3LGZB

Crystal structure of dehydrosqualene synthase y129a from s. aureus complexed with presqualene pyrophosphate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
284
structure length
279
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGACYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dehydrosqualene synthase
publication title Mechanism of action and inhibition of dehydrosqualene synthase.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 114
structure length 279
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3lgzB00
2EWGA 3W7FA 3ZOUA 2PS4A 2ZCOA 2F7MF 2ZCSA 4LFVF 5B00A 5A0IA 4HD1A 3Q2ZA 1HM4A 4KQUA 5E8KA 3TS7A 5ILYA 2FORA 4KVYA 2OPNA 5IKAA 1WY0A 2Z78A 2E8TA 4JVJF 4LPGF 3LK5A 3N49F 4OMGA 1V4IA 1VG2A 2F9KF 4LZ0A 3WCHA 4DXJA 4DWBA 2I19A 2OGDA 5E8LA 1VG3A 3ASXA 5EASA 3EZ3A 3IBAA 3Q30A 4DEMF 3WSBA 4OMHA 4GP2A 5IN8A 3SDUA 3QQVA 1V4JA 2E93A 4H5EF 1RTRA 2E90A 3QKCA 3WCIA 1N1BA 4NUAA 3ICNA 1N1ZA 3AQCB 5DJVF 4LOBA 3WCFA 4XQSF 5ILHA 3LZ9A 3WCMA 3OYRA 2J5CA 3KROA 5DW7A 5A0KA 4KKMA 2OA6A 3KROB 3VJAA 3TFPA 4LTVA 3KRFA 5B02A 3ACWA 1YYQA 3ICKA 4QPFA 5ILZA 5IMPA 3KRFB 3MZVA 4LZ3A 3LJIA 3WJKA 4GA3A 4DZWA 1JFAA 4H5CF 3SDRA 5IK0A 4KK2A 1YHMA 1N20A 3G4DA 2AELA 1UBWA 2F8ZF 1HM7A 2DH4A 3LOMA 3MAVA 2F8CF 2F92F 5EATA 4WK5A 1ZW5A 2RAHA 5IL8A 3KBKA 1VG7A 2Z4ZA 5DHIA 3ZMBA 5AELA 4DHDA 3NPRA 4K10A 2F94F 3LEEA 3VJDA 1YYUA 4UMJA 3M00A 3WSAA 4MC0A 5IMNA 1N23A 4KQ5A 3P41A 3M01A 3WCAA 4RXEA 2F89F 5A0JA 5DJPF 1WL0A 4N9UA 5B0KA 1YHKA 2O1OA 2PS5A 3PYAA 1KIZA 5B03A 1V4KA 4QXSF 1UBVA 4XQTF 3CC9A 4F6VA 5B0LA 1N22A 3RMGA 3M02A 3APZA 5HN8A 3KRPA 3P8LA 3OABA 2E8WA 1YV5A 1WKZA 3VJ8A 5KSXF 3KRPB 1EZFA 3OABB 5IVGA 3RYWA 4NFJF 2FTZA 5IL3A 2AZLA 3ACYA 5DHKA 3WCJA 4KVWA 2Q58A 4DWGA 2AEKA 1JFGA 3LLWA 3WCCA 4KWDA 2QISA 3N6KF 4OGUA 3N3LF 5CG5A 2VF6A 3ICMA 4KFAA 3VJ9A 2E94A 3G4FA 5HNAA 4Q23A 3KRAA 2ZCRA 4EA1A 1VG6A 4XQRF 1DI1A 5C05A 2Z4XA 4EA0A 4RYPA 4FJQA 5ERMA 2J1PA 1UBXA 5DGSF 4RNQA 3DYFA 4LLTA 1HXGA 3KRAB 3N5JF 2Q9YA 1RQIA 3BNYA 1V4HA 3N46F 3WCBA 4E9ZA 2PS6A 3VJCA 3WE9A 3CP6A 4E9UA 3N5HF 3Q2QA 2OPMA 2ZEUA 3UCAA 3AE0A 3IPIA 5DZ2A 4KPJA 3N1WF 2E92A 4EA2A 3KRCA 4NKFA 4LTZA 3WC9A 4FP4A 3RYEA 1YQ7A 5ILIA 3TFVA 3WCEA 3KRCB 3N3DA 1RQJA 4MC3A 5ERNA 3ZMCA 3M0GA 2E8VA 2PS8A 5IMIA 1HXCA 4MC8A 1N21A 2PS7A 4OKZA 4NG6A 3EFQA 3TFNA 5JV2F 2AZKA 3AQ0A 4JXYA 3SAEA 3PYBA 4N1ZF 3S4JA 5JA0F 4LXWA 4KVDA 1YYRA 2E8UA 3N0FA 3VJBA 3WEFA 4LLSA 4E1EA 4KQSA 5HN7A 4ZQ8A 5I1UA 3WJNA 1VG4A 5B0IA 3VJEA 3LG5A 4P0VA 3TC1A 3CKEA 3NF2A 4LFEA 3DYHA 3ID0A 1YYSA 4KUXA 4JZXA 4GP1A 4H5DF 4JYXA 2Z4YA 2Z7HA 3NPKA 3WEKA 1FPSA 3B7LA 4KVIA 3N0GA 4NFKF 1DGPA 4LA5A 5B0MA 4LFGA 3ICZA 4P0XA 1PS1A 5ILDA 5DIQF 2E4OA 3ADZA 2Q9ZA 4RXAA 3S9VA 3BNXA 3SDTA 3WCGA 1HX9A 3WEGA 5JV0F 4JZBA 3AQBB 4KPDA 5DGNF 1V4EA 5ILKA 5EROA 4LZCA 2J1OA 2ONGA 3LGZB 3M9UA 3RBMA 3EGTA 3N45F 3ACXA 4NFIF 2ZY1A 5ILJA 1UBYA 4P0WA 3PKOA 4L2XF 3WCDA 5EAUA 5H9DA 5JUZF 4PVYF 5B01A 4RXDA 5IK6A 3ZCDA 1YJ4A 4GAXA 3V66A 1WL2A 4LPHF 5JV1F 3NRIA 3PDEA 3ZL6A 3V1XA 2Z52A 5IKHA 3WEIA 4PVXF 3WJOA 3N1VF 4DI5A 5E8HA 4JXNA 4LUUA 3V1VA 4NKEA 5DJRF 5ER8A 3LGKA 1YYTA 1YHLA 2Z4VA 3WEHA 1WL1A 3KB9A 3Q1OA 3SDQA 2Z4WA 3SDVA 3WEJA 4F62A 2E91A 4LIXA 3P5RA 3PH7A 5IK9A 5B0JA 2ZCQA 1WL3A 4RXCA 3LVSA 2ZEVA 4LA6A 2AZJA 2E8XA 2Z7IA 3P8RA 3LSNA 1WMWA 2AETA 4F6XA 5CG6A 5DGMF 3OACA 3WCLA 4OKMA 5HN9A 3P5PA 5AFXA 3LMDA 3OACB 3LDWA 2ONHA 2E95A 2P1CA 1N24A 2H8OA 5AHUB 3DYGA 1KIYA 5AYPA 5IM1A 2Q80A 1HXAA 2Z50A
chains in the Genus database with same CATH superfamily
2EWGA 3W7FA 3ZOUA 2PS4A 2ZCOA 2F7MF 2ZCSA 4LFVF 5B00A 5A0IA 4HD1A 3Q2ZA 1HM4A 4KQUA 5E8KA 3TS7A 5ILYA 2FORA 4KVYA 2OPNA 5IKAA 1WY0A 2Z78A 2E8TA 4JVJF 4LPGF 3LK5A 3N49F 4OMGA 1V4IA 1VG2A 2F9KF 4LZ0A 3WCHA 4DXJA 4DWBA 2I19A 2OGDA 5E8LA 1VG3A 3ASXA 5EASA 3EZ3A 3IBAA 3Q30A 4DEMF 3WSBA 4OMHA 4GP2A 5IN8A 3SDUA 3QQVA 1V4JA 2E93A 4H5EF 1RTRA 2E90A 3QKCA 3WCIA 1N1BA 4NUAA 3ICNA 1N1ZA 3AQCB 5DJVF 4LOBA 3WCFA 4XQSF 5ILHA 3LZ9A 3WCMA 3OYRA 2J5CA 3KROA 5DW7A 5A0KA 4KKMA 2OA6A 3KROB 3VJAA 3TFPA 4LTVA 3KRFA 5B02A 3ACWA 1YYQA 3ICKA 4QPFA 5ILZA 5IMPA 3KRFB 3MZVA 4LZ3A 3LJIA 3WJKA 4GA3A 4DZWA 1JFAA 4H5CF 3SDRA 5IK0A 4KK2A 1YHMA 1N20A 3G4DA 2AELA 1UBWA 2F8ZF 1HM7A 2DH4A 3LOMA 3MAVA 2F8CF 2F92F 5EATA 4WK5A 1ZW5A 2RAHA 5IL8A 3KBKA 1VG7A 2Z4ZA 5DHIA 3ZMBA 5AELA 4DHDA 3NPRA 4K10A 2F94F 3LEEA 3VJDA 1YYUA 4UMJA 3M00A 3WSAA 4MC0A 5IMNA 1N23A 4KQ5A 3P41A 3M01A 3WCAA 4RXEA 2F89F 5A0JA 5DJPF 1WL0A 4N9UA 5B0KA 1YHKA 2O1OA 2PS5A 3PYAA 1KIZA 5B03A 1V4KA 4QXSF 1UBVA 4XQTF 3CC9A 4F6VA 5B0LA 1N22A 3RMGA 3M02A 3APZA 5HN8A 3KRPA 3P8LA 3OABA 2E8WA 1YV5A 1WKZA 3VJ8A 5KSXF 3KRPB 1EZFA 3OABB 5IVGA 3RYWA 4NFJF 2FTZA 5IL3A 2AZLA 3ACYA 5DHKA 3WCJA 4KVWA 2Q58A 4DWGA 2AEKA 1JFGA 3LLWA 3WCCA 4KWDA 2QISA 3N6KF 4OGUA 3N3LF 5CG5A 2VF6A 3ICMA 4KFAA 3VJ9A 2E94A 3G4FA 5HNAA 4Q23A 3KRAA 2ZCRA 4EA1A 1VG6A 4XQRF 1DI1A 5C05A 2Z4XA 4EA0A 4RYPA 4FJQA 5ERMA 2J1PA 1UBXA 5DGSF 4RNQA 3DYFA 4LLTA 1HXGA 3KRAB 3N5JF 2Q9YA 1RQIA 3BNYA 1V4HA 3N46F 3WCBA 4E9ZA 2PS6A 3VJCA 3WE9A 3CP6A 4E9UA 3N5HF 3Q2QA 2OPMA 2ZEUA 3UCAA 3AE0A 3IPIA 5DZ2A 4KPJA 3N1WF 2E92A 4EA2A 3KRCA 4NKFA 4LTZA 3WC9A 4FP4A 3RYEA 1YQ7A 5ILIA 3TFVA 3WCEA 3KRCB 3N3DA 1RQJA 4MC3A 5ERNA 3ZMCA 3M0GA 2E8VA 2PS8A 5IMIA 1HXCA 4MC8A 1N21A 2PS7A 4OKZA 4NG6A 3EFQA 3TFNA 5JV2F 2AZKA 3AQ0A 4JXYA 3SAEA 3PYBA 4N1ZF 3S4JA 5JA0F 4LXWA 4KVDA 1YYRA 2E8UA 3N0FA 3VJBA 3WEFA 4LLSA 4E1EA 4KQSA 5HN7A 4ZQ8A 5I1UA 3WJNA 1VG4A 5B0IA 3VJEA 3LG5A 4P0VA 3TC1A 3CKEA 3NF2A 4LFEA 3DYHA 3ID0A 1YYSA 4KUXA 4JZXA 4GP1A 4H5DF 4JYXA 2Z4YA 2Z7HA 3NPKA 3WEKA 1FPSA 3B7LA 4KVIA 3N0GA 4NFKF 1DGPA 4LA5A 5B0MA 4LFGA 3ICZA 4P0XA 1PS1A 5ILDA 5DIQF 2E4OA 3ADZA 2Q9ZA 4RXAA 3S9VA 3BNXA 3SDTA 3WCGA 1HX9A 3WEGA 5JV0F 4JZBA 3AQBB 4KPDA 5DGNF 1V4EA 5ILKA 5EROA 4LZCA 2J1OA 2ONGA 3LGZB 3M9UA 3RBMA 3EGTA 3N45F 3ACXA 4NFIF 2ZY1A 5ILJA 1UBYA 4P0WA 3PKOA 4L2XF 3WCDA 5EAUA 5H9DA 5JUZF 4PVYF 5B01A 4RXDA 5IK6A 3ZCDA 1YJ4A 4GAXA 3V66A 1WL2A 4LPHF 5JV1F 3NRIA 3PDEA 3ZL6A 3V1XA 2Z52A 5IKHA 3WEIA 4PVXF 3WJOA 3N1VF 4DI5A 5E8HA 4JXNA 4LUUA 3V1VA 4NKEA 5DJRF 5ER8A 3LGKA 1YYTA 1YHLA 2Z4VA 3WEHA 1WL1A 3KB9A 3Q1OA 3SDQA 2Z4WA 3SDVA 3WEJA 4F62A 2E91A 4LIXA 3P5RA 3PH7A 5IK9A 5B0JA 2ZCQA 1WL3A 4RXCA 3LVSA 2ZEVA 4LA6A 2AZJA 2E8XA 2Z7IA 3P8RA 3LSNA 1WMWA 2AETA 4F6XA 5CG6A 5DGMF 3OACA 3WCLA 4OKMA 5HN9A 3P5PA 5AFXA 3LMDA 3OACB 3LDWA 2ONHA 2E95A 2P1CA 1N24A 2H8OA 5AHUB 3DYGA 1KIYA 5AYPA 5IM1A 2Q80A 1HXAA 2Z50A
chains in the Genus database with same CATH topology
2EWGA 3W7FA 3ZOUA 2PS4A 2ZCOA 2F7MF 2ZCSA 4LFVF 5B00A 5A0IA 4HD1A 3Q2ZA 1HM4A 4KQUA 5E8KA 3TS7A 5ILYA 2FORA 4KVYA 2OPNA 5IKAA 1WY0A 2Z78A 2E8TA 4JVJF 4LPGF 3LK5A 3N49F 4OMGA 1V4IA 1VG2A 2F9KF 4LZ0A 3WCHA 4DXJA 4DWBA 2I19A 2OGDA 5E8LA 1VG3A 3ASXA 5EASA 3EZ3A 3IBAA 3Q30A 4DEMF 3WSBA 4OMHA 4GP2A 5IN8A 3SDUA 3QQVA 1V4JA 2E93A 4H5EF 1RTRA 2E90A 3QKCA 3WCIA 1N1BA 4NUAA 3ICNA 1N1ZA 3AQCB 5DJVF 4LOBA 3WCFA 4XQSF 5ILHA 3LZ9A 3WCMA 3OYRA 2J5CA 3KROA 5DW7A 5A0KA 4KKMA 2OA6A 3KROB 3VJAA 3TFPA 4LTVA 3KRFA 5B02A 3ACWA 1YYQA 3ICKA 4QPFA 5ILZA 5IMPA 3KRFB 3MZVA 4LZ3A 3LJIA 3WJKA 4GA3A 4DZWA 1JFAA 4H5CF 3SDRA 5IK0A 4KK2A 1YHMA 1N20A 3G4DA 2AELA 1UBWA 2F8ZF 1HM7A 2DH4A 3LOMA 3MAVA 2F8CF 2F92F 5EATA 4WK5A 1ZW5A 2RAHA 5IL8A 3KBKA 1VG7A 2Z4ZA 5DHIA 3ZMBA 5AELA 4DHDA 3NPRA 4K10A 2F94F 3LEEA 3VJDA 1YYUA 4UMJA 3M00A 3WSAA 4MC0A 5IMNA 1N23A 4KQ5A 3P41A 3M01A 3WCAA 4RXEA 2F89F 5A0JA 5DJPF 1WL0A 4N9UA 5B0KA 1YHKA 2O1OA 2PS5A 3PYAA 1KIZA 5B03A 1V4KA 4QXSF 1UBVA 4XQTF 3CC9A 4F6VA 5B0LA 1N22A 3RMGA 3M02A 3APZA 5HN8A 3KRPA 3P8LA 3OABA 2E8WA 1YV5A 1WKZA 3VJ8A 5KSXF 3KRPB 1EZFA 3OABB 5IVGA 3RYWA 4NFJF 2FTZA 5IL3A 2AZLA 3ACYA 5DHKA 3WCJA 4KVWA 2Q58A 4DWGA 2AEKA 1JFGA 3LLWA 3WCCA 4KWDA 2QISA 3N6KF 4OGUA 3N3LF 5CG5A 2VF6A 3ICMA 4KFAA 3VJ9A 2E94A 3G4FA 5HNAA 4Q23A 3KRAA 2ZCRA 4EA1A 1VG6A 4XQRF 1DI1A 5C05A 2Z4XA 4EA0A 4RYPA 4FJQA 5ERMA 2J1PA 1UBXA 5DGSF 4RNQA 3DYFA 4LLTA 1HXGA 3KRAB 3N5JF 2Q9YA 1RQIA 3BNYA 1V4HA 3N46F 3WCBA 4E9ZA 2PS6A 3VJCA 3WE9A 3CP6A 4E9UA 3N5HF 3Q2QA 2OPMA 2ZEUA 3UCAA 3AE0A 3IPIA 5DZ2A 4KPJA 3N1WF 2E92A 4EA2A 3KRCA 4NKFA 4LTZA 3WC9A 4FP4A 3RYEA 1YQ7A 5ILIA 3TFVA 3WCEA 3KRCB 3N3DA 1RQJA 4MC3A 5ERNA 3ZMCA 3M0GA 2E8VA 2PS8A 5IMIA 1HXCA 4MC8A 1N21A 2PS7A 4OKZA 4NG6A 3EFQA 3TFNA 5JV2F 2AZKA 3AQ0A 4JXYA 3SAEA 3PYBA 4N1ZF 3S4JA 5JA0F 4LXWA 4KVDA 1YYRA 2E8UA 3N0FA 3VJBA 3WEFA 4LLSA 4E1EA 4KQSA 5HN7A 4ZQ8A 5I1UA 3WJNA 1VG4A 5B0IA 3VJEA 3LG5A 4P0VA 3TC1A 3CKEA 3NF2A 4LFEA 3DYHA 3ID0A 1YYSA 4KUXA 4JZXA 4GP1A 4H5DF 4JYXA 2Z4YA 2Z7HA 3NPKA 3WEKA 1FPSA 3B7LA 4KVIA 3N0GA 4NFKF 1DGPA 4LA5A 5B0MA 4LFGA 3ICZA 4P0XA 1PS1A 5ILDA 5DIQF 2E4OA 3ADZA 2Q9ZA 4RXAA 3S9VA 3BNXA 3SDTA 3WCGA 1HX9A 3WEGA 5JV0F 4JZBA 3AQBB 4KPDA 5DGNF 1V4EA 5ILKA 5EROA 4LZCA 2J1OA 2ONGA 3LGZB 3M9UA 3RBMA 3EGTA 3N45F 3ACXA 4NFIF 2ZY1A 5ILJA 1UBYA 4P0WA 3PKOA 4L2XF 3WCDA 5EAUA 5H9DA 5JUZF 4PVYF 5B01A 4RXDA 5IK6A 3ZCDA 1YJ4A 4GAXA 3V66A 1WL2A 4LPHF 5JV1F 3NRIA 3PDEA 3ZL6A 3V1XA 2Z52A 5IKHA 3WEIA 4PVXF 3WJOA 3N1VF 4DI5A 5E8HA 4JXNA 4LUUA 3V1VA 4NKEA 5DJRF 5ER8A 3LGKA 1YYTA 1YHLA 2Z4VA 3WEHA 1WL1A 3KB9A 3Q1OA 3SDQA 2Z4WA 3SDVA 3WEJA 4F62A 2E91A 4LIXA 3P5RA 3PH7A 5IK9A 5B0JA 2ZCQA 1WL3A 4RXCA 3LVSA 2ZEVA 4LA6A 2AZJA 2E8XA 2Z7IA 3P8RA 3LSNA 1WMWA 2AETA 4F6XA 5CG6A 5DGMF 3OACA 3WCLA 4OKMA 5HN9A 3P5PA 5AFXA 3LMDA 3OACB 3LDWA 2ONHA 2E95A 2P1CA 1N24A 2H8OA 5AHUB 3DYGA 1KIYA 5AYPA 5IM1A 2Q80A 1HXAA 2Z50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWG A;  3W7F A;  3ZOU A;  2PS4 A;  2ZCO A;  2F7M F;  2ZCS A;  4LFV F;  5B00 A;  5A0I A;  4HD1 A;  3Q2Z A;  1HM4 A;  4KQU A;  5E8K A;  3TS7 A;  5ILY A;  2FOR A;  4KVY A;  2OPN A;  5IKA A;  1WY0 A;  2Z78 A;  2E8T A;  4JVJ F;  4LPG F;  3LK5 A;  3N49 F;  4OMG A;  1V4I A;  1VG2 A;  2F9K F;  4LZ0 A;  3WCH A;  4DXJ A;  4DWB A;  2I19 A;  2OGD A;  5E8L A;  1VG3 A;  3ASX A;  5EAS A;  3EZ3 A;  3IBA A;  3Q30 A;  4DEM F;  3WSB A;  4OMH A;  4GP2 A;  5IN8 A;  3SDU A;  3QQV A;  1V4J A;  2E93 A;  4H5E F;  1RTR A;  2E90 A;  3QKC A;  3WCI A;  1N1B A;  4NUA A;  3ICN A;  1N1Z A;  3AQC B;  5DJV F;  4LOB A;  3WCF A;  4XQS F;  5ILH A;  3LZ9 A;  3WCM A;  3OYR A;  2J5C A;  3KRO A;  5DW7 A;  5A0K A;  4KKM A;  2OA6 A;  3KRO B;  3VJA A;  3TFP A;  4LTV A;  3KRF A;  5B02 A;  3ACW A;  1YYQ A;  3ICK A;  4QPF A;  5ILZ A;  5IMP A;  3KRF B;  3MZV A;  4LZ3 A;  3LJI A;  3WJK A;  4GA3 A;  4DZW A;  1JFA A;  4H5C F;  3SDR A;  5IK0 A;  4KK2 A;  1YHM A;  1N20 A;  3G4D A;  2AEL A;  1UBW A;  2F8Z F;  1HM7 A;  2DH4 A;  3LOM A;  3MAV A;  2F8C F;  2F92 F;  5EAT A;  4WK5 A;  1ZW5 A;  2RAH A;  5IL8 A;  3KBK A;  1VG7 A;  2Z4Z A;  5DHI A;  3ZMB A;  5AEL A;  4DHD A;  3NPR A;  4K10 A;  2F94 F;  3LEE A;  3VJD A;  1YYU A;  4UMJ A;  3M00 A;  3WSA A;  4MC0 A;  5IMN A;  1N23 A;  4KQ5 A;  3P41 A;  3M01 A;  3WCA A;  4RXE A;  2F89 F;  5A0J A;  5DJP F;  1WL0 A;  4N9U A;  5B0K A;  1YHK A;  2O1O A;  2PS5 A;  3PYA A;  1KIZ A;  5B03 A;  1V4K A;  4QXS F;  1UBV A;  4XQT F;  3CC9 A;  4F6V A;  5B0L A;  1N22 A;  3RMG A;  3M02 A;  3APZ A;  5HN8 A;  3KRP A;  3P8L A;  3OAB A;  2E8W A;  1YV5 A;  1WKZ A;  3VJ8 A;  5KSX F;  3KRP B;  1EZF A;  3OAB B;  5IVG A;  3RYW A;  4NFJ F;  2FTZ A;  5IL3 A;  2AZL A;  3ACY A;  5DHK A;  3WCJ A;  4KVW A;  2Q58 A;  4DWG A;  2AEK A;  1JFG A;  3LLW A;  3WCC A;  4KWD A;  2QIS A;  3N6K F;  4OGU A;  3N3L F;  5CG5 A;  2VF6 A;  3ICM A;  4KFA A;  3VJ9 A;  2E94 A;  3G4F A;  5HNA A;  4Q23 A;  3KRA A;  2ZCR A;  4EA1 A;  1VG6 A;  4XQR F;  1DI1 A;  5C05 A;  2Z4X A;  4EA0 A;  4RYP A;  4FJQ A;  5ERM A;  2J1P A;  1UBX A;  5DGS F;  4RNQ A;  3DYF A;  4LLT A;  1HXG A;  3KRA B;  3N5J F;  2Q9Y A;  1RQI A;  3BNY A;  1V4H A;  3N46 F;  3WCB A;  4E9Z A;  2PS6 A;  3VJC A;  3WE9 A;  3CP6 A;  4E9U A;  3N5H F;  3Q2Q A;  2OPM A;  2ZEU A;  3UCA A;  3AE0 A;  3IPI A;  5DZ2 A;  4KPJ A;  3N1W F;  2E92 A;  4EA2 A;  3KRC A;  4NKF A;  4LTZ A;  3WC9 A;  4FP4 A;  3RYE A;  1YQ7 A;  5ILI A;  3TFV A;  3WCE A;  3KRC B;  3N3D A;  1RQJ A;  4MC3 A;  5ERN A;  3ZMC A;  3M0G A;  2E8V A;  2PS8 A;  5IMI A;  1HXC A;  4MC8 A;  1N21 A;  2PS7 A;  4OKZ A;  4NG6 A;  3EFQ A;  3TFN A;  5JV2 F;  2AZK A;  3AQ0 A;  4JXY A;  3SAE A;  3PYB A;  4N1Z F;  3S4J A;  5JA0 F;  4LXW A;  4KVD A;  1YYR A;  2E8U A;  3N0F A;  3VJB A;  3WEF A;  4LLS A;  4E1E A;  4KQS A;  5HN7 A;  4ZQ8 A;  5I1U A;  3WJN A;  1VG4 A;  5B0I A;  3VJE A;  3LG5 A;  4P0V A;  3TC1 A;  3CKE A;  3NF2 A;  4LFE A;  3DYH A;  3ID0 A;  1YYS A;  4KUX A;  4JZX A;  4GP1 A;  4H5D F;  4JYX A;  2Z4Y A;  2Z7H A;  3NPK A;  3WEK A;  1FPS A;  3B7L A;  4KVI A;  3N0G A;  4NFK F;  1DGP A;  4LA5 A;  5B0M A;  4LFG A;  3ICZ A;  4P0X A;  1PS1 A;  5ILD A;  5DIQ F;  2E4O A;  3ADZ A;  2Q9Z A;  4RXA A;  3S9V A;  3BNX A;  3SDT A;  3WCG A;  1HX9 A;  3WEG A;  5JV0 F;  4JZB A;  3AQB B;  4KPD A;  5DGN F;  1V4E A;  5ILK A;  5ERO A;  4LZC A;  2J1O A;  2ONG A;  3LGZ B;  3M9U A;  3RBM A;  3EGT A;  3N45 F;  3ACX A;  4NFI F;  2ZY1 A;  5ILJ A;  1UBY A;  4P0W A;  3PKO A;  4L2X F;  3WCD A;  5EAU A;  5H9D A;  5JUZ F;  4PVY F;  5B01 A;  4RXD A;  5IK6 A;  3ZCD A;  1YJ4 A;  4GAX A;  3V66 A;  1WL2 A;  4LPH F;  5JV1 F;  3NRI A;  3PDE A;  3ZL6 A;  3V1X A;  2Z52 A;  5IKH A;  3WEI A;  4PVX F;  3WJO A;  3N1V F;  4DI5 A;  5E8H A;  4JXN A;  4LUU A;  3V1V A;  4NKE A;  5DJR F;  5ER8 A;  3LGK A;  1YYT A;  1YHL A;  2Z4V A;  3WEH A;  1WL1 A;  3KB9 A;  3Q1O A;  3SDQ A;  2Z4W A;  3SDV A;  3WEJ A;  4F62 A;  2E91 A;  4LIX A;  3P5R A;  3PH7 A;  5IK9 A;  5B0J A;  2ZCQ A;  1WL3 A;  4RXC A;  3LVS A;  2ZEV A;  4LA6 A;  2AZJ A;  2E8X A;  2Z7I A;  3P8R A;  3LSN A;  1WMW A;  2AET A;  4F6X A;  5CG6 A;  5DGM F;  3OAC A;  3WCL A;  4OKM A;  5HN9 A;  3P5P A;  5AFX A;  3LMD A;  3OAC B;  3LDW A;  2ONH A;  2E95 A;  2P1C A;  1N24 A;  2H8O A;  5AHU B;  3DYG A;  1KIY A;  5AYP A;  5IM1 A;  2Q80 A;  1HXA A;  2Z50 A; 
#chains in the Genus database with same CATH topology
 2EWG A;  3W7F A;  3ZOU A;  2PS4 A;  2ZCO A;  2F7M F;  2ZCS A;  4LFV F;  5B00 A;  5A0I A;  4HD1 A;  3Q2Z A;  1HM4 A;  4KQU A;  5E8K A;  3TS7 A;  5ILY A;  2FOR A;  4KVY A;  2OPN A;  5IKA A;  1WY0 A;  2Z78 A;  2E8T A;  4JVJ F;  4LPG F;  3LK5 A;  3N49 F;  4OMG A;  1V4I A;  1VG2 A;  2F9K F;  4LZ0 A;  3WCH A;  4DXJ A;  4DWB A;  2I19 A;  2OGD A;  5E8L A;  1VG3 A;  3ASX A;  5EAS A;  3EZ3 A;  3IBA A;  3Q30 A;  4DEM F;  3WSB A;  4OMH A;  4GP2 A;  5IN8 A;  3SDU A;  3QQV A;  1V4J A;  2E93 A;  4H5E F;  1RTR A;  2E90 A;  3QKC A;  3WCI A;  1N1B A;  4NUA A;  3ICN A;  1N1Z A;  3AQC B;  5DJV F;  4LOB A;  3WCF A;  4XQS F;  5ILH A;  3LZ9 A;  3WCM A;  3OYR A;  2J5C A;  3KRO A;  5DW7 A;  5A0K A;  4KKM A;  2OA6 A;  3KRO B;  3VJA A;  3TFP A;  4LTV A;  3KRF A;  5B02 A;  3ACW A;  1YYQ A;  3ICK A;  4QPF A;  5ILZ A;  5IMP A;  3KRF B;  3MZV A;  4LZ3 A;  3LJI A;  3WJK A;  4GA3 A;  4DZW A;  1JFA A;  4H5C F;  3SDR A;  5IK0 A;  4KK2 A;  1YHM A;  1N20 A;  3G4D A;  2AEL A;  1UBW A;  2F8Z F;  1HM7 A;  2DH4 A;  3LOM A;  3MAV A;  2F8C F;  2F92 F;  5EAT A;  4WK5 A;  1ZW5 A;  2RAH A;  5IL8 A;  3KBK A;  1VG7 A;  2Z4Z A;  5DHI A;  3ZMB A;  5AEL A;  4DHD A;  3NPR A;  4K10 A;  2F94 F;  3LEE A;  3VJD A;  1YYU A;  4UMJ A;  3M00 A;  3WSA A;  4MC0 A;  5IMN A;  1N23 A;  4KQ5 A;  3P41 A;  3M01 A;  3WCA A;  4RXE A;  2F89 F;  5A0J A;  5DJP F;  1WL0 A;  4N9U A;  5B0K A;  1YHK A;  2O1O A;  2PS5 A;  3PYA A;  1KIZ A;  5B03 A;  1V4K A;  4QXS F;  1UBV A;  4XQT F;  3CC9 A;  4F6V A;  5B0L A;  1N22 A;  3RMG A;  3M02 A;  3APZ A;  5HN8 A;  3KRP A;  3P8L A;  3OAB A;  2E8W A;  1YV5 A;  1WKZ A;  3VJ8 A;  5KSX F;  3KRP B;  1EZF A;  3OAB B;  5IVG A;  3RYW A;  4NFJ F;  2FTZ A;  5IL3 A;  2AZL A;  3ACY A;  5DHK A;  3WCJ A;  4KVW A;  2Q58 A;  4DWG A;  2AEK A;  1JFG A;  3LLW A;  3WCC A;  4KWD A;  2QIS A;  3N6K F;  4OGU A;  3N3L F;  5CG5 A;  2VF6 A;  3ICM A;  4KFA A;  3VJ9 A;  2E94 A;  3G4F A;  5HNA A;  4Q23 A;  3KRA A;  2ZCR A;  4EA1 A;  1VG6 A;  4XQR F;  1DI1 A;  5C05 A;  2Z4X A;  4EA0 A;  4RYP A;  4FJQ A;  5ERM A;  2J1P A;  1UBX A;  5DGS F;  4RNQ A;  3DYF A;  4LLT A;  1HXG A;  3KRA B;  3N5J F;  2Q9Y A;  1RQI A;  3BNY A;  1V4H A;  3N46 F;  3WCB A;  4E9Z A;  2PS6 A;  3VJC A;  3WE9 A;  3CP6 A;  4E9U A;  3N5H F;  3Q2Q A;  2OPM A;  2ZEU A;  3UCA A;  3AE0 A;  3IPI A;  5DZ2 A;  4KPJ A;  3N1W F;  2E92 A;  4EA2 A;  3KRC A;  4NKF A;  4LTZ A;  3WC9 A;  4FP4 A;  3RYE A;  1YQ7 A;  5ILI A;  3TFV A;  3WCE A;  3KRC B;  3N3D A;  1RQJ A;  4MC3 A;  5ERN A;  3ZMC A;  3M0G A;  2E8V A;  2PS8 A;  5IMI A;  1HXC A;  4MC8 A;  1N21 A;  2PS7 A;  4OKZ A;  4NG6 A;  3EFQ A;  3TFN A;  5JV2 F;  2AZK A;  3AQ0 A;  4JXY A;  3SAE A;  3PYB A;  4N1Z F;  3S4J A;  5JA0 F;  4LXW A;  4KVD A;  1YYR A;  2E8U A;  3N0F A;  3VJB A;  3WEF A;  4LLS A;  4E1E A;  4KQS A;  5HN7 A;  4ZQ8 A;  5I1U A;  3WJN A;  1VG4 A;  5B0I A;  3VJE A;  3LG5 A;  4P0V A;  3TC1 A;  3CKE A;  3NF2 A;  4LFE A;  3DYH A;  3ID0 A;  1YYS A;  4KUX A;  4JZX A;  4GP1 A;  4H5D F;  4JYX A;  2Z4Y A;  2Z7H A;  3NPK A;  3WEK A;  1FPS A;  3B7L A;  4KVI A;  3N0G A;  4NFK F;  1DGP A;  4LA5 A;  5B0M A;  4LFG A;  3ICZ A;  4P0X A;  1PS1 A;  5ILD A;  5DIQ F;  2E4O A;  3ADZ A;  2Q9Z A;  4RXA A;  3S9V A;  3BNX A;  3SDT A;  3WCG A;  1HX9 A;  3WEG A;  5JV0 F;  4JZB A;  3AQB B;  4KPD A;  5DGN F;  1V4E A;  5ILK A;  5ERO A;  4LZC A;  2J1O A;  2ONG A;  3LGZ B;  3M9U A;  3RBM A;  3EGT A;  3N45 F;  3ACX A;  4NFI F;  2ZY1 A;  5ILJ A;  1UBY A;  4P0W A;  3PKO A;  4L2X F;  3WCD A;  5EAU A;  5H9D A;  5JUZ F;  4PVY F;  5B01 A;  4RXD A;  5IK6 A;  3ZCD A;  1YJ4 A;  4GAX A;  3V66 A;  1WL2 A;  4LPH F;  5JV1 F;  3NRI A;  3PDE A;  3ZL6 A;  3V1X A;  2Z52 A;  5IKH A;  3WEI A;  4PVX F;  3WJO A;  3N1V F;  4DI5 A;  5E8H A;  4JXN A;  4LUU A;  3V1V A;  4NKE A;  5DJR F;  5ER8 A;  3LGK A;  1YYT A;  1YHL A;  2Z4V A;  3WEH A;  1WL1 A;  3KB9 A;  3Q1O A;  3SDQ A;  2Z4W A;  3SDV A;  3WEJ A;  4F62 A;  2E91 A;  4LIX A;  3P5R A;  3PH7 A;  5IK9 A;  5B0J A;  2ZCQ A;  1WL3 A;  4RXC A;  3LVS A;  2ZEV A;  4LA6 A;  2AZJ A;  2E8X A;  2Z7I A;  3P8R A;  3LSN A;  1WMW A;  2AET A;  4F6X A;  5CG6 A;  5DGM F;  3OAC A;  3WCL A;  4OKM A;  5HN9 A;  3P5P A;  5AFX A;  3LMD A;  3OAC B;  3LDW A;  2ONH A;  2E95 A;  2P1C A;  1N24 A;  2H8O A;  5AHU B;  3DYG A;  1KIY A;  5AYP A;  5IM1 A;  2Q80 A;  1HXA A;  2Z50 A; 
#chains in the Genus database with same CATH homology
 2EWG A;  3W7F A;  3ZOU A;  2PS4 A;  2ZCO A;  2F7M F;  2ZCS A;  4LFV F;  5B00 A;  5A0I A;  4HD1 A;  3Q2Z A;  1HM4 A;  4KQU A;  5E8K A;  3TS7 A;  5ILY A;  2FOR A;  4KVY A;  2OPN A;  5IKA A;  1WY0 A;  2Z78 A;  2E8T A;  4JVJ F;  4LPG F;  3LK5 A;  3N49 F;  4OMG A;  1V4I A;  1VG2 A;  2F9K F;  4LZ0 A;  3WCH A;  4DXJ A;  4DWB A;  2I19 A;  2OGD A;  5E8L A;  1VG3 A;  3ASX A;  5EAS A;  3EZ3 A;  3IBA A;  3Q30 A;  4DEM F;  3WSB A;  4OMH A;  4GP2 A;  5IN8 A;  3SDU A;  3QQV A;  1V4J A;  2E93 A;  4H5E F;  1RTR A;  2E90 A;  3QKC A;  3WCI A;  1N1B A;  4NUA A;  3ICN A;  1N1Z A;  3AQC B;  5DJV F;  4LOB A;  3WCF A;  4XQS F;  5ILH A;  3LZ9 A;  3WCM A;  3OYR A;  2J5C A;  3KRO A;  5DW7 A;  5A0K A;  4KKM A;  2OA6 A;  3KRO B;  3VJA A;  3TFP A;  4LTV A;  3KRF A;  5B02 A;  3ACW A;  1YYQ A;  3ICK A;  4QPF A;  5ILZ A;  5IMP A;  3KRF B;  3MZV A;  4LZ3 A;  3LJI A;  3WJK A;  4GA3 A;  4DZW A;  1JFA A;  4H5C F;  3SDR A;  5IK0 A;  4KK2 A;  1YHM A;  1N20 A;  3G4D A;  2AEL A;  1UBW A;  2F8Z F;  1HM7 A;  2DH4 A;  3LOM A;  3MAV A;  2F8C F;  2F92 F;  5EAT A;  4WK5 A;  1ZW5 A;  2RAH A;  5IL8 A;  3KBK A;  1VG7 A;  2Z4Z A;  5DHI A;  3ZMB A;  5AEL A;  4DHD A;  3NPR A;  4K10 A;  2F94 F;  3LEE A;  3VJD A;  1YYU A;  4UMJ A;  3M00 A;  3WSA A;  4MC0 A;  5IMN A;  1N23 A;  4KQ5 A;  3P41 A;  3M01 A;  3WCA A;  4RXE A;  2F89 F;  5A0J A;  5DJP F;  1WL0 A;  4N9U A;  5B0K A;  1YHK A;  2O1O A;  2PS5 A;  3PYA A;  1KIZ A;  5B03 A;  1V4K A;  4QXS F;  1UBV A;  4XQT F;  3CC9 A;  4F6V A;  5B0L A;  1N22 A;  3RMG A;  3M02 A;  3APZ A;  5HN8 A;  3KRP A;  3P8L A;  3OAB A;  2E8W A;  1YV5 A;  1WKZ A;  3VJ8 A;  5KSX F;  3KRP B;  1EZF A;  3OAB B;  5IVG A;  3RYW A;  4NFJ F;  2FTZ A;  5IL3 A;  2AZL A;  3ACY A;  5DHK A;  3WCJ A;  4KVW A;  2Q58 A;  4DWG A;  2AEK A;  1JFG A;  3LLW A;  3WCC A;  4KWD A;  2QIS A;  3N6K F;  4OGU A;  3N3L F;  5CG5 A;  2VF6 A;  3ICM A;  4KFA A;  3VJ9 A;  2E94 A;  3G4F A;  5HNA A;  4Q23 A;  3KRA A;  2ZCR A;  4EA1 A;  1VG6 A;  4XQR F;  1DI1 A;  5C05 A;  2Z4X A;  4EA0 A;  4RYP A;  4FJQ A;  5ERM A;  2J1P A;  1UBX A;  5DGS F;  4RNQ A;  3DYF A;  4LLT A;  1HXG A;  3KRA B;  3N5J F;  2Q9Y A;  1RQI A;  3BNY A;  1V4H A;  3N46 F;  3WCB A;  4E9Z A;  2PS6 A;  3VJC A;  3WE9 A;  3CP6 A;  4E9U A;  3N5H F;  3Q2Q A;  2OPM A;  2ZEU A;  3UCA A;  3AE0 A;  3IPI A;  5DZ2 A;  4KPJ A;  3N1W F;  2E92 A;  4EA2 A;  3KRC A;  4NKF A;  4LTZ A;  3WC9 A;  4FP4 A;  3RYE A;  1YQ7 A;  5ILI A;  3TFV A;  3WCE A;  3KRC B;  3N3D A;  1RQJ A;  4MC3 A;  5ERN A;  3ZMC A;  3M0G A;  2E8V A;  2PS8 A;  5IMI A;  1HXC A;  4MC8 A;  1N21 A;  2PS7 A;  4OKZ A;  4NG6 A;  3EFQ A;  3TFN A;  5JV2 F;  2AZK A;  3AQ0 A;  4JXY A;  3SAE A;  3PYB A;  4N1Z F;  3S4J A;  5JA0 F;  4LXW A;  4KVD A;  1YYR A;  2E8U A;  3N0F A;  3VJB A;  3WEF A;  4LLS A;  4E1E A;  4KQS A;  5HN7 A;  4ZQ8 A;  5I1U A;  3WJN A;  1VG4 A;  5B0I A;  3VJE A;  3LG5 A;  4P0V A;  3TC1 A;  3CKE A;  3NF2 A;  4LFE A;  3DYH A;  3ID0 A;  1YYS A;  4KUX A;  4JZX A;  4GP1 A;  4H5D F;  4JYX A;  2Z4Y A;  2Z7H A;  3NPK A;  3WEK A;  1FPS A;  3B7L A;  4KVI A;  3N0G A;  4NFK F;  1DGP A;  4LA5 A;  5B0M A;  4LFG A;  3ICZ A;  4P0X A;  1PS1 A;  5ILD A;  5DIQ F;  2E4O A;  3ADZ A;  2Q9Z A;  4RXA A;  3S9V A;  3BNX A;  3SDT A;  3WCG A;  1HX9 A;  3WEG A;  5JV0 F;  4JZB A;  3AQB B;  4KPD A;  5DGN F;  1V4E A;  5ILK A;  5ERO A;  4LZC A;  2J1O A;  2ONG A;  3LGZ B;  3M9U A;  3RBM A;  3EGT A;  3N45 F;  3ACX A;  4NFI F;  2ZY1 A;  5ILJ A;  1UBY A;  4P0W A;  3PKO A;  4L2X F;  3WCD A;  5EAU A;  5H9D A;  5JUZ F;  4PVY F;  5B01 A;  4RXD A;  5IK6 A;  3ZCD A;  1YJ4 A;  4GAX A;  3V66 A;  1WL2 A;  4LPH F;  5JV1 F;  3NRI A;  3PDE A;  3ZL6 A;  3V1X A;  2Z52 A;  5IKH A;  3WEI A;  4PVX F;  3WJO A;  3N1V F;  4DI5 A;  5E8H A;  4JXN A;  4LUU A;  3V1V A;  4NKE A;  5DJR F;  5ER8 A;  3LGK A;  1YYT A;  1YHL A;  2Z4V A;  3WEH A;  1WL1 A;  3KB9 A;  3Q1O A;  3SDQ A;  2Z4W A;  3SDV A;  3WEJ A;  4F62 A;  2E91 A;  4LIX A;  3P5R A;  3PH7 A;  5IK9 A;  5B0J A;  2ZCQ A;  1WL3 A;  4RXC A;  3LVS A;  2ZEV A;  4LA6 A;  2AZJ A;  2E8X A;  2Z7I A;  3P8R A;  3LSN A;  1WMW A;  2AET A;  4F6X A;  5CG6 A;  5DGM F;  3OAC A;  3WCL A;  4OKM A;  5HN9 A;  3P5P A;  5AFX A;  3LMD A;  3OAC B;  3LDW A;  2ONH A;  2E95 A;  2P1C A;  1N24 A;  2H8O A;  5AHU B;  3DYG A;  1KIY A;  5AYP A;  5IM1 A;  2Q80 A;  1HXA A;  2Z50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...