4H5E F;  3WCB A;  5E8H A;  4DWB A;  5B02 A;  2PS7 A;  1YHM A;  4FJQ A;  2AZL A;  4NUA A;  1DI1 A;  4OGU A;  1WL0 A;  4KQ5 A;  3OAC A;  3VJ8 A;  2OPN A;  5DGS F;  2EWG A;  3AE0 A;  2E92 A;  2Z4W A;  4F62 A;  3WEF A;  1N1B A;  3DYH A;  3M01 A;  5ERN A;  4KQU A;  2AZK A;  3ZL6 A;  1HX9 A;  4FP4 A;  4LTV A;  4F6V A;  3LLW A;  5HNA A;  3CKE A;  3NF2 A;  3TFV A;  5AYP A;  3KBK A;  4JXN A;  1HXC A;  3N45 F;  3ICZ A;  4RYP A;  1WMW A;  3Q1O A;  3MZV A;  3WE9 A;  3LGZ B;  3DYG A;  5IMN A;  4LLS A;  1WL3 A;  3M00 A;  2Z4X A;  2E8U A;  4MC3 A;  5DGN F;  1JFA A;  3WCI A;  3WCJ A;  2AEL A;  5ILK A;  1JFG A;  4H5D F;  5IK6 A;  2PS5 A;  5B01 A;  2Z4Z A;  2E95 A;  2Z50 A;  3LEE A;  4EA0 A;  4LUU A;  5EAU A;  3M9U A;  2ZEV A;  3NPR A;  4N1Z F;  3WEI A;  4OKZ A;  1HM4 A;  2I19 A;  3N49 F;  4HD1 A;  3TFP A;  1WL2 A;  3VJD A;  5A0I A;  2ZY1 A;  5EAS A;  2E4O A;  3OAB A;  5JV2 F;  2Z4Y A;  5B0I A;  5IL3 A;  4KKM A;  2OPM A;  3LDW A;  5AFX A;  5IVG A;  3KRA B;  3ICK A;  2PS8 A;  5IMI A;  4MC0 A;  4KWD A;  3WSA A;  1WL1 A;  4NG6 A;  5IKH A;  1RQJ A;  5ILZ A;  3UCA A;  3WCM A;  2ZCO A;  5EAT A;  3KRC B;  4F6X A;  1KIZ A;  1YV5 A;  3PKO A;  1V4I A;  5C05 A;  3KB9 A;  3G4D A;  3OAC B;  3AQ0 A;  4LIX A;  3PYB A;  5DW7 A;  5B0K A;  2Z78 A;  3ZCD A;  4JZB A;  4K10 A;  5KSX F;  3Q30 A;  1V4H A;  4LOB A;  3M0G A;  3LVS A;  3WEH A;  3LOM A;  2F9K F;  3TS7 A;  4XQT F;  3N0G A;  1WKZ A;  2F8C F;  3BNX A;  4RNQ A;  4KVD A;  5H9D A;  3ZMC A;  2Q9Z A;  3W7F A;  2OA6 A;  3TC1 A;  2E94 A;  3WJN A;  2E8X A;  3KRF A;  3QQV A;  2FTZ A;  2QIS A;  2E90 A;  3LZ9 A;  5JV0 F;  5CG6 A;  3N0F A;  5B0J A;  3PH7 A;  1YYQ A;  4LTZ A;  1PS1 A;  3ACX A;  4EA1 A;  3N3L F;  1YYT A;  3V1X A;  4KFA A;  4LLT A;  2FOR A;  4KK2 A;  4OKM A;  3N6K F;  3WCA A;  1YYS A;  2F7M F;  4KUX A;  4GP1 A;  2ZCR A;  5HN8 A;  4LZC A;  3SDT A;  3KRP A;  4KPD A;  3WEK A;  3EGT A;  1V4J A;  4KVW A;  3RYE A;  2AET A;  5CG5 A;  1HM7 A;  2PS4 A;  4E9U A;  3SDU A;  4MC8 A;  2OGD A;  3LJI A;  3CP6 A;  2ONH A;  1UBX A;  3OAB B;  1VG4 A;  3RYW A;  5DGM F;  5IK9 A;  5IK0 A;  4L2X F;  3VJB A;  4JXY A;  3WC9 A;  3WEJ A;  3V66 A;  5A0J A;  5B0L A;  1V4E A;  1YHK A;  5DJP F;  4H5C F;  3VJE A;  5ILJ A;  3N5J F;  2E8T A;  3ACW A;  4KQS A;  3Q2Q A;  3PDE A;  3N5H F;  4KVI A;  1N1Z A;  1ZW5 A;  4LPG F;  3WJO A;  5ERO A;  4QPF A;  3P8L A;  5B0M A;  3CC9 A;  1YYU A;  4KPJ A;  4LZ3 A;  5DHK A;  3P5P A;  2ZCQ A;  4RXA A;  5DJV F;  3Q2Z A;  3NPK A;  4PVY F;  4DWG A;  5A0K A;  5HN7 A;  5DZ2 A;  3M02 A;  4LA6 A;  3KRF B;  2J1O A;  5HN9 A;  2F89 F;  4OMH A;  3APZ A;  5AEL A;  5ER8 A;  2E8V A;  3EZ3 A;  5ILD A;  3WCF A;  4LA5 A;  2F94 F;  5B00 A;  3SAE A;  1KIY A;  3KRO A;  3BNY A;  2Z52 A;  3N3D A;  3VJ9 A;  5JUZ F;  1N22 A;  4GP2 A;  3AQB B;  3ICM A;  1UBV A;  2VF6 A;  2Z7H A;  3KRP B;  5IL8 A;  4GA3 A;  5ILI A;  4LPH F;  5E8K A;  2Q80 A;  3ZMB A;  4N9U A;  1VG3 A;  1FPS A;  1RTR A;  3WCG A;  4DI5 A;  3PYA A;  4XQR F;  3EFQ A; 
#chains in the Genus database with same CATH topology
 1DGP A;  3NRI A;  4XQS F;  5IN8 A;  4NFJ F;  3SDQ A;  2J1P A;  4JZX A;  4JVJ F;  2Z4V A;  3ZOU A;  3LGK A;  1UBY A;  3LG5 A;  3KRC A;  1N23 A;  3AQC B;  4P0X A;  2J5C A;  3P41 A;  1WY0 A;  3RBM A;  3N1V F;  1EZF A;  3WCH A;  4DEM F;  3LK5 A;  4E1E A;  2AEK A;  3V1V A;  3SDV A;  4P0V A;  5ILH A;  2Z7I A;  3ID0 A;  5DIQ F;  4RXD A;  1YQ7 A;  4NKE A;  2H8O A;  4KVY A;  3WEG A;  2DH4 A;  4PVX F;  5IMP A;  5I1U A;  5ERM A;  3MAV A;  5IM1 A;  1VG2 A;  3LMD A;  2ZEU A;  4NKF A;  3DYF A;  1RQI A;  4DXJ A;  5AHU B;  1N24 A;  1YYR A;  3WSB A;  4DZW A;  4ZQ8 A;  1V4K A;  2E93 A;  3KRO B;  1VG7 A;  4RXE A;  4EA2 A;  3VJA A;  3WCC A;  4LFV F;  5JA0 F;  3ACY A;  1YHL A;  2E91 A;  2AZJ A;  1YJ4 A;  2F8Z F;  4LFE A;  4LFG A;  2Q58 A;  1UBW A;  2Q9Y A;  1HXG A;  3SDR A;  5E8L A;  2PS6 A;  4QXS F;  3P5R A;  2ZCS A;  3RMG A;  5JV1 F;  5ILY A;  2RAH A;  3G4F A;  3VJC A;  3ADZ A;  2O1O A;  4RXC A;  4OMG A;  3WCL A;  2P1C A;  3TFN A;  3S9V A;  4DHD A;  3S4J A;  4NFI F;  1N21 A;  3ICN A;  2F92 F;  3WCD A;  3OYR A;  2E8W A;  4JYX A;  5B03 A;  3LSN A;  3WJK A;  3QKC A;  3IPI A;  4WK5 A;  3B7L A;  3P8R A;  4E9Z A;  3WCE A;  5IKA A;  3N46 F;  4P0W A;  4UMJ A;  1VG6 A;  5DHI A;  1N20 A;  3IBA A;  4NFK F;  5DJR F;  4LXW A;  3KRA A;  4Q23 A;  4LZ0 A;  3ASX A;  3N1W F;  4GAX A;  1HXA A;  2ONG A;  4H5E F;  3WCB A;  5E8H A;  4DWB A;  5B02 A;  2PS7 A;  1YHM A;  4FJQ A;  2AZL A;  4NUA A;  1DI1 A;  4OGU A;  1WL0 A;  4KQ5 A;  3OAC A;  3VJ8 A;  2OPN A;  5DGS F;  2EWG A;  3AE0 A;  2E92 A;  2Z4W A;  4F62 A;  3WEF A;  1N1B A;  3DYH A;  3M01 A;  5ERN A;  4KQU A;  2AZK A;  3ZL6 A;  1HX9 A;  4FP4 A;  4LTV A;  4F6V A;  3LLW A;  5HNA A;  3CKE A;  3NF2 A;  3TFV A;  5AYP A;  3KBK A;  4JXN A;  1HXC A;  3N45 F;  3ICZ A;  4RYP A;  1WMW A;  3Q1O A;  3MZV A;  3WE9 A;  3LGZ B;  3DYG A;  5IMN A;  4LLS A;  1WL3 A;  3M00 A;  2Z4X A;  2E8U A;  4MC3 A;  5DGN F;  1JFA A;  3WCI A;  3WCJ A;  2AEL A;  5ILK A;  1JFG A;  4H5D F;  5IK6 A;  2PS5 A;  5B01 A;  2Z4Z A;  2E95 A;  2Z50 A;  3LEE A;  4EA0 A;  4LUU A;  5EAU A;  3M9U A;  2ZEV A;  3NPR A;  4N1Z F;  3WEI A;  4OKZ A;  1HM4 A;  2I19 A;  3N49 F;  4HD1 A;  3TFP A;  1WL2 A;  3VJD A;  5A0I A;  2ZY1 A;  5EAS A;  2E4O A;  3OAB A;  5JV2 F;  2Z4Y A;  5B0I A;  5IL3 A;  4KKM A;  2OPM A;  3LDW A;  5AFX A;  5IVG A;  3KRA B;  3ICK A;  2PS8 A;  5IMI A;  4MC0 A;  4KWD A;  3WSA A;  1WL1 A;  4NG6 A;  5IKH A;  1RQJ A;  5ILZ A;  3UCA A;  3WCM A;  2ZCO A;  5EAT A;  3KRC B;  4F6X A;  1KIZ A;  1YV5 A;  3PKO A;  1V4I A;  5C05 A;  3KB9 A;  3G4D A;  3OAC B;  3AQ0 A;  4LIX A;  3PYB A;  5DW7 A;  5B0K A;  2Z78 A;  3ZCD A;  4JZB A;  4K10 A;  5KSX F;  3Q30 A;  1V4H A;  4LOB A;  3M0G A;  3LVS A;  3WEH A;  3LOM A;  2F9K F;  3TS7 A;  4XQT F;  3N0G A;  1WKZ A;  2F8C F;  3BNX A;  4RNQ A;  4KVD A;  5H9D A;  3ZMC A;  2Q9Z A;  3W7F A;  2OA6 A;  3TC1 A;  2E94 A;  3WJN A;  2E8X A;  3KRF A;  3QQV A;  2FTZ A;  2QIS A;  2E90 A;  3LZ9 A;  5JV0 F;  5CG6 A;  3N0F A;  5B0J A;  3PH7 A;  1YYQ A;  4LTZ A;  1PS1 A;  3ACX A;  4EA1 A;  3N3L F;  1YYT A;  3V1X A;  4KFA A;  4LLT A;  2FOR A;  4KK2 A;  4OKM A;  3N6K F;  3WCA A;  1YYS A;  2F7M F;  4KUX A;  4GP1 A;  2ZCR A;  5HN8 A;  4LZC A;  3SDT A;  3KRP A;  4KPD A;  3WEK A;  3EGT A;  1V4J A;  4KVW A;  3RYE A;  2AET A;  5CG5 A;  1HM7 A;  2PS4 A;  4E9U A;  3SDU A;  4MC8 A;  2OGD A;  3LJI A;  3CP6 A;  2ONH A;  1UBX A;  3OAB B;  1VG4 A;  3RYW A;  5DGM F;  5IK9 A;  5IK0 A;  4L2X F;  3VJB A;  4JXY A;  3WC9 A;  3WEJ A;  3V66 A;  5A0J A;  5B0L A;  1V4E A;  1YHK A;  5DJP F;  4H5C F;  3VJE A;  5ILJ A;  3N5J F;  2E8T A;  3ACW A;  4KQS A;  3Q2Q A;  3PDE A;  3N5H F;  4KVI A;  1N1Z A;  1ZW5 A;  4LPG F;  3WJO A;  5ERO A;  4QPF A;  3P8L A;  5B0M A;  3CC9 A;  1YYU A;  4KPJ A;  4LZ3 A;  5DHK A;  3P5P A;  2ZCQ A;  4RXA A;  5DJV F;  3Q2Z A;  3NPK A;  4PVY F;  4DWG A;  5A0K A;  5HN7 A;  5DZ2 A;  3M02 A;  4LA6 A;  3KRF B;  2J1O A;  5HN9 A;  2F89 F;  4OMH A;  3APZ A;  5AEL A;  5ER8 A;  2E8V A;  3EZ3 A;  5ILD A;  3WCF A;  4LA5 A;  2F94 F;  5B00 A;  3SAE A;  1KIY A;  3KRO A;  3BNY A;  2Z52 A;  3N3D A;  3VJ9 A;  5JUZ F;  1N22 A;  4GP2 A;  3AQB B;  3ICM A;  1UBV A;  2VF6 A;  2Z7H A;  3KRP B;  5IL8 A;  4GA3 A;  5ILI A;  4LPH F;  5E8K A;  2Q80 A;  3ZMB A;  4N9U A;  1VG3 A;  1FPS A;  1RTR A;  3WCG A;  4DI5 A;  3PYA A;  4XQR F;  3EFQ A; 
#chains in the Genus database with same CATH homology
 1DGP A;  3NRI A;  4XQS F;  5IN8 A;  4NFJ F;  3SDQ A;  2J1P A;  4JZX A;  4JVJ F;  2Z4V A;  3ZOU A;  3LGK A;  1UBY A;  3LG5 A;  3KRC A;  1N23 A;  3AQC B;  4P0X A;  2J5C A;  3P41 A;  1WY0 A;  3RBM A;  3N1V F;  1EZF A;  3WCH A;  4DEM F;  3LK5 A;  4E1E A;  2AEK A;  3V1V A;  3SDV A;  4P0V A;  5ILH A;  2Z7I A;  3ID0 A;  5DIQ F;  4RXD A;  1YQ7 A;  4NKE A;  2H8O A;  4KVY A;  3WEG A;  2DH4 A;  4PVX F;  5IMP A;  5I1U A;  5ERM A;  3MAV A;  5IM1 A;  1VG2 A;  3LMD A;  2ZEU A;  4NKF A;  3DYF A;  1RQI A;  4DXJ A;  5AHU B;  1N24 A;  1YYR A;  3WSB A;  4DZW A;  4ZQ8 A;  1V4K A;  2E93 A;  3KRO B;  1VG7 A;  4RXE A;  4EA2 A;  3VJA A;  3WCC A;  4LFV F;  5JA0 F;  3ACY A;  1YHL A;  2E91 A;  2AZJ A;  1YJ4 A;  2F8Z F;  4LFE A;  4LFG A;  2Q58 A;  1UBW A;  2Q9Y A;  1HXG A;  3SDR A;  5E8L A;  2PS6 A;  4QXS F;  3P5R A;  2ZCS A;  3RMG A;  5JV1 F;  5ILY A;  2RAH A;  3G4F A;  3VJC A;  3ADZ A;  2O1O A;  4RXC A;  4OMG A;  3WCL A;  2P1C A;  3TFN A;  3S9V A;  4DHD A;  3S4J A;  4NFI F;  1N21 A;  3ICN A;  2F92 F;  3WCD A;  3OYR A;  2E8W A;  4JYX A;  5B03 A;  3LSN A;  3WJK A;  3QKC A;  3IPI A;  4WK5 A;  3B7L A;  3P8R A;  4E9Z A;  3WCE A;  5IKA A;  3N46 F;  4P0W A;  4UMJ A;  1VG6 A;  5DHI A;  1N20 A;  3IBA A;  4NFK F;  5DJR F;  4LXW A;  3KRA A;  4Q23 A;  4LZ0 A;  3ASX A;  3N1W F;  4GAX A;  1HXA A;  2ONG A;  4H5E F;  3WCB A;  5E8H A;  4DWB A;  5B02 A;  2PS7 A;  1YHM A;  4FJQ A;  2AZL A;  4NUA A;  1DI1 A;  4OGU A;  1WL0 A;  4KQ5 A;  3OAC A;  3VJ8 A;  2OPN A;  5DGS F;  2EWG A;  3AE0 A;  2E92 A;  2Z4W A;  4F62 A;  3WEF A;  1N1B A;  3DYH A;  3M01 A;  5ERN A;  4KQU A;  2AZK A;  3ZL6 A;  1HX9 A;  4FP4 A;  4LTV A;  4F6V A;  3LLW A;  5HNA A;  3CKE A;  3NF2 A;  3TFV A;  5AYP A;  3KBK A;  4JXN A;  1HXC A;  3N45 F;  3ICZ A;  4RYP A;  1WMW A;  3Q1O A;  3MZV A;  3WE9 A;  3LGZ B;  3DYG A;  5IMN A;  4LLS A;  1WL3 A;  3M00 A;  2Z4X A;  2E8U A;  4MC3 A;  5DGN F;  1JFA A;  3WCI A;  3WCJ A;  2AEL A;  5ILK A;  1JFG A;  4H5D F;  5IK6 A;  2PS5 A;  5B01 A;  2Z4Z A;  2E95 A;  2Z50 A;  3LEE A;  4EA0 A;  4LUU A;  5EAU A;  3M9U A;  2ZEV A;  3NPR A;  4N1Z F;  3WEI A;  4OKZ A;  1HM4 A;  2I19 A;  3N49 F;  4HD1 A;  3TFP A;  1WL2 A;  3VJD A;  5A0I A;  2ZY1 A;  5EAS A;  2E4O A;  3OAB A;  5JV2 F;  2Z4Y A;  5B0I A;  5IL3 A;  4KKM A;  2OPM A;  3LDW A;  5AFX A;  5IVG A;  3KRA B;  3ICK A;  2PS8 A;  5IMI A;  4MC0 A;  4KWD A;  3WSA A;  1WL1 A;  4NG6 A;  5IKH A;  1RQJ A;  5ILZ A;  3UCA A;  3WCM A;  2ZCO A;  5EAT A;  3KRC B;  4F6X A;  1KIZ A;  1YV5 A;  3PKO A;  1V4I A;  5C05 A;  3KB9 A;  3G4D A;  3OAC B;  3AQ0 A;  4LIX A;  3PYB A;  5DW7 A;  5B0K A;  2Z78 A;  3ZCD A;  4JZB A;  4K10 A;  5KSX F;  3Q30 A;  1V4H A;  4LOB A;  3M0G A;  3LVS A;  3WEH A;  3LOM A;  2F9K F;  3TS7 A;  4XQT F;  3N0G A;  1WKZ A;  2F8C F;  3BNX A;  4RNQ A;  4KVD A;  5H9D A;  3ZMC A;  2Q9Z A;  3W7F A;  2OA6 A;  3TC1 A;  2E94 A;  3WJN A;  2E8X A;  3KRF A;  3QQV A;  2FTZ A;  2QIS A;  2E90 A;  3LZ9 A;  5JV0 F;  5CG6 A;  3N0F A;  5B0J A;  3PH7 A;  1YYQ A;  4LTZ A;  1PS1 A;  3ACX A;  4EA1 A;  3N3L F;  1YYT A;  3V1X A;  4KFA A;  4LLT A;  2FOR A;  4KK2 A;  4OKM A;  3N6K F;  3WCA A;  1YYS A;  2F7M F;  4KUX A;  4GP1 A;  2ZCR A;  5HN8 A;  4LZC A;  3SDT A;  3KRP A;  4KPD A;  3WEK A;  3EGT A;  1V4J A;  4KVW A;  3RYE A;  2AET A;  5CG5 A;  1HM7 A;  2PS4 A;  4E9U A;  3SDU A;  4MC8 A;  2OGD A;  3LJI A;  3CP6 A;  2ONH A;  1UBX A;  3OAB B;  1VG4 A;  3RYW A;  5DGM F;  5IK9 A;  5IK0 A;  4L2X F;  3VJB A;  4JXY A;  3WC9 A;  3WEJ A;  3V66 A;  5A0J A;  5B0L A;  1V4E A;  1YHK A;  5DJP F;  4H5C F;  3VJE A;  5ILJ A;  3N5J F;  2E8T A;  3ACW A;  4KQS A;  3Q2Q A;  3PDE A;  3N5H F;  4KVI A;  1N1Z A;  1ZW5 A;  4LPG F;  3WJO A;  5ERO A;  4QPF A;  3P8L A;  5B0M A;  3CC9 A;  1YYU A;  4KPJ A;  4LZ3 A;  5DHK A;  3P5P A;  2ZCQ A;  4RXA A;  5DJV F;  3Q2Z A;  3NPK A;  4PVY F;  4DWG A;  5A0K A;  5HN7 A;  5DZ2 A;  3M02 A;  4LA6 A;  3KRF B;  2J1O A;  5HN9 A;  2F89 F;  4OMH A;  3APZ A;  5AEL A;  5ER8 A;  2E8V A;  3EZ3 A;  5ILD A;  3WCF A;  4LA5 A;  2F94 F;  5B00 A;  3SAE A;  1KIY A;  3KRO A;  3BNY A;  2Z52 A;  3N3D A;  3VJ9 A;  5JUZ F;  1N22 A;  4GP2 A;  3AQB B;  3ICM A;  1UBV A;  2VF6 A;  2Z7H A;  3KRP B;  5IL8 A;  4GA3 A;  5ILI A;  4LPH F;  5E8K A;  2Q80 A;  3ZMB A;  4N9U A;  1VG3 A;  1FPS A;  1RTR A;  3WCG A;  4DI5 A;  3PYA A;  4XQR F;  3EFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...