3PKOA

Crystal structure of geranylgeranyl pyrophosphate synthase from lactobacillus brevis atcc 367 complexed with citrate
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
332
structure length
331
Chain Sequence
AHHHHHHSLRQLWRQFPQVEPQLTALQDYLLRTVQLDNQPIHHKILALLKSGGKLLRPGYFYLFSTFGNAATPAQLQAGAAAIEILHVGTLIHDDVIDDSPTRRGVRTIQMTYGQRNAIYAGDFMFTVYFDQVLKSTTDRSLIQNHIDAMHRILQGELHQMDLNYREDITLDAYLNEIAGKTAELFALSCYQGAQLAGAPQSVIDRTRDIGIAIGCAYQMLDDILDYAGDPKRTQKPVLEDLRSGVYSLPLLLSLSHAPRDFHKLLKKKQAMTLEDIKHVQALVAQYDGVGAAKQLAQDYTDRALTLIQQLPVGSAQQSLEQLTRLLLRRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl pyrophosphate synthase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Transferase
total genus 136
structure length 331
sequence length 332
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3pkoA00
4RXEA 2E90A 1N20A 3LEEA 2E8WA 3KB9A 4UMJA 2E8TA 4P0WA 4K10A 1N1ZA 3NRIA 2AEKA 2F7MF 1V4EA 1RTRA 3EZ3A 2O1OA 4EA2A 2J1OA 5ILIA 1YYSA 4OMHA 2ZCRA 3DYFA 5ILZA 3N5HF 1RQIA 4KK2A 3KRAA 5A0JA 3WJOA 3VJAA 3BNYA 3KRCA 4H5CF 4FJQA 3WCCA 5JV0F 3WJKA 4DEMF 1HM7A 3M02A 3WJNA 3LOMA 2Q58A 4KQSA 4LIXA 4E9UA 5C05A 4N1ZF 1N1BA 3N45F 1YYUA 5B0MA 4NG6A 3ZL6A 5EATA 4F6XA 5CG6A 5ILYA 3P8LA 4DWBA 1N23A 1FPSA 4GP2A 3RBMA 5HN7A 4LFGA 5E8HA 1WL1A 5AFXA 2Q9ZA 4Q23A 1JFGA 3MZVA 1YJ4A 3VJ9A 1KIYA 2AZJA 2VF6A 2Z4WA 5ILHA 2ONHA 4EA0A 3AQCB 5IKHA 2OPNA 3AE0A 5HN8A 3WEFA 2FTZA 2Z50A 4JYXA 5JA0F 3RYEA 5I1UA 3VJ8A 1V4HA 2ZCOA 3M01A 3CP6A 1YHKA 2EWGA 5EROA 3M00A 1V4IA 2I19A 5IK6A 3CKEA 4LFVF 3RMGA 1UBWA 5B01A 4E1EA 3RYWA 1VG7A 3P8RA 5ERNA 4QXSF 3V1VA 3ZOUA 5IKAA 4XQTF 4JVJF 1YV5A 1HM4A 1V4JA 4LZCA 4OKZA 2Q80A 2E92A 3M9UA 5IVGA 1DGPA 2E93A 5A0KA 4FP4A 3N1WF 2F89F 3BNXA 4DHDA 1JFAA 2F8CF 1YHMA 1VG3A 2AELA 3P41A 4E9ZA 5JV2F 3WSBA 4DXJA 3P5RA 4JZBA 4XQRF 1HXCA 2F92F 4NFJF 3UCAA 4NUAA 3N46F 4LPGF 3WCIA 4MC8A 3WCBA 5DIQF 3ACYA 3APZA 3WCEA 4F6VA 5IN8A 2DH4A 4RNQA 3SDRA 5CG5A 3Q2QA 3N1VF 1UBYA 3S9VA 3AQ0A 2Z4YA 3PH7A 4LA6A 5DJPF 5EASA 1WKZA 3N3DA 1WY0A 5E8LA 3N6KF 2E8VA 3IBAA 3NPKA 4WK5A 4GAXA 5EAUA 4LUUA 3OABB 3SDUA 3LGKA 5DZ2A 3LDWA 2Z78A 3KROB 2ZY1A 4MC3A 3N0FA 4LLSA 4LFEA 3WCLA 4H5DF 2Z4XA 5IL3A 3EFQA 3DYGA 5IMPA 3WCDA 3SDTA 3KRFB 2OPMA 1YQ7A 5AHUB 3LSNA 2E4OA 2Z7HA 5IK0A 5HN9A 3ICNA 4DZWA 4OGUA 2H8OA 3OACB 1VG2A 5IMNA 2Z4VA 2E94A 4L2XF 3G4DA 1YYTA 4GA3A 3TS7A 5HNAA 2F9KF 1UBXA 4KUXA 3B7LA 3EGTA 4PVYF 3SDVA 3LG5A 2PS7A 3N3LF 2RAHA 4KFAA 4KPJA 3CC9A 1N22A 5JUZF 4QPFA 3N0GA 4F62A 3ADZA 3WEJA 5ILKA 2Z4ZA 3ASXA 3WCAA 4HD1A 5B0KA 2F8ZF 3OABA 3ID0A 3PYAA 4LOBA 3KRPB 5B0JA 5DGSF 3WCGA 5B00A 4RXAA 3ZCDA 5ILDA 3ICKA 3WEKA 1YHLA 1WL0A 1PS1A 3VJEA 4LTZA 2PS5A 3KRFA 4ZQ8A 3TFPA 2QISA 3ICMA 4NKFA 4DWGA 3S4JA 3NPRA 3Q1OA 3OACA 4LLTA 3M0GA 2E8XA 3QQVA 2ZEVA 4JXNA 2F94F 5DHIA 5E8KA 3WCHA 3ICZA 3WSAA 5JV1F 4MC0A 3OYRA 3ZMCA 3LGZB 2AZKA 3QKCA 4LPHF 4KQ5A 3N49F 3WCJA 2Z52A 4GP1A 3IPIA 1YYRA 3KBKA 4LA5A 4PVXF 5ER8A 1N21A 3W7FA 2ONGA 3WEGA 5B03A 5IMIA 2E91A 3LZ9A 3KRPA 4NFKF 1YYQA 3ACXA 3G4FA 1WL2A 2PS4A 4RYPA 1HXAA 5IK9A 2PS8A 4H5EF 3VJDA 2ZCQA 5DW7A 5B0LA 3LLWA 2Z7IA 3TC1A 2J5CA 2E8UA 4LZ3A 5DJVF 5DHKA 3WEIA 2AZLA 3Q30A 3AQBB 1WMWA 3LK5A 3TFNA 4KKMA 2J1PA 4RXDA 4P0XA 3VJCA 4LXWA 2OA6A 4KVDA 2AETA 3WC9A 5B02A 3V1XA 1UBVA 4XQSF 4OMGA 1VG4A 5AELA 5KSXF 2Q9YA 3N5JF 4EA1A 4JXYA 1WL3A 1HX9A 5B0IA 1ZW5A 1DI1A 1VG6A 2E95A 1RQJA 1EZFA 2ZEUA 4NFIF 4LZ0A 5IL8A 3WE9A 3P5PA 3PYBA 4RXCA 4OKMA 4LTVA 1HXGA 3KRAB 5ERMA 5DGMF 3KROA 5AYPA 4JZXA 1KIZA 3LMDA 3PDEA 3KRCB 3SAEA 3MAVA 3NF2A 5ILJA 4P0VA 4KWDA 3VJBA 2FORA 3SDQA 5DGNF 3V66A 3DYHA 3ACWA 4DI5A 4KVWA 4KPDA 5IM1A 4NKEA 4N9UA 3WEHA 3Q2ZA 3LJIA 2P1CA 3ZMBA 2PS6A 3TFVA 2ZCSA 3WCFA 5DJRF 5H9DA 1N24A 4KQUA 4KVYA 3LVSA 5A0IA 2OGDA 3WCMA 1V4KA 4KVIA 3PKOA
chains in the Genus database with same CATH superfamily
4RXEA 2E90A 1N20A 3LEEA 2E8WA 3KB9A 4UMJA 2E8TA 4P0WA 4K10A 1N1ZA 3NRIA 2AEKA 2F7MF 1V4EA 1RTRA 3EZ3A 2O1OA 4EA2A 2J1OA 5ILIA 1YYSA 4OMHA 2ZCRA 3DYFA 5ILZA 3N5HF 1RQIA 4KK2A 3KRAA 5A0JA 3WJOA 3VJAA 3BNYA 3KRCA 4H5CF 4FJQA 3WCCA 5JV0F 3WJKA 4DEMF 1HM7A 3M02A 3WJNA 3LOMA 2Q58A 4KQSA 4LIXA 4E9UA 5C05A 4N1ZF 1N1BA 3N45F 1YYUA 5B0MA 4NG6A 3ZL6A 5EATA 4F6XA 5CG6A 5ILYA 3P8LA 4DWBA 1N23A 1FPSA 4GP2A 3RBMA 5HN7A 4LFGA 5E8HA 1WL1A 5AFXA 2Q9ZA 4Q23A 1JFGA 3MZVA 1YJ4A 3VJ9A 1KIYA 2AZJA 2VF6A 2Z4WA 5ILHA 2ONHA 4EA0A 3AQCB 5IKHA 2OPNA 3AE0A 5HN8A 3WEFA 2FTZA 2Z50A 4JYXA 5JA0F 3RYEA 5I1UA 3VJ8A 1V4HA 2ZCOA 3M01A 3CP6A 1YHKA 2EWGA 5EROA 3M00A 1V4IA 2I19A 5IK6A 3CKEA 4LFVF 3RMGA 1UBWA 5B01A 4E1EA 3RYWA 1VG7A 3P8RA 5ERNA 4QXSF 3V1VA 3ZOUA 5IKAA 4XQTF 4JVJF 1YV5A 1HM4A 1V4JA 4LZCA 4OKZA 2Q80A 2E92A 3M9UA 5IVGA 1DGPA 2E93A 5A0KA 4FP4A 3N1WF 2F89F 3BNXA 4DHDA 1JFAA 2F8CF 1YHMA 1VG3A 2AELA 3P41A 4E9ZA 5JV2F 3WSBA 4DXJA 3P5RA 4JZBA 4XQRF 1HXCA 2F92F 4NFJF 3UCAA 4NUAA 3N46F 4LPGF 3WCIA 4MC8A 3WCBA 5DIQF 3ACYA 3APZA 3WCEA 4F6VA 5IN8A 2DH4A 4RNQA 3SDRA 5CG5A 3Q2QA 3N1VF 1UBYA 3S9VA 3AQ0A 2Z4YA 3PH7A 4LA6A 5DJPF 5EASA 1WKZA 3N3DA 1WY0A 5E8LA 3N6KF 2E8VA 3IBAA 3NPKA 4WK5A 4GAXA 5EAUA 4LUUA 3OABB 3SDUA 3LGKA 5DZ2A 3LDWA 2Z78A 3KROB 2ZY1A 4MC3A 3N0FA 4LLSA 4LFEA 3WCLA 4H5DF 2Z4XA 5IL3A 3EFQA 3DYGA 5IMPA 3WCDA 3SDTA 3KRFB 2OPMA 1YQ7A 5AHUB 3LSNA 2E4OA 2Z7HA 5IK0A 5HN9A 3ICNA 4DZWA 4OGUA 2H8OA 3OACB 1VG2A 5IMNA 2Z4VA 2E94A 4L2XF 3G4DA 1YYTA 4GA3A 3TS7A 5HNAA 2F9KF 1UBXA 4KUXA 3B7LA 3EGTA 4PVYF 3SDVA 3LG5A 2PS7A 3N3LF 2RAHA 4KFAA 4KPJA 3CC9A 1N22A 5JUZF 4QPFA 3N0GA 4F62A 3ADZA 3WEJA 5ILKA 2Z4ZA 3ASXA 3WCAA 4HD1A 5B0KA 2F8ZF 3OABA 3ID0A 3PYAA 4LOBA 3KRPB 5B0JA 5DGSF 3WCGA 5B00A 4RXAA 3ZCDA 5ILDA 3ICKA 3WEKA 1YHLA 1WL0A 1PS1A 3VJEA 4LTZA 2PS5A 3KRFA 4ZQ8A 3TFPA 2QISA 3ICMA 4NKFA 4DWGA 3S4JA 3NPRA 3Q1OA 3OACA 4LLTA 3M0GA 2E8XA 3QQVA 2ZEVA 4JXNA 2F94F 5DHIA 5E8KA 3WCHA 3ICZA 3WSAA 5JV1F 4MC0A 3OYRA 3ZMCA 3LGZB 2AZKA 3QKCA 4LPHF 4KQ5A 3N49F 3WCJA 2Z52A 4GP1A 3IPIA 1YYRA 3KBKA 4LA5A 4PVXF 5ER8A 1N21A 3W7FA 2ONGA 3WEGA 5B03A 5IMIA 2E91A 3LZ9A 3KRPA 4NFKF 1YYQA 3ACXA 3G4FA 1WL2A 2PS4A 4RYPA 1HXAA 5IK9A 2PS8A 4H5EF 3VJDA 2ZCQA 5DW7A 5B0LA 3LLWA 2Z7IA 3TC1A 2J5CA 2E8UA 4LZ3A 5DJVF 5DHKA 3WEIA 2AZLA 3Q30A 3AQBB 1WMWA 3LK5A 3TFNA 4KKMA 2J1PA 4RXDA 4P0XA 3VJCA 4LXWA 2OA6A 4KVDA 2AETA 3WC9A 5B02A 3V1XA 1UBVA 4XQSF 4OMGA 1VG4A 5AELA 5KSXF 2Q9YA 3N5JF 4EA1A 4JXYA 1WL3A 1HX9A 5B0IA 1ZW5A 1DI1A 1VG6A 2E95A 1RQJA 1EZFA 2ZEUA 4NFIF 4LZ0A 5IL8A 3WE9A 3P5PA 3PYBA 4RXCA 4OKMA 4LTVA 1HXGA 3KRAB 5ERMA 5DGMF 3KROA 5AYPA 4JZXA 1KIZA 3LMDA 3PDEA 3KRCB 3SAEA 3MAVA 3NF2A 5ILJA 4P0VA 4KWDA 3VJBA 2FORA 3SDQA 5DGNF 3V66A 3DYHA 3ACWA 4DI5A 4KVWA 4KPDA 5IM1A 4NKEA 4N9UA 3WEHA 3Q2ZA 3LJIA 2P1CA 3ZMBA 2PS6A 3TFVA 2ZCSA 3WCFA 5DJRF 5H9DA 1N24A 4KQUA 4KVYA 3LVSA 5A0IA 2OGDA 3WCMA 1V4KA 4KVIA 3PKOA
chains in the Genus database with same CATH topology
4RXEA 2E90A 1N20A 3LEEA 2E8WA 3KB9A 4UMJA 2E8TA 4P0WA 4K10A 1N1ZA 3NRIA 2AEKA 2F7MF 1V4EA 1RTRA 3EZ3A 2O1OA 4EA2A 2J1OA 5ILIA 1YYSA 4OMHA 2ZCRA 3DYFA 5ILZA 3N5HF 1RQIA 4KK2A 3KRAA 5A0JA 3WJOA 3VJAA 3BNYA 3KRCA 4H5CF 4FJQA 3WCCA 5JV0F 3WJKA 4DEMF 1HM7A 3M02A 3WJNA 3LOMA 2Q58A 4KQSA 4LIXA 4E9UA 5C05A 4N1ZF 1N1BA 3N45F 1YYUA 5B0MA 4NG6A 3ZL6A 5EATA 4F6XA 5CG6A 5ILYA 3P8LA 4DWBA 1N23A 1FPSA 4GP2A 3RBMA 5HN7A 4LFGA 5E8HA 1WL1A 5AFXA 2Q9ZA 4Q23A 1JFGA 3MZVA 1YJ4A 3VJ9A 1KIYA 2AZJA 2VF6A 2Z4WA 5ILHA 2ONHA 4EA0A 3AQCB 5IKHA 2OPNA 3AE0A 5HN8A 3WEFA 2FTZA 2Z50A 4JYXA 5JA0F 3RYEA 5I1UA 3VJ8A 1V4HA 2ZCOA 3M01A 3CP6A 1YHKA 2EWGA 5EROA 3M00A 1V4IA 2I19A 5IK6A 3CKEA 4LFVF 3RMGA 1UBWA 5B01A 4E1EA 3RYWA 1VG7A 3P8RA 5ERNA 4QXSF 3V1VA 3ZOUA 5IKAA 4XQTF 4JVJF 1YV5A 1HM4A 1V4JA 4LZCA 4OKZA 2Q80A 2E92A 3M9UA 5IVGA 1DGPA 2E93A 5A0KA 4FP4A 3N1WF 2F89F 3BNXA 4DHDA 1JFAA 2F8CF 1YHMA 1VG3A 2AELA 3P41A 4E9ZA 5JV2F 3WSBA 4DXJA 3P5RA 4JZBA 4XQRF 1HXCA 2F92F 4NFJF 3UCAA 4NUAA 3N46F 4LPGF 3WCIA 4MC8A 3WCBA 5DIQF 3ACYA 3APZA 3WCEA 4F6VA 5IN8A 2DH4A 4RNQA 3SDRA 5CG5A 3Q2QA 3N1VF 1UBYA 3S9VA 3AQ0A 2Z4YA 3PH7A 4LA6A 5DJPF 5EASA 1WKZA 3N3DA 1WY0A 5E8LA 3N6KF 2E8VA 3IBAA 3NPKA 4WK5A 4GAXA 5EAUA 4LUUA 3OABB 3SDUA 3LGKA 5DZ2A 3LDWA 2Z78A 3KROB 2ZY1A 4MC3A 3N0FA 4LLSA 4LFEA 3WCLA 4H5DF 2Z4XA 5IL3A 3EFQA 3DYGA 5IMPA 3WCDA 3SDTA 3KRFB 2OPMA 1YQ7A 5AHUB 3LSNA 2E4OA 2Z7HA 5IK0A 5HN9A 3ICNA 4DZWA 4OGUA 2H8OA 3OACB 1VG2A 5IMNA 2Z4VA 2E94A 4L2XF 3G4DA 1YYTA 4GA3A 3TS7A 5HNAA 2F9KF 1UBXA 4KUXA 3B7LA 3EGTA 4PVYF 3SDVA 3LG5A 2PS7A 3N3LF 2RAHA 4KFAA 4KPJA 3CC9A 1N22A 5JUZF 4QPFA 3N0GA 4F62A 3ADZA 3WEJA 5ILKA 2Z4ZA 3ASXA 3WCAA 4HD1A 5B0KA 2F8ZF 3OABA 3ID0A 3PYAA 4LOBA 3KRPB 5B0JA 5DGSF 3WCGA 5B00A 4RXAA 3ZCDA 5ILDA 3ICKA 3WEKA 1YHLA 1WL0A 1PS1A 3VJEA 4LTZA 2PS5A 3KRFA 4ZQ8A 3TFPA 2QISA 3ICMA 4NKFA 4DWGA 3S4JA 3NPRA 3Q1OA 3OACA 4LLTA 3M0GA 2E8XA 3QQVA 2ZEVA 4JXNA 2F94F 5DHIA 5E8KA 3WCHA 3ICZA 3WSAA 5JV1F 4MC0A 3OYRA 3ZMCA 3LGZB 2AZKA 3QKCA 4LPHF 4KQ5A 3N49F 3WCJA 2Z52A 4GP1A 3IPIA 1YYRA 3KBKA 4LA5A 4PVXF 5ER8A 1N21A 3W7FA 2ONGA 3WEGA 5B03A 5IMIA 2E91A 3LZ9A 3KRPA 4NFKF 1YYQA 3ACXA 3G4FA 1WL2A 2PS4A 4RYPA 1HXAA 5IK9A 2PS8A 4H5EF 3VJDA 2ZCQA 5DW7A 5B0LA 3LLWA 2Z7IA 3TC1A 2J5CA 2E8UA 4LZ3A 5DJVF 5DHKA 3WEIA 2AZLA 3Q30A 3AQBB 1WMWA 3LK5A 3TFNA 4KKMA 2J1PA 4RXDA 4P0XA 3VJCA 4LXWA 2OA6A 4KVDA 2AETA 3WC9A 5B02A 3V1XA 1UBVA 4XQSF 4OMGA 1VG4A 5AELA 5KSXF 2Q9YA 3N5JF 4EA1A 4JXYA 1WL3A 1HX9A 5B0IA 1ZW5A 1DI1A 1VG6A 2E95A 1RQJA 1EZFA 2ZEUA 4NFIF 4LZ0A 5IL8A 3WE9A 3P5PA 3PYBA 4RXCA 4OKMA 4LTVA 1HXGA 3KRAB 5ERMA 5DGMF 3KROA 5AYPA 4JZXA 1KIZA 3LMDA 3PDEA 3KRCB 3SAEA 3MAVA 3NF2A 5ILJA 4P0VA 4KWDA 3VJBA 2FORA 3SDQA 5DGNF 3V66A 3DYHA 3ACWA 4DI5A 4KVWA 4KPDA 5IM1A 4NKEA 4N9UA 3WEHA 3Q2ZA 3LJIA 2P1CA 3ZMBA 2PS6A 3TFVA 2ZCSA 3WCFA 5DJRF 5H9DA 1N24A 4KQUA 4KVYA 3LVSA 5A0IA 2OGDA 3WCMA 1V4KA 4KVIA 3PKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RXE A;  2E90 A;  1N20 A;  3LEE A;  2E8W A;  3KB9 A;  4UMJ A;  2E8T A;  4P0W A;  4K10 A;  1N1Z A;  3NRI A;  2AEK A;  2F7M F;  1V4E A;  1RTR A;  3EZ3 A;  2O1O A;  4EA2 A;  2J1O A;  5ILI A;  1YYS A;  4OMH A;  2ZCR A;  3DYF A;  5ILZ A;  3N5H F;  1RQI A;  4KK2 A;  3KRA A;  5A0J A;  3WJO A;  3VJA A;  3BNY A;  3KRC A;  4H5C F;  4FJQ A;  3WCC A;  5JV0 F;  3WJK A;  4DEM F;  1HM7 A;  3M02 A;  3WJN A;  3LOM A;  2Q58 A;  4KQS A;  4LIX A;  4E9U A;  5C05 A;  4N1Z F;  1N1B A;  3N45 F;  1YYU A;  5B0M A;  4NG6 A;  3ZL6 A;  5EAT A;  4F6X A;  5CG6 A;  5ILY A;  3P8L A;  4DWB A;  1N23 A;  1FPS A;  4GP2 A;  3RBM A;  5HN7 A;  4LFG A;  5E8H A;  1WL1 A;  5AFX A;  2Q9Z A;  4Q23 A;  1JFG A;  3MZV A;  1YJ4 A;  3VJ9 A;  1KIY A;  2AZJ A;  2VF6 A;  2Z4W A;  5ILH A;  2ONH A;  4EA0 A;  3AQC B;  5IKH A;  2OPN A;  3AE0 A;  5HN8 A;  3WEF A;  2FTZ A;  2Z50 A;  4JYX A;  5JA0 F;  3RYE A;  5I1U A;  3VJ8 A;  1V4H A;  2ZCO A;  3M01 A;  3CP6 A;  1YHK A;  2EWG A;  5ERO A;  3M00 A;  1V4I A;  2I19 A;  5IK6 A;  3CKE A;  4LFV F;  3RMG A;  1UBW A;  5B01 A;  4E1E A;  3RYW A;  1VG7 A;  3P8R A;  5ERN A;  4QXS F;  3V1V A;  3ZOU A;  5IKA A;  4XQT F;  4JVJ F;  1YV5 A;  1HM4 A;  1V4J A;  4LZC A;  4OKZ A;  2Q80 A;  2E92 A;  3M9U A;  5IVG A;  1DGP A;  2E93 A;  5A0K A;  4FP4 A;  3N1W F;  2F89 F;  3BNX A;  4DHD A;  1JFA A;  2F8C F;  1YHM A;  1VG3 A;  2AEL A;  3P41 A;  4E9Z A;  5JV2 F;  3WSB A;  4DXJ A;  3P5R A;  4JZB A;  4XQR F;  1HXC A;  2F92 F;  4NFJ F;  3UCA A;  4NUA A;  3N46 F;  4LPG F;  3WCI A;  4MC8 A;  3WCB A;  5DIQ F;  3ACY A;  3APZ A;  3WCE A;  4F6V A;  5IN8 A;  2DH4 A;  4RNQ A;  3SDR A;  5CG5 A;  3Q2Q A;  3N1V F;  1UBY A;  3S9V A;  3AQ0 A;  2Z4Y A;  3PH7 A;  4LA6 A;  5DJP F;  5EAS A;  1WKZ A;  3N3D A;  1WY0 A;  5E8L A;  3N6K F;  2E8V A;  3IBA A;  3NPK A;  4WK5 A;  4GAX A;  5EAU A;  4LUU A;  3OAB B;  3SDU A;  3LGK A;  5DZ2 A;  3LDW A;  2Z78 A;  3KRO B;  2ZY1 A;  4MC3 A;  3N0F A;  4LLS A;  4LFE A;  3WCL A;  4H5D F;  2Z4X A;  5IL3 A;  3EFQ A;  3DYG A;  5IMP A;  3WCD A;  3SDT A;  3KRF B;  2OPM A;  1YQ7 A;  5AHU B;  3LSN A;  2E4O A;  2Z7H A;  5IK0 A;  5HN9 A;  3ICN A;  4DZW A;  4OGU A;  2H8O A;  3OAC B;  1VG2 A;  5IMN A;  2Z4V A;  2E94 A;  4L2X F;  3G4D A;  1YYT A;  4GA3 A;  3TS7 A;  5HNA A;  2F9K F;  1UBX A;  4KUX A;  3B7L A;  3EGT A;  4PVY F;  3SDV A;  3LG5 A;  2PS7 A;  3N3L F;  2RAH A;  4KFA A;  4KPJ A;  3CC9 A;  1N22 A;  5JUZ F;  4QPF A;  3N0G A;  4F62 A;  3ADZ A;  3WEJ A;  5ILK A;  2Z4Z A;  3ASX A;  3WCA A;  4HD1 A;  5B0K A;  2F8Z F;  3OAB A;  3ID0 A;  3PYA A;  4LOB A;  3KRP B;  5B0J A;  5DGS F;  3WCG A;  5B00 A;  4RXA A;  3ZCD A;  5ILD A;  3ICK A;  3WEK A;  1YHL A;  1WL0 A;  1PS1 A;  3VJE A;  4LTZ A;  2PS5 A;  3KRF A;  4ZQ8 A;  3TFP A;  2QIS A;  3ICM A;  4NKF A;  4DWG A;  3S4J A;  3NPR A;  3Q1O A;  3OAC A;  4LLT A;  3M0G A;  2E8X A;  3QQV A;  2ZEV A;  4JXN A;  2F94 F;  5DHI A;  5E8K A;  3WCH A;  3ICZ A;  3WSA A;  5JV1 F;  4MC0 A;  3OYR A;  3ZMC A;  3LGZ B;  2AZK A;  3QKC A;  4LPH F;  4KQ5 A;  3N49 F;  3WCJ A;  2Z52 A;  4GP1 A;  3IPI A;  1YYR A;  3KBK A;  4LA5 A;  4PVX F;  5ER8 A;  1N21 A;  3W7F A;  2ONG A;  3WEG A;  5B03 A;  5IMI A;  2E91 A;  3LZ9 A;  3KRP A;  4NFK F;  1YYQ A;  3ACX A;  3G4F A;  1WL2 A;  2PS4 A;  4RYP A;  1HXA A;  5IK9 A;  2PS8 A;  4H5E F;  3VJD A;  2ZCQ A;  5DW7 A;  5B0L A;  3LLW A;  2Z7I A;  3TC1 A;  2J5C A;  2E8U A;  4LZ3 A;  5DJV F;  5DHK A;  3WEI A;  2AZL A;  3Q30 A;  3AQB B;  1WMW A;  3LK5 A;  3TFN A;  4KKM A;  2J1P A;  4RXD A;  4P0X A;  3VJC A;  4LXW A;  2OA6 A;  4KVD A;  2AET A;  3WC9 A;  5B02 A;  3V1X A;  1UBV A;  4XQS F;  4OMG A;  1VG4 A;  5AEL A;  5KSX F;  2Q9Y A;  3N5J F;  4EA1 A;  4JXY A;  1WL3 A;  1HX9 A;  5B0I A;  1ZW5 A;  1DI1 A;  1VG6 A;  2E95 A;  1RQJ A;  1EZF A;  2ZEU A;  4NFI F;  4LZ0 A;  5IL8 A;  3WE9 A;  3P5P A;  3PYB A;  4RXC A;  4OKM A;  4LTV A;  1HXG A;  3KRA B;  5ERM A;  5DGM F;  3KRO A;  5AYP A;  4JZX A;  1KIZ A;  3LMD A;  3PDE A;  3KRC B;  3SAE A;  3MAV A;  3NF2 A;  5ILJ A;  4P0V A;  4KWD A;  3VJB A;  2FOR A;  3SDQ A;  5DGN F;  3V66 A;  3DYH A;  3ACW A;  4DI5 A;  4KVW A;  4KPD A;  5IM1 A;  4NKE A;  4N9U A;  3WEH A;  3Q2Z A;  3LJI A;  2P1C A;  3ZMB A;  2PS6 A;  3TFV A;  2ZCS A;  3WCF A;  5DJR F;  5H9D A;  1N24 A;  4KQU A;  4KVY A;  3LVS A;  5A0I A;  2OGD A;  3WCM A;  1V4K A;  4KVI A;  3PKO A; 
#chains in the Genus database with same CATH topology
 4RXE A;  2E90 A;  1N20 A;  3LEE A;  2E8W A;  3KB9 A;  4UMJ A;  2E8T A;  4P0W A;  4K10 A;  1N1Z A;  3NRI A;  2AEK A;  2F7M F;  1V4E A;  1RTR A;  3EZ3 A;  2O1O A;  4EA2 A;  2J1O A;  5ILI A;  1YYS A;  4OMH A;  2ZCR A;  3DYF A;  5ILZ A;  3N5H F;  1RQI A;  4KK2 A;  3KRA A;  5A0J A;  3WJO A;  3VJA A;  3BNY A;  3KRC A;  4H5C F;  4FJQ A;  3WCC A;  5JV0 F;  3WJK A;  4DEM F;  1HM7 A;  3M02 A;  3WJN A;  3LOM A;  2Q58 A;  4KQS A;  4LIX A;  4E9U A;  5C05 A;  4N1Z F;  1N1B A;  3N45 F;  1YYU A;  5B0M A;  4NG6 A;  3ZL6 A;  5EAT A;  4F6X A;  5CG6 A;  5ILY A;  3P8L A;  4DWB A;  1N23 A;  1FPS A;  4GP2 A;  3RBM A;  5HN7 A;  4LFG A;  5E8H A;  1WL1 A;  5AFX A;  2Q9Z A;  4Q23 A;  1JFG A;  3MZV A;  1YJ4 A;  3VJ9 A;  1KIY A;  2AZJ A;  2VF6 A;  2Z4W A;  5ILH A;  2ONH A;  4EA0 A;  3AQC B;  5IKH A;  2OPN A;  3AE0 A;  5HN8 A;  3WEF A;  2FTZ A;  2Z50 A;  4JYX A;  5JA0 F;  3RYE A;  5I1U A;  3VJ8 A;  1V4H A;  2ZCO A;  3M01 A;  3CP6 A;  1YHK A;  2EWG A;  5ERO A;  3M00 A;  1V4I A;  2I19 A;  5IK6 A;  3CKE A;  4LFV F;  3RMG A;  1UBW A;  5B01 A;  4E1E A;  3RYW A;  1VG7 A;  3P8R A;  5ERN A;  4QXS F;  3V1V A;  3ZOU A;  5IKA A;  4XQT F;  4JVJ F;  1YV5 A;  1HM4 A;  1V4J A;  4LZC A;  4OKZ A;  2Q80 A;  2E92 A;  3M9U A;  5IVG A;  1DGP A;  2E93 A;  5A0K A;  4FP4 A;  3N1W F;  2F89 F;  3BNX A;  4DHD A;  1JFA A;  2F8C F;  1YHM A;  1VG3 A;  2AEL A;  3P41 A;  4E9Z A;  5JV2 F;  3WSB A;  4DXJ A;  3P5R A;  4JZB A;  4XQR F;  1HXC A;  2F92 F;  4NFJ F;  3UCA A;  4NUA A;  3N46 F;  4LPG F;  3WCI A;  4MC8 A;  3WCB A;  5DIQ F;  3ACY A;  3APZ A;  3WCE A;  4F6V A;  5IN8 A;  2DH4 A;  4RNQ A;  3SDR A;  5CG5 A;  3Q2Q A;  3N1V F;  1UBY A;  3S9V A;  3AQ0 A;  2Z4Y A;  3PH7 A;  4LA6 A;  5DJP F;  5EAS A;  1WKZ A;  3N3D A;  1WY0 A;  5E8L A;  3N6K F;  2E8V A;  3IBA A;  3NPK A;  4WK5 A;  4GAX A;  5EAU A;  4LUU A;  3OAB B;  3SDU A;  3LGK A;  5DZ2 A;  3LDW A;  2Z78 A;  3KRO B;  2ZY1 A;  4MC3 A;  3N0F A;  4LLS A;  4LFE A;  3WCL A;  4H5D F;  2Z4X A;  5IL3 A;  3EFQ A;  3DYG A;  5IMP A;  3WCD A;  3SDT A;  3KRF B;  2OPM A;  1YQ7 A;  5AHU B;  3LSN A;  2E4O A;  2Z7H A;  5IK0 A;  5HN9 A;  3ICN A;  4DZW A;  4OGU A;  2H8O A;  3OAC B;  1VG2 A;  5IMN A;  2Z4V A;  2E94 A;  4L2X F;  3G4D A;  1YYT A;  4GA3 A;  3TS7 A;  5HNA A;  2F9K F;  1UBX A;  4KUX A;  3B7L A;  3EGT A;  4PVY F;  3SDV A;  3LG5 A;  2PS7 A;  3N3L F;  2RAH A;  4KFA A;  4KPJ A;  3CC9 A;  1N22 A;  5JUZ F;  4QPF A;  3N0G A;  4F62 A;  3ADZ A;  3WEJ A;  5ILK A;  2Z4Z A;  3ASX A;  3WCA A;  4HD1 A;  5B0K A;  2F8Z F;  3OAB A;  3ID0 A;  3PYA A;  4LOB A;  3KRP B;  5B0J A;  5DGS F;  3WCG A;  5B00 A;  4RXA A;  3ZCD A;  5ILD A;  3ICK A;  3WEK A;  1YHL A;  1WL0 A;  1PS1 A;  3VJE A;  4LTZ A;  2PS5 A;  3KRF A;  4ZQ8 A;  3TFP A;  2QIS A;  3ICM A;  4NKF A;  4DWG A;  3S4J A;  3NPR A;  3Q1O A;  3OAC A;  4LLT A;  3M0G A;  2E8X A;  3QQV A;  2ZEV A;  4JXN A;  2F94 F;  5DHI A;  5E8K A;  3WCH A;  3ICZ A;  3WSA A;  5JV1 F;  4MC0 A;  3OYR A;  3ZMC A;  3LGZ B;  2AZK A;  3QKC A;  4LPH F;  4KQ5 A;  3N49 F;  3WCJ A;  2Z52 A;  4GP1 A;  3IPI A;  1YYR A;  3KBK A;  4LA5 A;  4PVX F;  5ER8 A;  1N21 A;  3W7F A;  2ONG A;  3WEG A;  5B03 A;  5IMI A;  2E91 A;  3LZ9 A;  3KRP A;  4NFK F;  1YYQ A;  3ACX A;  3G4F A;  1WL2 A;  2PS4 A;  4RYP A;  1HXA A;  5IK9 A;  2PS8 A;  4H5E F;  3VJD A;  2ZCQ A;  5DW7 A;  5B0L A;  3LLW A;  2Z7I A;  3TC1 A;  2J5C A;  2E8U A;  4LZ3 A;  5DJV F;  5DHK A;  3WEI A;  2AZL A;  3Q30 A;  3AQB B;  1WMW A;  3LK5 A;  3TFN A;  4KKM A;  2J1P A;  4RXD A;  4P0X A;  3VJC A;  4LXW A;  2OA6 A;  4KVD A;  2AET A;  3WC9 A;  5B02 A;  3V1X A;  1UBV A;  4XQS F;  4OMG A;  1VG4 A;  5AEL A;  5KSX F;  2Q9Y A;  3N5J F;  4EA1 A;  4JXY A;  1WL3 A;  1HX9 A;  5B0I A;  1ZW5 A;  1DI1 A;  1VG6 A;  2E95 A;  1RQJ A;  1EZF A;  2ZEU A;  4NFI F;  4LZ0 A;  5IL8 A;  3WE9 A;  3P5P A;  3PYB A;  4RXC A;  4OKM A;  4LTV A;  1HXG A;  3KRA B;  5ERM A;  5DGM F;  3KRO A;  5AYP A;  4JZX A;  1KIZ A;  3LMD A;  3PDE A;  3KRC B;  3SAE A;  3MAV A;  3NF2 A;  5ILJ A;  4P0V A;  4KWD A;  3VJB A;  2FOR A;  3SDQ A;  5DGN F;  3V66 A;  3DYH A;  3ACW A;  4DI5 A;  4KVW A;  4KPD A;  5IM1 A;  4NKE A;  4N9U A;  3WEH A;  3Q2Z A;  3LJI A;  2P1C A;  3ZMB A;  2PS6 A;  3TFV A;  2ZCS A;  3WCF A;  5DJR F;  5H9D A;  1N24 A;  4KQU A;  4KVY A;  3LVS A;  5A0I A;  2OGD A;  3WCM A;  1V4K A;  4KVI A;  3PKO A; 
#chains in the Genus database with same CATH homology
 4RXE A;  2E90 A;  1N20 A;  3LEE A;  2E8W A;  3KB9 A;  4UMJ A;  2E8T A;  4P0W A;  4K10 A;  1N1Z A;  3NRI A;  2AEK A;  2F7M F;  1V4E A;  1RTR A;  3EZ3 A;  2O1O A;  4EA2 A;  2J1O A;  5ILI A;  1YYS A;  4OMH A;  2ZCR A;  3DYF A;  5ILZ A;  3N5H F;  1RQI A;  4KK2 A;  3KRA A;  5A0J A;  3WJO A;  3VJA A;  3BNY A;  3KRC A;  4H5C F;  4FJQ A;  3WCC A;  5JV0 F;  3WJK A;  4DEM F;  1HM7 A;  3M02 A;  3WJN A;  3LOM A;  2Q58 A;  4KQS A;  4LIX A;  4E9U A;  5C05 A;  4N1Z F;  1N1B A;  3N45 F;  1YYU A;  5B0M A;  4NG6 A;  3ZL6 A;  5EAT A;  4F6X A;  5CG6 A;  5ILY A;  3P8L A;  4DWB A;  1N23 A;  1FPS A;  4GP2 A;  3RBM A;  5HN7 A;  4LFG A;  5E8H A;  1WL1 A;  5AFX A;  2Q9Z A;  4Q23 A;  1JFG A;  3MZV A;  1YJ4 A;  3VJ9 A;  1KIY A;  2AZJ A;  2VF6 A;  2Z4W A;  5ILH A;  2ONH A;  4EA0 A;  3AQC B;  5IKH A;  2OPN A;  3AE0 A;  5HN8 A;  3WEF A;  2FTZ A;  2Z50 A;  4JYX A;  5JA0 F;  3RYE A;  5I1U A;  3VJ8 A;  1V4H A;  2ZCO A;  3M01 A;  3CP6 A;  1YHK A;  2EWG A;  5ERO A;  3M00 A;  1V4I A;  2I19 A;  5IK6 A;  3CKE A;  4LFV F;  3RMG A;  1UBW A;  5B01 A;  4E1E A;  3RYW A;  1VG7 A;  3P8R A;  5ERN A;  4QXS F;  3V1V A;  3ZOU A;  5IKA A;  4XQT F;  4JVJ F;  1YV5 A;  1HM4 A;  1V4J A;  4LZC A;  4OKZ A;  2Q80 A;  2E92 A;  3M9U A;  5IVG A;  1DGP A;  2E93 A;  5A0K A;  4FP4 A;  3N1W F;  2F89 F;  3BNX A;  4DHD A;  1JFA A;  2F8C F;  1YHM A;  1VG3 A;  2AEL A;  3P41 A;  4E9Z A;  5JV2 F;  3WSB A;  4DXJ A;  3P5R A;  4JZB A;  4XQR F;  1HXC A;  2F92 F;  4NFJ F;  3UCA A;  4NUA A;  3N46 F;  4LPG F;  3WCI A;  4MC8 A;  3WCB A;  5DIQ F;  3ACY A;  3APZ A;  3WCE A;  4F6V A;  5IN8 A;  2DH4 A;  4RNQ A;  3SDR A;  5CG5 A;  3Q2Q A;  3N1V F;  1UBY A;  3S9V A;  3AQ0 A;  2Z4Y A;  3PH7 A;  4LA6 A;  5DJP F;  5EAS A;  1WKZ A;  3N3D A;  1WY0 A;  5E8L A;  3N6K F;  2E8V A;  3IBA A;  3NPK A;  4WK5 A;  4GAX A;  5EAU A;  4LUU A;  3OAB B;  3SDU A;  3LGK A;  5DZ2 A;  3LDW A;  2Z78 A;  3KRO B;  2ZY1 A;  4MC3 A;  3N0F A;  4LLS A;  4LFE A;  3WCL A;  4H5D F;  2Z4X A;  5IL3 A;  3EFQ A;  3DYG A;  5IMP A;  3WCD A;  3SDT A;  3KRF B;  2OPM A;  1YQ7 A;  5AHU B;  3LSN A;  2E4O A;  2Z7H A;  5IK0 A;  5HN9 A;  3ICN A;  4DZW A;  4OGU A;  2H8O A;  3OAC B;  1VG2 A;  5IMN A;  2Z4V A;  2E94 A;  4L2X F;  3G4D A;  1YYT A;  4GA3 A;  3TS7 A;  5HNA A;  2F9K F;  1UBX A;  4KUX A;  3B7L A;  3EGT A;  4PVY F;  3SDV A;  3LG5 A;  2PS7 A;  3N3L F;  2RAH A;  4KFA A;  4KPJ A;  3CC9 A;  1N22 A;  5JUZ F;  4QPF A;  3N0G A;  4F62 A;  3ADZ A;  3WEJ A;  5ILK A;  2Z4Z A;  3ASX A;  3WCA A;  4HD1 A;  5B0K A;  2F8Z F;  3OAB A;  3ID0 A;  3PYA A;  4LOB A;  3KRP B;  5B0J A;  5DGS F;  3WCG A;  5B00 A;  4RXA A;  3ZCD A;  5ILD A;  3ICK A;  3WEK A;  1YHL A;  1WL0 A;  1PS1 A;  3VJE A;  4LTZ A;  2PS5 A;  3KRF A;  4ZQ8 A;  3TFP A;  2QIS A;  3ICM A;  4NKF A;  4DWG A;  3S4J A;  3NPR A;  3Q1O A;  3OAC A;  4LLT A;  3M0G A;  2E8X A;  3QQV A;  2ZEV A;  4JXN A;  2F94 F;  5DHI A;  5E8K A;  3WCH A;  3ICZ A;  3WSA A;  5JV1 F;  4MC0 A;  3OYR A;  3ZMC A;  3LGZ B;  2AZK A;  3QKC A;  4LPH F;  4KQ5 A;  3N49 F;  3WCJ A;  2Z52 A;  4GP1 A;  3IPI A;  1YYR A;  3KBK A;  4LA5 A;  4PVX F;  5ER8 A;  1N21 A;  3W7F A;  2ONG A;  3WEG A;  5B03 A;  5IMI A;  2E91 A;  3LZ9 A;  3KRP A;  4NFK F;  1YYQ A;  3ACX A;  3G4F A;  1WL2 A;  2PS4 A;  4RYP A;  1HXA A;  5IK9 A;  2PS8 A;  4H5E F;  3VJD A;  2ZCQ A;  5DW7 A;  5B0L A;  3LLW A;  2Z7I A;  3TC1 A;  2J5C A;  2E8U A;  4LZ3 A;  5DJV F;  5DHK A;  3WEI A;  2AZL A;  3Q30 A;  3AQB B;  1WMW A;  3LK5 A;  3TFN A;  4KKM A;  2J1P A;  4RXD A;  4P0X A;  3VJC A;  4LXW A;  2OA6 A;  4KVD A;  2AET A;  3WC9 A;  5B02 A;  3V1X A;  1UBV A;  4XQS F;  4OMG A;  1VG4 A;  5AEL A;  5KSX F;  2Q9Y A;  3N5J F;  4EA1 A;  4JXY A;  1WL3 A;  1HX9 A;  5B0I A;  1ZW5 A;  1DI1 A;  1VG6 A;  2E95 A;  1RQJ A;  1EZF A;  2ZEU A;  4NFI F;  4LZ0 A;  5IL8 A;  3WE9 A;  3P5P A;  3PYB A;  4RXC A;  4OKM A;  4LTV A;  1HXG A;  3KRA B;  5ERM A;  5DGM F;  3KRO A;  5AYP A;  4JZX A;  1KIZ A;  3LMD A;  3PDE A;  3KRC B;  3SAE A;  3MAV A;  3NF2 A;  5ILJ A;  4P0V A;  4KWD A;  3VJB A;  2FOR A;  3SDQ A;  5DGN F;  3V66 A;  3DYH A;  3ACW A;  4DI5 A;  4KVW A;  4KPD A;  5IM1 A;  4NKE A;  4N9U A;  3WEH A;  3Q2Z A;  3LJI A;  2P1C A;  3ZMB A;  2PS6 A;  3TFV A;  2ZCS A;  3WCF A;  5DJR F;  5H9D A;  1N24 A;  4KQU A;  4KVY A;  3LVS A;  5A0I A;  2OGD A;  3WCM A;  1V4K A;  4KVI A;  3PKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...