4F6XA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with bph-1112
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
284
structure length
281
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title HIV-1 Integrase Inhibitor-Inspired Antibacterials Targeting Isoprenoid Biosynthesis.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 113
structure length 281
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4f6xA00
5CG6A 1YV5A 4FP4A 3QKCA 3TFVA 2ZY1A 3VJ9A 3BNYA 4KVIA 3WCCA 3WJNA 1HM4A 1WL3A 1ZW5A 4LLSA 4LXWA 3KRCB 4LA5A 3OACA 4OKZA 3LK5A 3VJAA 2Z4VA 2Q58A 4LUUA 3SDQA 3WC9A 2F89F 5JV2F 3N0FA 4KKMA 3B7LA 2ZCSA 5IK6A 3ACYA 2AETA 1PS1A 1YHMA 3ADZA 4NUAA 2PS6A 2OPMA 3LVSA 4KVDA 1DI1A 3NF2A 5DHIA 5AYPA 1YHKA 4DI5A 3N3LF 4H5CF 1YYRA 3ZMCA 3ACXA 2J1PA 2EWGA 3DYFA 3WCIA 2FTZA 4UMJA 2E4OA 3N46F 5AHUB 5IL8A 2OGDA 1N22A 3ICMA 1KIYA 4QXSF 4E9UA 3KROB 2PS5A 1HXAA 3N5JF 5DZ2A 5EASA 1V4EA 3CP6A 3SAEA 2E95A 4JXNA 1V4HA 3SDTA 5IL3A 4RXDA 3PYBA 5DHKA 5B0MA 4KK2A 1YYTA 3VJCA 3M0GA 4NG6A 5ERMA 3WEHA 5CG5A 4Q23A 2F8ZF 3WSBA 2E8VA 3G4DA 3AE0A 1N1ZA 1WL1A 3P5PA 3WCLA 4LFVF 1HXCA 4F6VA 1RTRA 4RXAA 4WK5A 4K10A 3EZ3A 2F9KF 4LFGA 3VJEA 2OPNA 3OABB 2I19A 4OMHA 1HX9A 3P41A 5AELA 5E8LA 3WJOA 2P1CA 3LGKA 5C05A 5IKAA 4EA1A 3ZL6A 3P8RA 2Z78A 4LTVA 4MC3A 3LGZB 1YYQA 1RQIA 3WEKA 2J5CA 3OYRA 4KQUA 3N3DA 4KWDA 3M01A 3ICKA 4ZQ8A 3LOMA 5B0JA 3SDUA 3EFQA 5ILHA 4P0XA 5I1UA 5ERNA 2Z4WA 1VG2A 5B0KA 4GP1A 2Z7HA 4KVYA 5DJPF 4RYPA 1V4KA 3IBAA 4QPFA 2PS8A 5IMPA 4RXCA 4NFIF 1HM7A 3TS7A 1N21A 1KIZA 5JUZF 3KRAA 4H5DF 3P5RA 4LPGF 2E90A 3N49F 4MC8A 5A0IA 3WEIA 4LZ3A 2ONHA 3Q2ZA 4JYXA 2F94F 1YJ4A 3RBMA 1WMWA 3PKOA 4EA0A 4NFJF 3KRCA 1WKZA 3S9VA 4KFAA 2PS7A 5DGNF 4P0WA 4E1EA 5IK0A 3LZ9A 5B02A 5B0IA 5EROA 3LEEA 2RAHA 4HD1A 3WCAA 3N1VF 1JFGA 4LZCA 4N1ZF 3Q2QA 3VJDA 1UBYA 2Q80A 5DJRF 4RNQA 3PYAA 4KPJA 4NKFA 4RXEA 5IK9A 5ILYA 3DYGA 2AEKA 3Q30A 1VG4A 4P0VA 5IN8A 2ZEUA 5B03A 3Q1OA 2ZCOA 5JV0F 3NPKA 4GP2A 3MZVA 2E8TA 5ILJA 2ZCQA 4DZWA 4DHDA 5JV1F 2J1OA 2ONGA 3RMGA 3KRPB 2AZLA 5AFXA 4LLTA 2AELA 5IM1A 5H9DA 4NFKF 3KROA 1N24A 4PVYF 1DGPA 3TFNA 2OA6A 3ACWA 2E93A 3WCJA 3CKEA 1V4IA 4GAXA 3DYHA 4H5EF 4LOBA 3ZMBA 3LMDA 3AQBB 4LTZA 2E91A 5ILDA 3VJ8A 3WSAA 4F6XA 3LDWA 3KRFB 3TFPA 2AZKA 3PDEA 3V1XA 3EGTA 3ID0A 3ZOUA 5ER8A 1FPSA 3WE9A 5B0LA 1UBWA 3UCAA 4DXJA 3LJIA 2QISA 3NPRA 3W7FA 2ZCRA 3MAVA 5IMNA 3ICNA 4MC0A 5IMIA 4JXYA 5KSXF 4DWBA 2Q9YA 4XQTF 5HN8A 1VG7A 1UBXA 3OABA 1EZFA 3OACB 5EATA 3N45F 3WCBA 1YYSA 5HNAA 5DGSF 2Z50A 3KBKA 5DW7A 4PVXF 3M02A 5E8HA 2O1OA 5IVGA 4OMGA 3WEJA 2H8OA 1WY0A 3TC1A 5HN7A 2Z7IA 5ILIA 3LG5A 1UBVA 5JA0F 4LZ0A 4GA3A 3IPIA 2E8UA 3QQVA 4EA2A 4KVWA 4FJQA 3SDRA 3BNXA 2E92A 3M00A 5A0JA 4LIXA 2F92F 4JVJF 3WCDA 3AQCB 5ILKA 5DGMF 4KPDA 1N1BA 1VG3A 4E9ZA 3WEFA 2Z4ZA 3G4FA 3V66A 3WCMA 3LLWA 4LPHF 1YYUA 3N1WF 2F8CF 2PS4A 3PH7A 3RYWA 4KQSA 3N5HF 5B01A 2E8XA 2FORA 4NKEA 2ZEVA 3NRIA 3S4JA 5EAUA 4DWGA 4OKMA 2DH4A 3P8LA 1WL2A 4L2XF 3VJBA 1JFAA 3WCGA 1HXGA 4N9UA 5E8KA 3WCFA 2F7MF 1WL0A 4XQSF 3WEGA 3RYEA 1RQJA 2Q9ZA 3SDVA 5A0KA 3WJKA 1N20A 4OGUA 4F62A 5DIQF 3V1VA 5DJVF 3N6KF 2Z4XA 3N0GA 1YQ7A 3APZA 2Z52A 1VG6A 2AZJA 4XQRF 3WCHA 5IKHA 4KUXA 4JZXA 3KRPA 4KQ5A 5B00A 3ICZA 4DEMF 2Z4YA 4JZBA 4LA6A 2VF6A 1V4JA 5ILZA 3AQ0A 1N23A 5HN9A 3ZCDA 3LSNA 4LFEA 2E94A 1YHLA 3KB9A 2E8WA 3WCEA 3KRFA 3CC9A 3M9UA 3KRAB 3ASXA
chains in the Genus database with same CATH superfamily
5CG6A 1YV5A 4FP4A 3QKCA 3TFVA 2ZY1A 3VJ9A 3BNYA 4KVIA 3WCCA 3WJNA 1HM4A 1WL3A 1ZW5A 4LLSA 4LXWA 3KRCB 4LA5A 3OACA 4OKZA 3LK5A 3VJAA 2Z4VA 2Q58A 4LUUA 3SDQA 3WC9A 2F89F 5JV2F 3N0FA 4KKMA 3B7LA 2ZCSA 5IK6A 3ACYA 2AETA 1PS1A 1YHMA 3ADZA 4NUAA 2PS6A 2OPMA 3LVSA 4KVDA 1DI1A 3NF2A 5DHIA 5AYPA 1YHKA 4DI5A 3N3LF 4H5CF 1YYRA 3ZMCA 3ACXA 2J1PA 2EWGA 3DYFA 3WCIA 2FTZA 4UMJA 2E4OA 3N46F 5AHUB 5IL8A 2OGDA 1N22A 3ICMA 1KIYA 4QXSF 4E9UA 3KROB 2PS5A 1HXAA 3N5JF 5DZ2A 5EASA 1V4EA 3CP6A 3SAEA 2E95A 4JXNA 1V4HA 3SDTA 5IL3A 4RXDA 3PYBA 5DHKA 5B0MA 4KK2A 1YYTA 3VJCA 3M0GA 4NG6A 5ERMA 3WEHA 5CG5A 4Q23A 2F8ZF 3WSBA 2E8VA 3G4DA 3AE0A 1N1ZA 1WL1A 3P5PA 3WCLA 4LFVF 1HXCA 4F6VA 1RTRA 4RXAA 4WK5A 4K10A 3EZ3A 2F9KF 4LFGA 3VJEA 2OPNA 3OABB 2I19A 4OMHA 1HX9A 3P41A 5AELA 5E8LA 3WJOA 2P1CA 3LGKA 5C05A 5IKAA 4EA1A 3ZL6A 3P8RA 2Z78A 4LTVA 4MC3A 3LGZB 1YYQA 1RQIA 3WEKA 2J5CA 3OYRA 4KQUA 3N3DA 4KWDA 3M01A 3ICKA 4ZQ8A 3LOMA 5B0JA 3SDUA 3EFQA 5ILHA 4P0XA 5I1UA 5ERNA 2Z4WA 1VG2A 5B0KA 4GP1A 2Z7HA 4KVYA 5DJPF 4RYPA 1V4KA 3IBAA 4QPFA 2PS8A 5IMPA 4RXCA 4NFIF 1HM7A 3TS7A 1N21A 1KIZA 5JUZF 3KRAA 4H5DF 3P5RA 4LPGF 2E90A 3N49F 4MC8A 5A0IA 3WEIA 4LZ3A 2ONHA 3Q2ZA 4JYXA 2F94F 1YJ4A 3RBMA 1WMWA 3PKOA 4EA0A 4NFJF 3KRCA 1WKZA 3S9VA 4KFAA 2PS7A 5DGNF 4P0WA 4E1EA 5IK0A 3LZ9A 5B02A 5B0IA 5EROA 3LEEA 2RAHA 4HD1A 3WCAA 3N1VF 1JFGA 4LZCA 4N1ZF 3Q2QA 3VJDA 1UBYA 2Q80A 5DJRF 4RNQA 3PYAA 4KPJA 4NKFA 4RXEA 5IK9A 5ILYA 3DYGA 2AEKA 3Q30A 1VG4A 4P0VA 5IN8A 2ZEUA 5B03A 3Q1OA 2ZCOA 5JV0F 3NPKA 4GP2A 3MZVA 2E8TA 5ILJA 2ZCQA 4DZWA 4DHDA 5JV1F 2J1OA 2ONGA 3RMGA 3KRPB 2AZLA 5AFXA 4LLTA 2AELA 5IM1A 5H9DA 4NFKF 3KROA 1N24A 4PVYF 1DGPA 3TFNA 2OA6A 3ACWA 2E93A 3WCJA 3CKEA 1V4IA 4GAXA 3DYHA 4H5EF 4LOBA 3ZMBA 3LMDA 3AQBB 4LTZA 2E91A 5ILDA 3VJ8A 3WSAA 4F6XA 3LDWA 3KRFB 3TFPA 2AZKA 3PDEA 3V1XA 3EGTA 3ID0A 3ZOUA 5ER8A 1FPSA 3WE9A 5B0LA 1UBWA 3UCAA 4DXJA 3LJIA 2QISA 3NPRA 3W7FA 2ZCRA 3MAVA 5IMNA 3ICNA 4MC0A 5IMIA 4JXYA 5KSXF 4DWBA 2Q9YA 4XQTF 5HN8A 1VG7A 1UBXA 3OABA 1EZFA 3OACB 5EATA 3N45F 3WCBA 1YYSA 5HNAA 5DGSF 2Z50A 3KBKA 5DW7A 4PVXF 3M02A 5E8HA 2O1OA 5IVGA 4OMGA 3WEJA 2H8OA 1WY0A 3TC1A 5HN7A 2Z7IA 5ILIA 3LG5A 1UBVA 5JA0F 4LZ0A 4GA3A 3IPIA 2E8UA 3QQVA 4EA2A 4KVWA 4FJQA 3SDRA 3BNXA 2E92A 3M00A 5A0JA 4LIXA 2F92F 4JVJF 3WCDA 3AQCB 5ILKA 5DGMF 4KPDA 1N1BA 1VG3A 4E9ZA 3WEFA 2Z4ZA 3G4FA 3V66A 3WCMA 3LLWA 4LPHF 1YYUA 3N1WF 2F8CF 2PS4A 3PH7A 3RYWA 4KQSA 3N5HF 5B01A 2E8XA 2FORA 4NKEA 2ZEVA 3NRIA 3S4JA 5EAUA 4DWGA 4OKMA 2DH4A 3P8LA 1WL2A 4L2XF 3VJBA 1JFAA 3WCGA 1HXGA 4N9UA 5E8KA 3WCFA 2F7MF 1WL0A 4XQSF 3WEGA 3RYEA 1RQJA 2Q9ZA 3SDVA 5A0KA 3WJKA 1N20A 4OGUA 4F62A 5DIQF 3V1VA 5DJVF 3N6KF 2Z4XA 3N0GA 1YQ7A 3APZA 2Z52A 1VG6A 2AZJA 4XQRF 3WCHA 5IKHA 4KUXA 4JZXA 3KRPA 4KQ5A 5B00A 3ICZA 4DEMF 2Z4YA 4JZBA 4LA6A 2VF6A 1V4JA 5ILZA 3AQ0A 1N23A 5HN9A 3ZCDA 3LSNA 4LFEA 2E94A 1YHLA 3KB9A 2E8WA 3WCEA 3KRFA 3CC9A 3M9UA 3KRAB 3ASXA
chains in the Genus database with same CATH topology
5CG6A 1YV5A 4FP4A 3QKCA 3TFVA 2ZY1A 3VJ9A 3BNYA 4KVIA 3WCCA 3WJNA 1HM4A 1WL3A 1ZW5A 4LLSA 4LXWA 3KRCB 4LA5A 3OACA 4OKZA 3LK5A 3VJAA 2Z4VA 2Q58A 4LUUA 3SDQA 3WC9A 2F89F 5JV2F 3N0FA 4KKMA 3B7LA 2ZCSA 5IK6A 3ACYA 2AETA 1PS1A 1YHMA 3ADZA 4NUAA 2PS6A 2OPMA 3LVSA 4KVDA 1DI1A 3NF2A 5DHIA 5AYPA 1YHKA 4DI5A 3N3LF 4H5CF 1YYRA 3ZMCA 3ACXA 2J1PA 2EWGA 3DYFA 3WCIA 2FTZA 4UMJA 2E4OA 3N46F 5AHUB 5IL8A 2OGDA 1N22A 3ICMA 1KIYA 4QXSF 4E9UA 3KROB 2PS5A 1HXAA 3N5JF 5DZ2A 5EASA 1V4EA 3CP6A 3SAEA 2E95A 4JXNA 1V4HA 3SDTA 5IL3A 4RXDA 3PYBA 5DHKA 5B0MA 4KK2A 1YYTA 3VJCA 3M0GA 4NG6A 5ERMA 3WEHA 5CG5A 4Q23A 2F8ZF 3WSBA 2E8VA 3G4DA 3AE0A 1N1ZA 1WL1A 3P5PA 3WCLA 4LFVF 1HXCA 4F6VA 1RTRA 4RXAA 4WK5A 4K10A 3EZ3A 2F9KF 4LFGA 3VJEA 2OPNA 3OABB 2I19A 4OMHA 1HX9A 3P41A 5AELA 5E8LA 3WJOA 2P1CA 3LGKA 5C05A 5IKAA 4EA1A 3ZL6A 3P8RA 2Z78A 4LTVA 4MC3A 3LGZB 1YYQA 1RQIA 3WEKA 2J5CA 3OYRA 4KQUA 3N3DA 4KWDA 3M01A 3ICKA 4ZQ8A 3LOMA 5B0JA 3SDUA 3EFQA 5ILHA 4P0XA 5I1UA 5ERNA 2Z4WA 1VG2A 5B0KA 4GP1A 2Z7HA 4KVYA 5DJPF 4RYPA 1V4KA 3IBAA 4QPFA 2PS8A 5IMPA 4RXCA 4NFIF 1HM7A 3TS7A 1N21A 1KIZA 5JUZF 3KRAA 4H5DF 3P5RA 4LPGF 2E90A 3N49F 4MC8A 5A0IA 3WEIA 4LZ3A 2ONHA 3Q2ZA 4JYXA 2F94F 1YJ4A 3RBMA 1WMWA 3PKOA 4EA0A 4NFJF 3KRCA 1WKZA 3S9VA 4KFAA 2PS7A 5DGNF 4P0WA 4E1EA 5IK0A 3LZ9A 5B02A 5B0IA 5EROA 3LEEA 2RAHA 4HD1A 3WCAA 3N1VF 1JFGA 4LZCA 4N1ZF 3Q2QA 3VJDA 1UBYA 2Q80A 5DJRF 4RNQA 3PYAA 4KPJA 4NKFA 4RXEA 5IK9A 5ILYA 3DYGA 2AEKA 3Q30A 1VG4A 4P0VA 5IN8A 2ZEUA 5B03A 3Q1OA 2ZCOA 5JV0F 3NPKA 4GP2A 3MZVA 2E8TA 5ILJA 2ZCQA 4DZWA 4DHDA 5JV1F 2J1OA 2ONGA 3RMGA 3KRPB 2AZLA 5AFXA 4LLTA 2AELA 5IM1A 5H9DA 4NFKF 3KROA 1N24A 4PVYF 1DGPA 3TFNA 2OA6A 3ACWA 2E93A 3WCJA 3CKEA 1V4IA 4GAXA 3DYHA 4H5EF 4LOBA 3ZMBA 3LMDA 3AQBB 4LTZA 2E91A 5ILDA 3VJ8A 3WSAA 4F6XA 3LDWA 3KRFB 3TFPA 2AZKA 3PDEA 3V1XA 3EGTA 3ID0A 3ZOUA 5ER8A 1FPSA 3WE9A 5B0LA 1UBWA 3UCAA 4DXJA 3LJIA 2QISA 3NPRA 3W7FA 2ZCRA 3MAVA 5IMNA 3ICNA 4MC0A 5IMIA 4JXYA 5KSXF 4DWBA 2Q9YA 4XQTF 5HN8A 1VG7A 1UBXA 3OABA 1EZFA 3OACB 5EATA 3N45F 3WCBA 1YYSA 5HNAA 5DGSF 2Z50A 3KBKA 5DW7A 4PVXF 3M02A 5E8HA 2O1OA 5IVGA 4OMGA 3WEJA 2H8OA 1WY0A 3TC1A 5HN7A 2Z7IA 5ILIA 3LG5A 1UBVA 5JA0F 4LZ0A 4GA3A 3IPIA 2E8UA 3QQVA 4EA2A 4KVWA 4FJQA 3SDRA 3BNXA 2E92A 3M00A 5A0JA 4LIXA 2F92F 4JVJF 3WCDA 3AQCB 5ILKA 5DGMF 4KPDA 1N1BA 1VG3A 4E9ZA 3WEFA 2Z4ZA 3G4FA 3V66A 3WCMA 3LLWA 4LPHF 1YYUA 3N1WF 2F8CF 2PS4A 3PH7A 3RYWA 4KQSA 3N5HF 5B01A 2E8XA 2FORA 4NKEA 2ZEVA 3NRIA 3S4JA 5EAUA 4DWGA 4OKMA 2DH4A 3P8LA 1WL2A 4L2XF 3VJBA 1JFAA 3WCGA 1HXGA 4N9UA 5E8KA 3WCFA 2F7MF 1WL0A 4XQSF 3WEGA 3RYEA 1RQJA 2Q9ZA 3SDVA 5A0KA 3WJKA 1N20A 4OGUA 4F62A 5DIQF 3V1VA 5DJVF 3N6KF 2Z4XA 3N0GA 1YQ7A 3APZA 2Z52A 1VG6A 2AZJA 4XQRF 3WCHA 5IKHA 4KUXA 4JZXA 3KRPA 4KQ5A 5B00A 3ICZA 4DEMF 2Z4YA 4JZBA 4LA6A 2VF6A 1V4JA 5ILZA 3AQ0A 1N23A 5HN9A 3ZCDA 3LSNA 4LFEA 2E94A 1YHLA 3KB9A 2E8WA 3WCEA 3KRFA 3CC9A 3M9UA 3KRAB 3ASXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CG6 A;  1YV5 A;  4FP4 A;  3QKC A;  3TFV A;  2ZY1 A;  3VJ9 A;  3BNY A;  4KVI A;  3WCC A;  3WJN A;  1HM4 A;  1WL3 A;  1ZW5 A;  4LLS A;  4LXW A;  3KRC B;  4LA5 A;  3OAC A;  4OKZ A;  3LK5 A;  3VJA A;  2Z4V A;  2Q58 A;  4LUU A;  3SDQ A;  3WC9 A;  2F89 F;  5JV2 F;  3N0F A;  4KKM A;  3B7L A;  2ZCS A;  5IK6 A;  3ACY A;  2AET A;  1PS1 A;  1YHM A;  3ADZ A;  4NUA A;  2PS6 A;  2OPM A;  3LVS A;  4KVD A;  1DI1 A;  3NF2 A;  5DHI A;  5AYP A;  1YHK A;  4DI5 A;  3N3L F;  4H5C F;  1YYR A;  3ZMC A;  3ACX A;  2J1P A;  2EWG A;  3DYF A;  3WCI A;  2FTZ A;  4UMJ A;  2E4O A;  3N46 F;  5AHU B;  5IL8 A;  2OGD A;  1N22 A;  3ICM A;  1KIY A;  4QXS F;  4E9U A;  3KRO B;  2PS5 A;  1HXA A;  3N5J F;  5DZ2 A;  5EAS A;  1V4E A;  3CP6 A;  3SAE A;  2E95 A;  4JXN A;  1V4H A;  3SDT A;  5IL3 A;  4RXD A;  3PYB A;  5DHK A;  5B0M A;  4KK2 A;  1YYT A;  3VJC A;  3M0G A;  4NG6 A;  5ERM A;  3WEH A;  5CG5 A;  4Q23 A;  2F8Z F;  3WSB A;  2E8V A;  3G4D A;  3AE0 A;  1N1Z A;  1WL1 A;  3P5P A;  3WCL A;  4LFV F;  1HXC A;  4F6V A;  1RTR A;  4RXA A;  4WK5 A;  4K10 A;  3EZ3 A;  2F9K F;  4LFG A;  3VJE A;  2OPN A;  3OAB B;  2I19 A;  4OMH A;  1HX9 A;  3P41 A;  5AEL A;  5E8L A;  3WJO A;  2P1C A;  3LGK A;  5C05 A;  5IKA A;  4EA1 A;  3ZL6 A;  3P8R A;  2Z78 A;  4LTV A;  4MC3 A;  3LGZ B;  1YYQ A;  1RQI A;  3WEK A;  2J5C A;  3OYR A;  4KQU A;  3N3D A;  4KWD A;  3M01 A;  3ICK A;  4ZQ8 A;  3LOM A;  5B0J A;  3SDU A;  3EFQ A;  5ILH A;  4P0X A;  5I1U A;  5ERN A;  2Z4W A;  1VG2 A;  5B0K A;  4GP1 A;  2Z7H A;  4KVY A;  5DJP F;  4RYP A;  1V4K A;  3IBA A;  4QPF A;  2PS8 A;  5IMP A;  4RXC A;  4NFI F;  1HM7 A;  3TS7 A;  1N21 A;  1KIZ A;  5JUZ F;  3KRA A;  4H5D F;  3P5R A;  4LPG F;  2E90 A;  3N49 F;  4MC8 A;  5A0I A;  3WEI A;  4LZ3 A;  2ONH A;  3Q2Z A;  4JYX A;  2F94 F;  1YJ4 A;  3RBM A;  1WMW A;  3PKO A;  4EA0 A;  4NFJ F;  3KRC A;  1WKZ A;  3S9V A;  4KFA A;  2PS7 A;  5DGN F;  4P0W A;  4E1E A;  5IK0 A;  3LZ9 A;  5B02 A;  5B0I A;  5ERO A;  3LEE A;  2RAH A;  4HD1 A;  3WCA A;  3N1V F;  1JFG A;  4LZC A;  4N1Z F;  3Q2Q A;  3VJD A;  1UBY A;  2Q80 A;  5DJR F;  4RNQ A;  3PYA A;  4KPJ A;  4NKF A;  4RXE A;  5IK9 A;  5ILY A;  3DYG A;  2AEK A;  3Q30 A;  1VG4 A;  4P0V A;  5IN8 A;  2ZEU A;  5B03 A;  3Q1O A;  2ZCO A;  5JV0 F;  3NPK A;  4GP2 A;  3MZV A;  2E8T A;  5ILJ A;  2ZCQ A;  4DZW A;  4DHD A;  5JV1 F;  2J1O A;  2ONG A;  3RMG A;  3KRP B;  2AZL A;  5AFX A;  4LLT A;  2AEL A;  5IM1 A;  5H9D A;  4NFK F;  3KRO A;  1N24 A;  4PVY F;  1DGP A;  3TFN A;  2OA6 A;  3ACW A;  2E93 A;  3WCJ A;  3CKE A;  1V4I A;  4GAX A;  3DYH A;  4H5E F;  4LOB A;  3ZMB A;  3LMD A;  3AQB B;  4LTZ A;  2E91 A;  5ILD A;  3VJ8 A;  3WSA A;  4F6X A;  3LDW A;  3KRF B;  3TFP A;  2AZK A;  3PDE A;  3V1X A;  3EGT A;  3ID0 A;  3ZOU A;  5ER8 A;  1FPS A;  3WE9 A;  5B0L A;  1UBW A;  3UCA A;  4DXJ A;  3LJI A;  2QIS A;  3NPR A;  3W7F A;  2ZCR A;  3MAV A;  5IMN A;  3ICN A;  4MC0 A;  5IMI A;  4JXY A;  5KSX F;  4DWB A;  2Q9Y A;  4XQT F;  5HN8 A;  1VG7 A;  1UBX A;  3OAB A;  1EZF A;  3OAC B;  5EAT A;  3N45 F;  3WCB A;  1YYS A;  5HNA A;  5DGS F;  2Z50 A;  3KBK A;  5DW7 A;  4PVX F;  3M02 A;  5E8H A;  2O1O A;  5IVG A;  4OMG A;  3WEJ A;  2H8O A;  1WY0 A;  3TC1 A;  5HN7 A;  2Z7I A;  5ILI A;  3LG5 A;  1UBV A;  5JA0 F;  4LZ0 A;  4GA3 A;  3IPI A;  2E8U A;  3QQV A;  4EA2 A;  4KVW A;  4FJQ A;  3SDR A;  3BNX A;  2E92 A;  3M00 A;  5A0J A;  4LIX A;  2F92 F;  4JVJ F;  3WCD A;  3AQC B;  5ILK A;  5DGM F;  4KPD A;  1N1B A;  1VG3 A;  4E9Z A;  3WEF A;  2Z4Z A;  3G4F A;  3V66 A;  3WCM A;  3LLW A;  4LPH F;  1YYU A;  3N1W F;  2F8C F;  2PS4 A;  3PH7 A;  3RYW A;  4KQS A;  3N5H F;  5B01 A;  2E8X A;  2FOR A;  4NKE A;  2ZEV A;  3NRI A;  3S4J A;  5EAU A;  4DWG A;  4OKM A;  2DH4 A;  3P8L A;  1WL2 A;  4L2X F;  3VJB A;  1JFA A;  3WCG A;  1HXG A;  4N9U A;  5E8K A;  3WCF A;  2F7M F;  1WL0 A;  4XQS F;  3WEG A;  3RYE A;  1RQJ A;  2Q9Z A;  3SDV A;  5A0K A;  3WJK A;  1N20 A;  4OGU A;  4F62 A;  5DIQ F;  3V1V A;  5DJV F;  3N6K F;  2Z4X A;  3N0G A;  1YQ7 A;  3APZ A;  2Z52 A;  1VG6 A;  2AZJ A;  4XQR F;  3WCH A;  5IKH A;  4KUX A;  4JZX A;  3KRP A;  4KQ5 A;  5B00 A;  3ICZ A;  4DEM F;  2Z4Y A;  4JZB A;  4LA6 A;  2VF6 A;  1V4J A;  5ILZ A;  3AQ0 A;  1N23 A;  5HN9 A;  3ZCD A;  3LSN A;  4LFE A;  2E94 A;  1YHL A;  3KB9 A;  2E8W A;  3WCE A;  3KRF A;  3CC9 A;  3M9U A;  3KRA B;  3ASX A; 
#chains in the Genus database with same CATH topology
 5CG6 A;  1YV5 A;  4FP4 A;  3QKC A;  3TFV A;  2ZY1 A;  3VJ9 A;  3BNY A;  4KVI A;  3WCC A;  3WJN A;  1HM4 A;  1WL3 A;  1ZW5 A;  4LLS A;  4LXW A;  3KRC B;  4LA5 A;  3OAC A;  4OKZ A;  3LK5 A;  3VJA A;  2Z4V A;  2Q58 A;  4LUU A;  3SDQ A;  3WC9 A;  2F89 F;  5JV2 F;  3N0F A;  4KKM A;  3B7L A;  2ZCS A;  5IK6 A;  3ACY A;  2AET A;  1PS1 A;  1YHM A;  3ADZ A;  4NUA A;  2PS6 A;  2OPM A;  3LVS A;  4KVD A;  1DI1 A;  3NF2 A;  5DHI A;  5AYP A;  1YHK A;  4DI5 A;  3N3L F;  4H5C F;  1YYR A;  3ZMC A;  3ACX A;  2J1P A;  2EWG A;  3DYF A;  3WCI A;  2FTZ A;  4UMJ A;  2E4O A;  3N46 F;  5AHU B;  5IL8 A;  2OGD A;  1N22 A;  3ICM A;  1KIY A;  4QXS F;  4E9U A;  3KRO B;  2PS5 A;  1HXA A;  3N5J F;  5DZ2 A;  5EAS A;  1V4E A;  3CP6 A;  3SAE A;  2E95 A;  4JXN A;  1V4H A;  3SDT A;  5IL3 A;  4RXD A;  3PYB A;  5DHK A;  5B0M A;  4KK2 A;  1YYT A;  3VJC A;  3M0G A;  4NG6 A;  5ERM A;  3WEH A;  5CG5 A;  4Q23 A;  2F8Z F;  3WSB A;  2E8V A;  3G4D A;  3AE0 A;  1N1Z A;  1WL1 A;  3P5P A;  3WCL A;  4LFV F;  1HXC A;  4F6V A;  1RTR A;  4RXA A;  4WK5 A;  4K10 A;  3EZ3 A;  2F9K F;  4LFG A;  3VJE A;  2OPN A;  3OAB B;  2I19 A;  4OMH A;  1HX9 A;  3P41 A;  5AEL A;  5E8L A;  3WJO A;  2P1C A;  3LGK A;  5C05 A;  5IKA A;  4EA1 A;  3ZL6 A;  3P8R A;  2Z78 A;  4LTV A;  4MC3 A;  3LGZ B;  1YYQ A;  1RQI A;  3WEK A;  2J5C A;  3OYR A;  4KQU A;  3N3D A;  4KWD A;  3M01 A;  3ICK A;  4ZQ8 A;  3LOM A;  5B0J A;  3SDU A;  3EFQ A;  5ILH A;  4P0X A;  5I1U A;  5ERN A;  2Z4W A;  1VG2 A;  5B0K A;  4GP1 A;  2Z7H A;  4KVY A;  5DJP F;  4RYP A;  1V4K A;  3IBA A;  4QPF A;  2PS8 A;  5IMP A;  4RXC A;  4NFI F;  1HM7 A;  3TS7 A;  1N21 A;  1KIZ A;  5JUZ F;  3KRA A;  4H5D F;  3P5R A;  4LPG F;  2E90 A;  3N49 F;  4MC8 A;  5A0I A;  3WEI A;  4LZ3 A;  2ONH A;  3Q2Z A;  4JYX A;  2F94 F;  1YJ4 A;  3RBM A;  1WMW A;  3PKO A;  4EA0 A;  4NFJ F;  3KRC A;  1WKZ A;  3S9V A;  4KFA A;  2PS7 A;  5DGN F;  4P0W A;  4E1E A;  5IK0 A;  3LZ9 A;  5B02 A;  5B0I A;  5ERO A;  3LEE A;  2RAH A;  4HD1 A;  3WCA A;  3N1V F;  1JFG A;  4LZC A;  4N1Z F;  3Q2Q A;  3VJD A;  1UBY A;  2Q80 A;  5DJR F;  4RNQ A;  3PYA A;  4KPJ A;  4NKF A;  4RXE A;  5IK9 A;  5ILY A;  3DYG A;  2AEK A;  3Q30 A;  1VG4 A;  4P0V A;  5IN8 A;  2ZEU A;  5B03 A;  3Q1O A;  2ZCO A;  5JV0 F;  3NPK A;  4GP2 A;  3MZV A;  2E8T A;  5ILJ A;  2ZCQ A;  4DZW A;  4DHD A;  5JV1 F;  2J1O A;  2ONG A;  3RMG A;  3KRP B;  2AZL A;  5AFX A;  4LLT A;  2AEL A;  5IM1 A;  5H9D A;  4NFK F;  3KRO A;  1N24 A;  4PVY F;  1DGP A;  3TFN A;  2OA6 A;  3ACW A;  2E93 A;  3WCJ A;  3CKE A;  1V4I A;  4GAX A;  3DYH A;  4H5E F;  4LOB A;  3ZMB A;  3LMD A;  3AQB B;  4LTZ A;  2E91 A;  5ILD A;  3VJ8 A;  3WSA A;  4F6X A;  3LDW A;  3KRF B;  3TFP A;  2AZK A;  3PDE A;  3V1X A;  3EGT A;  3ID0 A;  3ZOU A;  5ER8 A;  1FPS A;  3WE9 A;  5B0L A;  1UBW A;  3UCA A;  4DXJ A;  3LJI A;  2QIS A;  3NPR A;  3W7F A;  2ZCR A;  3MAV A;  5IMN A;  3ICN A;  4MC0 A;  5IMI A;  4JXY A;  5KSX F;  4DWB A;  2Q9Y A;  4XQT F;  5HN8 A;  1VG7 A;  1UBX A;  3OAB A;  1EZF A;  3OAC B;  5EAT A;  3N45 F;  3WCB A;  1YYS A;  5HNA A;  5DGS F;  2Z50 A;  3KBK A;  5DW7 A;  4PVX F;  3M02 A;  5E8H A;  2O1O A;  5IVG A;  4OMG A;  3WEJ A;  2H8O A;  1WY0 A;  3TC1 A;  5HN7 A;  2Z7I A;  5ILI A;  3LG5 A;  1UBV A;  5JA0 F;  4LZ0 A;  4GA3 A;  3IPI A;  2E8U A;  3QQV A;  4EA2 A;  4KVW A;  4FJQ A;  3SDR A;  3BNX A;  2E92 A;  3M00 A;  5A0J A;  4LIX A;  2F92 F;  4JVJ F;  3WCD A;  3AQC B;  5ILK A;  5DGM F;  4KPD A;  1N1B A;  1VG3 A;  4E9Z A;  3WEF A;  2Z4Z A;  3G4F A;  3V66 A;  3WCM A;  3LLW A;  4LPH F;  1YYU A;  3N1W F;  2F8C F;  2PS4 A;  3PH7 A;  3RYW A;  4KQS A;  3N5H F;  5B01 A;  2E8X A;  2FOR A;  4NKE A;  2ZEV A;  3NRI A;  3S4J A;  5EAU A;  4DWG A;  4OKM A;  2DH4 A;  3P8L A;  1WL2 A;  4L2X F;  3VJB A;  1JFA A;  3WCG A;  1HXG A;  4N9U A;  5E8K A;  3WCF A;  2F7M F;  1WL0 A;  4XQS F;  3WEG A;  3RYE A;  1RQJ A;  2Q9Z A;  3SDV A;  5A0K A;  3WJK A;  1N20 A;  4OGU A;  4F62 A;  5DIQ F;  3V1V A;  5DJV F;  3N6K F;  2Z4X A;  3N0G A;  1YQ7 A;  3APZ A;  2Z52 A;  1VG6 A;  2AZJ A;  4XQR F;  3WCH A;  5IKH A;  4KUX A;  4JZX A;  3KRP A;  4KQ5 A;  5B00 A;  3ICZ A;  4DEM F;  2Z4Y A;  4JZB A;  4LA6 A;  2VF6 A;  1V4J A;  5ILZ A;  3AQ0 A;  1N23 A;  5HN9 A;  3ZCD A;  3LSN A;  4LFE A;  2E94 A;  1YHL A;  3KB9 A;  2E8W A;  3WCE A;  3KRF A;  3CC9 A;  3M9U A;  3KRA B;  3ASX A; 
#chains in the Genus database with same CATH homology
 5CG6 A;  1YV5 A;  4FP4 A;  3QKC A;  3TFV A;  2ZY1 A;  3VJ9 A;  3BNY A;  4KVI A;  3WCC A;  3WJN A;  1HM4 A;  1WL3 A;  1ZW5 A;  4LLS A;  4LXW A;  3KRC B;  4LA5 A;  3OAC A;  4OKZ A;  3LK5 A;  3VJA A;  2Z4V A;  2Q58 A;  4LUU A;  3SDQ A;  3WC9 A;  2F89 F;  5JV2 F;  3N0F A;  4KKM A;  3B7L A;  2ZCS A;  5IK6 A;  3ACY A;  2AET A;  1PS1 A;  1YHM A;  3ADZ A;  4NUA A;  2PS6 A;  2OPM A;  3LVS A;  4KVD A;  1DI1 A;  3NF2 A;  5DHI A;  5AYP A;  1YHK A;  4DI5 A;  3N3L F;  4H5C F;  1YYR A;  3ZMC A;  3ACX A;  2J1P A;  2EWG A;  3DYF A;  3WCI A;  2FTZ A;  4UMJ A;  2E4O A;  3N46 F;  5AHU B;  5IL8 A;  2OGD A;  1N22 A;  3ICM A;  1KIY A;  4QXS F;  4E9U A;  3KRO B;  2PS5 A;  1HXA A;  3N5J F;  5DZ2 A;  5EAS A;  1V4E A;  3CP6 A;  3SAE A;  2E95 A;  4JXN A;  1V4H A;  3SDT A;  5IL3 A;  4RXD A;  3PYB A;  5DHK A;  5B0M A;  4KK2 A;  1YYT A;  3VJC A;  3M0G A;  4NG6 A;  5ERM A;  3WEH A;  5CG5 A;  4Q23 A;  2F8Z F;  3WSB A;  2E8V A;  3G4D A;  3AE0 A;  1N1Z A;  1WL1 A;  3P5P A;  3WCL A;  4LFV F;  1HXC A;  4F6V A;  1RTR A;  4RXA A;  4WK5 A;  4K10 A;  3EZ3 A;  2F9K F;  4LFG A;  3VJE A;  2OPN A;  3OAB B;  2I19 A;  4OMH A;  1HX9 A;  3P41 A;  5AEL A;  5E8L A;  3WJO A;  2P1C A;  3LGK A;  5C05 A;  5IKA A;  4EA1 A;  3ZL6 A;  3P8R A;  2Z78 A;  4LTV A;  4MC3 A;  3LGZ B;  1YYQ A;  1RQI A;  3WEK A;  2J5C A;  3OYR A;  4KQU A;  3N3D A;  4KWD A;  3M01 A;  3ICK A;  4ZQ8 A;  3LOM A;  5B0J A;  3SDU A;  3EFQ A;  5ILH A;  4P0X A;  5I1U A;  5ERN A;  2Z4W A;  1VG2 A;  5B0K A;  4GP1 A;  2Z7H A;  4KVY A;  5DJP F;  4RYP A;  1V4K A;  3IBA A;  4QPF A;  2PS8 A;  5IMP A;  4RXC A;  4NFI F;  1HM7 A;  3TS7 A;  1N21 A;  1KIZ A;  5JUZ F;  3KRA A;  4H5D F;  3P5R A;  4LPG F;  2E90 A;  3N49 F;  4MC8 A;  5A0I A;  3WEI A;  4LZ3 A;  2ONH A;  3Q2Z A;  4JYX A;  2F94 F;  1YJ4 A;  3RBM A;  1WMW A;  3PKO A;  4EA0 A;  4NFJ F;  3KRC A;  1WKZ A;  3S9V A;  4KFA A;  2PS7 A;  5DGN F;  4P0W A;  4E1E A;  5IK0 A;  3LZ9 A;  5B02 A;  5B0I A;  5ERO A;  3LEE A;  2RAH A;  4HD1 A;  3WCA A;  3N1V F;  1JFG A;  4LZC A;  4N1Z F;  3Q2Q A;  3VJD A;  1UBY A;  2Q80 A;  5DJR F;  4RNQ A;  3PYA A;  4KPJ A;  4NKF A;  4RXE A;  5IK9 A;  5ILY A;  3DYG A;  2AEK A;  3Q30 A;  1VG4 A;  4P0V A;  5IN8 A;  2ZEU A;  5B03 A;  3Q1O A;  2ZCO A;  5JV0 F;  3NPK A;  4GP2 A;  3MZV A;  2E8T A;  5ILJ A;  2ZCQ A;  4DZW A;  4DHD A;  5JV1 F;  2J1O A;  2ONG A;  3RMG A;  3KRP B;  2AZL A;  5AFX A;  4LLT A;  2AEL A;  5IM1 A;  5H9D A;  4NFK F;  3KRO A;  1N24 A;  4PVY F;  1DGP A;  3TFN A;  2OA6 A;  3ACW A;  2E93 A;  3WCJ A;  3CKE A;  1V4I A;  4GAX A;  3DYH A;  4H5E F;  4LOB A;  3ZMB A;  3LMD A;  3AQB B;  4LTZ A;  2E91 A;  5ILD A;  3VJ8 A;  3WSA A;  4F6X A;  3LDW A;  3KRF B;  3TFP A;  2AZK A;  3PDE A;  3V1X A;  3EGT A;  3ID0 A;  3ZOU A;  5ER8 A;  1FPS A;  3WE9 A;  5B0L A;  1UBW A;  3UCA A;  4DXJ A;  3LJI A;  2QIS A;  3NPR A;  3W7F A;  2ZCR A;  3MAV A;  5IMN A;  3ICN A;  4MC0 A;  5IMI A;  4JXY A;  5KSX F;  4DWB A;  2Q9Y A;  4XQT F;  5HN8 A;  1VG7 A;  1UBX A;  3OAB A;  1EZF A;  3OAC B;  5EAT A;  3N45 F;  3WCB A;  1YYS A;  5HNA A;  5DGS F;  2Z50 A;  3KBK A;  5DW7 A;  4PVX F;  3M02 A;  5E8H A;  2O1O A;  5IVG A;  4OMG A;  3WEJ A;  2H8O A;  1WY0 A;  3TC1 A;  5HN7 A;  2Z7I A;  5ILI A;  3LG5 A;  1UBV A;  5JA0 F;  4LZ0 A;  4GA3 A;  3IPI A;  2E8U A;  3QQV A;  4EA2 A;  4KVW A;  4FJQ A;  3SDR A;  3BNX A;  2E92 A;  3M00 A;  5A0J A;  4LIX A;  2F92 F;  4JVJ F;  3WCD A;  3AQC B;  5ILK A;  5DGM F;  4KPD A;  1N1B A;  1VG3 A;  4E9Z A;  3WEF A;  2Z4Z A;  3G4F A;  3V66 A;  3WCM A;  3LLW A;  4LPH F;  1YYU A;  3N1W F;  2F8C F;  2PS4 A;  3PH7 A;  3RYW A;  4KQS A;  3N5H F;  5B01 A;  2E8X A;  2FOR A;  4NKE A;  2ZEV A;  3NRI A;  3S4J A;  5EAU A;  4DWG A;  4OKM A;  2DH4 A;  3P8L A;  1WL2 A;  4L2X F;  3VJB A;  1JFA A;  3WCG A;  1HXG A;  4N9U A;  5E8K A;  3WCF A;  2F7M F;  1WL0 A;  4XQS F;  3WEG A;  3RYE A;  1RQJ A;  2Q9Z A;  3SDV A;  5A0K A;  3WJK A;  1N20 A;  4OGU A;  4F62 A;  5DIQ F;  3V1V A;  5DJV F;  3N6K F;  2Z4X A;  3N0G A;  1YQ7 A;  3APZ A;  2Z52 A;  1VG6 A;  2AZJ A;  4XQR F;  3WCH A;  5IKH A;  4KUX A;  4JZX A;  3KRP A;  4KQ5 A;  5B00 A;  3ICZ A;  4DEM F;  2Z4Y A;  4JZB A;  4LA6 A;  2VF6 A;  1V4J A;  5ILZ A;  3AQ0 A;  1N23 A;  5HN9 A;  3ZCD A;  3LSN A;  4LFE A;  2E94 A;  1YHL A;  3KB9 A;  2E8W A;  3WCE A;  3KRF A;  3CC9 A;  3M9U A;  3KRA B;  3ASX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...