3TFPA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with bph-1162
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Dual dehydrosqualene/squalene synthase inhibitors: leads for innate immune system-based therapeutics.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 124
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3tfpA00
3SDTA 3IPIA 4KVDA 3WSBA 3P8LA 4MC0A 3Q2QA 5EASA 3IBAA 4RXEA 5DGSF 4H5DF 4LFGA 4LZCA 4WK5A 1VG6A 2Q80A 4GP2A 2Z4YA 2Z4XA 1RQIA 2AEKA 4RXAA 1WKZA 3P8RA 1HX9A 4OGUA 5AELA 3ICZA 2RAHA 1VG3A 3QKCA 4EA1A 1VG7A 4RXCA 4NFKF 5ILKA 2AZKA 3OYRA 1VG2A 3N46F 2ZCSA 3M9UA 4LTVA 4GP1A 3WCLA 5IM1A 5ERMA 3ICKA 1YHMA 3N6KF 3KRCA 3OABB 3V1XA 5CG5A 3CC9A 4FP4A 2E94A 5IK0A 3LLWA 2Q9YA 5KSXF 3N3DA 1YV5A 2E91A 1V4KA 4RYPA 3QQVA 2Z50A 1WL0A 5JV2F 3MZVA 4LUUA 4Q23A 4PVYF 3PYAA 3NRIA 4QPFA 4NFJF 3WJKA 3SDUA 4DWGA 3N1WF 1UBXA 2AZJA 3KRAB 3AQ0A 1HM7A 2PS4A 5A0KA 3EFQA 4LTZA 3LOMA 4ZQ8A 5ILIA 3WCBA 1FPSA 3PKOA 5HN7A 3KBKA 3APZA 2ZCRA 5DJRF 2E8XA 5IVGA 2DH4A 5AFXA 3ZCDA 5E8HA 3WEKA 1HXCA 2OGDA 3KRPB 3NF2A 4XQRF 1YHKA 3WCJA 1HXAA 3EZ3A 1RQJA 4P0VA 1V4JA 2F8CF 2H8OA 3WCGA 3UCAA 5DZ2A 3WCHA 3LK5A 3SDRA 3P41A 5B03A 5IL3A 2Z52A 4E9UA 5ILJA 3RYEA 4NFIF 3ICNA 1YYUA 3N3LF 1N1BA 3KRFB 4XQSF 5ILDA 2FORA 3WJNA 2Z4VA 3G4DA 5IMPA 3LZ9A 2E8VA 3ZMCA 1N22A 2F7MF 4LA5A 4OKMA 5AHUB 4H5CF 3WCAA 4RNQA 3VJDA 3ADZA 4H5EF 2F94F 4N1ZF 3SDVA 1N24A 3S9VA 5DIQF 5B0KA 2J5CA 3LGZB 5HN8A 3KROB 3OABA 2AETA 2PS5A 3M00A 1DI1A 4DWBA 5E8KA 2F9KF 3LSNA 5JUZF 5ILHA 3VJBA 4MC8A 1YYTA 5C05A 3LDWA 3ASXA 3WJOA 1WL1A 3WSAA 3DYGA 2E90A 5B0IA 1WY0A 3VJ8A 3TFPA 2VF6A 5B0JA 3LMDA 2F92F 2E8UA 2OPMA 1YJ4A 3TFNA 5IN8A 4FJQA 5AYPA 1WL3A 2EWGA 1YYQA 3ICMA 3KB9A 5B02A 3RYWA 3BNXA 3WCDA 3WCCA 4LFVF 2Z4WA 1JFGA 3TFVA 4LPHF 2PS6A 4NG6A 5DGMF 1V4HA 3SAEA 5JA0F 3ACWA 3KRCB 4KK2A 2P1CA 3W7FA 5EATA 3RMGA 1UBYA 3TS7A 4P0WA 2FTZA 1KIYA 3PYBA 4EA2A 3CKEA 3B7LA 3WCFA 5JV1F 2F89F 4OMHA 3RBMA 2QISA 4JZBA 3ZMBA 3OACA 5ILYA 4KQSA 4XQTF 5IK6A 5IMIA 3DYHA 4LOBA 4LXWA 3S4JA 3AQBB 1UBWA 5IK9A 2AELA 3KRFA 3G4FA 3N1VF 3LG5A 2ONGA 2O1OA 4KVIA 3V1VA 5I1UA 2OA6A 3WEFA 2E95A 1N1ZA 5B0MA 3PH7A 3WEJA 4PVXF 2E93A 4KWDA 2E92A 1RTRA 1PS1A 1YHLA 3AQCB 3WC9A 1YYSA 3ACXA 3NPRA 4P0XA 5DJPF 1YQ7A 4DI5A 4GA3A 2Z78A 4KFAA 4OMGA 3WCMA 3N49F 1KIZA 3LGKA 3LJIA 4LA6A 4LIXA 3WEHA 3VJCA 1N20A 4GAXA 3ACYA 5ILZA 3TC1A 4N9UA 3ID0A 4UMJA 5B00A 5EAUA 1JFAA 2ZEVA 2AZLA 2E4OA 4KQ5A 4E9ZA 3Q30A 3EGTA 5HN9A 2J1OA 2Z7HA 4EA0A 1DGPA 3PDEA 3CP6A 1V4EA 4LPGF 5DJVF 4F6VA 1HXGA 2PS8A 4E1EA 4LZ0A 4NKFA 1N23A 3M0GA 4QXSF 4HD1A 3WEIA 1WMWA 5E8LA 3P5RA 3KRAA 3Q2ZA 3M01A 3N5HF 3LEEA 3LVSA 4DXJA 3N0FA 3BNYA 3WE9A 4KKMA 5IKAA 5IKHA 2ONHA 1VG4A 4DHDA 3VJAA 3WCIA 5EROA 1V4IA 3DYFA 5DGNF 3P5PA 1WL2A 2Q9ZA 5A0IA 1EZFA 2OPNA 3KRPA 4L2XF 4KPJA 5ER8A 2ZCOA 4KVYA 4NKEA 3AE0A 1UBVA 5DHIA 4KPDA 4DEMF 4MC3A 3N45F 3WEGA 3ZL6A 2F8ZF 2PS7A 3Q1OA 4LLSA 5CG6A 4F6XA 3VJEA 1HM4A 4JXNA 3NPKA 3N0GA 2J1PA 4NUAA 5A0JA 2Z7IA 1YYRA 2E8WA 3SDQA 4LLTA 4JXYA 4KUXA 4JZXA 4F62A 3ZOUA 1ZW5A 5IL8A 4LFEA 4DZWA 2E8TA 2ZEUA 2ZCQA 1N21A 5DW7A 2I19A 3VJ9A 2Z4ZA 5JV0F 4RXDA 3N5JF 4OKZA 3WCEA 5IMNA 4LZ3A 3MAVA 4JYXA 2ZY1A 5B01A 4K10A 3V66A 3OACB 5H9DA 3KROA 4KVWA 5ERNA 5DHKA 3M02A 5HNAA 5B0LA 4JVJF 2Q58A 4KQUA
chains in the Genus database with same CATH superfamily
3SDTA 3IPIA 4KVDA 3WSBA 3P8LA 4MC0A 3Q2QA 5EASA 3IBAA 4RXEA 5DGSF 4H5DF 4LFGA 4LZCA 4WK5A 1VG6A 2Q80A 4GP2A 2Z4YA 2Z4XA 1RQIA 2AEKA 4RXAA 1WKZA 3P8RA 1HX9A 4OGUA 5AELA 3ICZA 2RAHA 1VG3A 3QKCA 4EA1A 1VG7A 4RXCA 4NFKF 5ILKA 2AZKA 3OYRA 1VG2A 3N46F 2ZCSA 3M9UA 4LTVA 4GP1A 3WCLA 5IM1A 5ERMA 3ICKA 1YHMA 3N6KF 3KRCA 3OABB 3V1XA 5CG5A 3CC9A 4FP4A 2E94A 5IK0A 3LLWA 2Q9YA 5KSXF 3N3DA 1YV5A 2E91A 1V4KA 4RYPA 3QQVA 2Z50A 1WL0A 5JV2F 3MZVA 4LUUA 4Q23A 4PVYF 3PYAA 3NRIA 4QPFA 4NFJF 3WJKA 3SDUA 4DWGA 3N1WF 1UBXA 2AZJA 3KRAB 3AQ0A 1HM7A 2PS4A 5A0KA 3EFQA 4LTZA 3LOMA 4ZQ8A 5ILIA 3WCBA 1FPSA 3PKOA 5HN7A 3KBKA 3APZA 2ZCRA 5DJRF 2E8XA 5IVGA 2DH4A 5AFXA 3ZCDA 5E8HA 3WEKA 1HXCA 2OGDA 3KRPB 3NF2A 4XQRF 1YHKA 3WCJA 1HXAA 3EZ3A 1RQJA 4P0VA 1V4JA 2F8CF 2H8OA 3WCGA 3UCAA 5DZ2A 3WCHA 3LK5A 3SDRA 3P41A 5B03A 5IL3A 2Z52A 4E9UA 5ILJA 3RYEA 4NFIF 3ICNA 1YYUA 3N3LF 1N1BA 3KRFB 4XQSF 5ILDA 2FORA 3WJNA 2Z4VA 3G4DA 5IMPA 3LZ9A 2E8VA 3ZMCA 1N22A 2F7MF 4LA5A 4OKMA 5AHUB 4H5CF 3WCAA 4RNQA 3VJDA 3ADZA 4H5EF 2F94F 4N1ZF 3SDVA 1N24A 3S9VA 5DIQF 5B0KA 2J5CA 3LGZB 5HN8A 3KROB 3OABA 2AETA 2PS5A 3M00A 1DI1A 4DWBA 5E8KA 2F9KF 3LSNA 5JUZF 5ILHA 3VJBA 4MC8A 1YYTA 5C05A 3LDWA 3ASXA 3WJOA 1WL1A 3WSAA 3DYGA 2E90A 5B0IA 1WY0A 3VJ8A 3TFPA 2VF6A 5B0JA 3LMDA 2F92F 2E8UA 2OPMA 1YJ4A 3TFNA 5IN8A 4FJQA 5AYPA 1WL3A 2EWGA 1YYQA 3ICMA 3KB9A 5B02A 3RYWA 3BNXA 3WCDA 3WCCA 4LFVF 2Z4WA 1JFGA 3TFVA 4LPHF 2PS6A 4NG6A 5DGMF 1V4HA 3SAEA 5JA0F 3ACWA 3KRCB 4KK2A 2P1CA 3W7FA 5EATA 3RMGA 1UBYA 3TS7A 4P0WA 2FTZA 1KIYA 3PYBA 4EA2A 3CKEA 3B7LA 3WCFA 5JV1F 2F89F 4OMHA 3RBMA 2QISA 4JZBA 3ZMBA 3OACA 5ILYA 4KQSA 4XQTF 5IK6A 5IMIA 3DYHA 4LOBA 4LXWA 3S4JA 3AQBB 1UBWA 5IK9A 2AELA 3KRFA 3G4FA 3N1VF 3LG5A 2ONGA 2O1OA 4KVIA 3V1VA 5I1UA 2OA6A 3WEFA 2E95A 1N1ZA 5B0MA 3PH7A 3WEJA 4PVXF 2E93A 4KWDA 2E92A 1RTRA 1PS1A 1YHLA 3AQCB 3WC9A 1YYSA 3ACXA 3NPRA 4P0XA 5DJPF 1YQ7A 4DI5A 4GA3A 2Z78A 4KFAA 4OMGA 3WCMA 3N49F 1KIZA 3LGKA 3LJIA 4LA6A 4LIXA 3WEHA 3VJCA 1N20A 4GAXA 3ACYA 5ILZA 3TC1A 4N9UA 3ID0A 4UMJA 5B00A 5EAUA 1JFAA 2ZEVA 2AZLA 2E4OA 4KQ5A 4E9ZA 3Q30A 3EGTA 5HN9A 2J1OA 2Z7HA 4EA0A 1DGPA 3PDEA 3CP6A 1V4EA 4LPGF 5DJVF 4F6VA 1HXGA 2PS8A 4E1EA 4LZ0A 4NKFA 1N23A 3M0GA 4QXSF 4HD1A 3WEIA 1WMWA 5E8LA 3P5RA 3KRAA 3Q2ZA 3M01A 3N5HF 3LEEA 3LVSA 4DXJA 3N0FA 3BNYA 3WE9A 4KKMA 5IKAA 5IKHA 2ONHA 1VG4A 4DHDA 3VJAA 3WCIA 5EROA 1V4IA 3DYFA 5DGNF 3P5PA 1WL2A 2Q9ZA 5A0IA 1EZFA 2OPNA 3KRPA 4L2XF 4KPJA 5ER8A 2ZCOA 4KVYA 4NKEA 3AE0A 1UBVA 5DHIA 4KPDA 4DEMF 4MC3A 3N45F 3WEGA 3ZL6A 2F8ZF 2PS7A 3Q1OA 4LLSA 5CG6A 4F6XA 3VJEA 1HM4A 4JXNA 3NPKA 3N0GA 2J1PA 4NUAA 5A0JA 2Z7IA 1YYRA 2E8WA 3SDQA 4LLTA 4JXYA 4KUXA 4JZXA 4F62A 3ZOUA 1ZW5A 5IL8A 4LFEA 4DZWA 2E8TA 2ZEUA 2ZCQA 1N21A 5DW7A 2I19A 3VJ9A 2Z4ZA 5JV0F 4RXDA 3N5JF 4OKZA 3WCEA 5IMNA 4LZ3A 3MAVA 4JYXA 2ZY1A 5B01A 4K10A 3V66A 3OACB 5H9DA 3KROA 4KVWA 5ERNA 5DHKA 3M02A 5HNAA 5B0LA 4JVJF 2Q58A 4KQUA
chains in the Genus database with same CATH topology
3SDTA 3IPIA 4KVDA 3WSBA 3P8LA 4MC0A 3Q2QA 5EASA 3IBAA 4RXEA 5DGSF 4H5DF 4LFGA 4LZCA 4WK5A 1VG6A 2Q80A 4GP2A 2Z4YA 2Z4XA 1RQIA 2AEKA 4RXAA 1WKZA 3P8RA 1HX9A 4OGUA 5AELA 3ICZA 2RAHA 1VG3A 3QKCA 4EA1A 1VG7A 4RXCA 4NFKF 5ILKA 2AZKA 3OYRA 1VG2A 3N46F 2ZCSA 3M9UA 4LTVA 4GP1A 3WCLA 5IM1A 5ERMA 3ICKA 1YHMA 3N6KF 3KRCA 3OABB 3V1XA 5CG5A 3CC9A 4FP4A 2E94A 5IK0A 3LLWA 2Q9YA 5KSXF 3N3DA 1YV5A 2E91A 1V4KA 4RYPA 3QQVA 2Z50A 1WL0A 5JV2F 3MZVA 4LUUA 4Q23A 4PVYF 3PYAA 3NRIA 4QPFA 4NFJF 3WJKA 3SDUA 4DWGA 3N1WF 1UBXA 2AZJA 3KRAB 3AQ0A 1HM7A 2PS4A 5A0KA 3EFQA 4LTZA 3LOMA 4ZQ8A 5ILIA 3WCBA 1FPSA 3PKOA 5HN7A 3KBKA 3APZA 2ZCRA 5DJRF 2E8XA 5IVGA 2DH4A 5AFXA 3ZCDA 5E8HA 3WEKA 1HXCA 2OGDA 3KRPB 3NF2A 4XQRF 1YHKA 3WCJA 1HXAA 3EZ3A 1RQJA 4P0VA 1V4JA 2F8CF 2H8OA 3WCGA 3UCAA 5DZ2A 3WCHA 3LK5A 3SDRA 3P41A 5B03A 5IL3A 2Z52A 4E9UA 5ILJA 3RYEA 4NFIF 3ICNA 1YYUA 3N3LF 1N1BA 3KRFB 4XQSF 5ILDA 2FORA 3WJNA 2Z4VA 3G4DA 5IMPA 3LZ9A 2E8VA 3ZMCA 1N22A 2F7MF 4LA5A 4OKMA 5AHUB 4H5CF 3WCAA 4RNQA 3VJDA 3ADZA 4H5EF 2F94F 4N1ZF 3SDVA 1N24A 3S9VA 5DIQF 5B0KA 2J5CA 3LGZB 5HN8A 3KROB 3OABA 2AETA 2PS5A 3M00A 1DI1A 4DWBA 5E8KA 2F9KF 3LSNA 5JUZF 5ILHA 3VJBA 4MC8A 1YYTA 5C05A 3LDWA 3ASXA 3WJOA 1WL1A 3WSAA 3DYGA 2E90A 5B0IA 1WY0A 3VJ8A 3TFPA 2VF6A 5B0JA 3LMDA 2F92F 2E8UA 2OPMA 1YJ4A 3TFNA 5IN8A 4FJQA 5AYPA 1WL3A 2EWGA 1YYQA 3ICMA 3KB9A 5B02A 3RYWA 3BNXA 3WCDA 3WCCA 4LFVF 2Z4WA 1JFGA 3TFVA 4LPHF 2PS6A 4NG6A 5DGMF 1V4HA 3SAEA 5JA0F 3ACWA 3KRCB 4KK2A 2P1CA 3W7FA 5EATA 3RMGA 1UBYA 3TS7A 4P0WA 2FTZA 1KIYA 3PYBA 4EA2A 3CKEA 3B7LA 3WCFA 5JV1F 2F89F 4OMHA 3RBMA 2QISA 4JZBA 3ZMBA 3OACA 5ILYA 4KQSA 4XQTF 5IK6A 5IMIA 3DYHA 4LOBA 4LXWA 3S4JA 3AQBB 1UBWA 5IK9A 2AELA 3KRFA 3G4FA 3N1VF 3LG5A 2ONGA 2O1OA 4KVIA 3V1VA 5I1UA 2OA6A 3WEFA 2E95A 1N1ZA 5B0MA 3PH7A 3WEJA 4PVXF 2E93A 4KWDA 2E92A 1RTRA 1PS1A 1YHLA 3AQCB 3WC9A 1YYSA 3ACXA 3NPRA 4P0XA 5DJPF 1YQ7A 4DI5A 4GA3A 2Z78A 4KFAA 4OMGA 3WCMA 3N49F 1KIZA 3LGKA 3LJIA 4LA6A 4LIXA 3WEHA 3VJCA 1N20A 4GAXA 3ACYA 5ILZA 3TC1A 4N9UA 3ID0A 4UMJA 5B00A 5EAUA 1JFAA 2ZEVA 2AZLA 2E4OA 4KQ5A 4E9ZA 3Q30A 3EGTA 5HN9A 2J1OA 2Z7HA 4EA0A 1DGPA 3PDEA 3CP6A 1V4EA 4LPGF 5DJVF 4F6VA 1HXGA 2PS8A 4E1EA 4LZ0A 4NKFA 1N23A 3M0GA 4QXSF 4HD1A 3WEIA 1WMWA 5E8LA 3P5RA 3KRAA 3Q2ZA 3M01A 3N5HF 3LEEA 3LVSA 4DXJA 3N0FA 3BNYA 3WE9A 4KKMA 5IKAA 5IKHA 2ONHA 1VG4A 4DHDA 3VJAA 3WCIA 5EROA 1V4IA 3DYFA 5DGNF 3P5PA 1WL2A 2Q9ZA 5A0IA 1EZFA 2OPNA 3KRPA 4L2XF 4KPJA 5ER8A 2ZCOA 4KVYA 4NKEA 3AE0A 1UBVA 5DHIA 4KPDA 4DEMF 4MC3A 3N45F 3WEGA 3ZL6A 2F8ZF 2PS7A 3Q1OA 4LLSA 5CG6A 4F6XA 3VJEA 1HM4A 4JXNA 3NPKA 3N0GA 2J1PA 4NUAA 5A0JA 2Z7IA 1YYRA 2E8WA 3SDQA 4LLTA 4JXYA 4KUXA 4JZXA 4F62A 3ZOUA 1ZW5A 5IL8A 4LFEA 4DZWA 2E8TA 2ZEUA 2ZCQA 1N21A 5DW7A 2I19A 3VJ9A 2Z4ZA 5JV0F 4RXDA 3N5JF 4OKZA 3WCEA 5IMNA 4LZ3A 3MAVA 4JYXA 2ZY1A 5B01A 4K10A 3V66A 3OACB 5H9DA 3KROA 4KVWA 5ERNA 5DHKA 3M02A 5HNAA 5B0LA 4JVJF 2Q58A 4KQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SDT A;  3IPI A;  4KVD A;  3WSB A;  3P8L A;  4MC0 A;  3Q2Q A;  5EAS A;  3IBA A;  4RXE A;  5DGS F;  4H5D F;  4LFG A;  4LZC A;  4WK5 A;  1VG6 A;  2Q80 A;  4GP2 A;  2Z4Y A;  2Z4X A;  1RQI A;  2AEK A;  4RXA A;  1WKZ A;  3P8R A;  1HX9 A;  4OGU A;  5AEL A;  3ICZ A;  2RAH A;  1VG3 A;  3QKC A;  4EA1 A;  1VG7 A;  4RXC A;  4NFK F;  5ILK A;  2AZK A;  3OYR A;  1VG2 A;  3N46 F;  2ZCS A;  3M9U A;  4LTV A;  4GP1 A;  3WCL A;  5IM1 A;  5ERM A;  3ICK A;  1YHM A;  3N6K F;  3KRC A;  3OAB B;  3V1X A;  5CG5 A;  3CC9 A;  4FP4 A;  2E94 A;  5IK0 A;  3LLW A;  2Q9Y A;  5KSX F;  3N3D A;  1YV5 A;  2E91 A;  1V4K A;  4RYP A;  3QQV A;  2Z50 A;  1WL0 A;  5JV2 F;  3MZV A;  4LUU A;  4Q23 A;  4PVY F;  3PYA A;  3NRI A;  4QPF A;  4NFJ F;  3WJK A;  3SDU A;  4DWG A;  3N1W F;  1UBX A;  2AZJ A;  3KRA B;  3AQ0 A;  1HM7 A;  2PS4 A;  5A0K A;  3EFQ A;  4LTZ A;  3LOM A;  4ZQ8 A;  5ILI A;  3WCB A;  1FPS A;  3PKO A;  5HN7 A;  3KBK A;  3APZ A;  2ZCR A;  5DJR F;  2E8X A;  5IVG A;  2DH4 A;  5AFX A;  3ZCD A;  5E8H A;  3WEK A;  1HXC A;  2OGD A;  3KRP B;  3NF2 A;  4XQR F;  1YHK A;  3WCJ A;  1HXA A;  3EZ3 A;  1RQJ A;  4P0V A;  1V4J A;  2F8C F;  2H8O A;  3WCG A;  3UCA A;  5DZ2 A;  3WCH A;  3LK5 A;  3SDR A;  3P41 A;  5B03 A;  5IL3 A;  2Z52 A;  4E9U A;  5ILJ A;  3RYE A;  4NFI F;  3ICN A;  1YYU A;  3N3L F;  1N1B A;  3KRF B;  4XQS F;  5ILD A;  2FOR A;  3WJN A;  2Z4V A;  3G4D A;  5IMP A;  3LZ9 A;  2E8V A;  3ZMC A;  1N22 A;  2F7M F;  4LA5 A;  4OKM A;  5AHU B;  4H5C F;  3WCA A;  4RNQ A;  3VJD A;  3ADZ A;  4H5E F;  2F94 F;  4N1Z F;  3SDV A;  1N24 A;  3S9V A;  5DIQ F;  5B0K A;  2J5C A;  3LGZ B;  5HN8 A;  3KRO B;  3OAB A;  2AET A;  2PS5 A;  3M00 A;  1DI1 A;  4DWB A;  5E8K A;  2F9K F;  3LSN A;  5JUZ F;  5ILH A;  3VJB A;  4MC8 A;  1YYT A;  5C05 A;  3LDW A;  3ASX A;  3WJO A;  1WL1 A;  3WSA A;  3DYG A;  2E90 A;  5B0I A;  1WY0 A;  3VJ8 A;  3TFP A;  2VF6 A;  5B0J A;  3LMD A;  2F92 F;  2E8U A;  2OPM A;  1YJ4 A;  3TFN A;  5IN8 A;  4FJQ A;  5AYP A;  1WL3 A;  2EWG A;  1YYQ A;  3ICM A;  3KB9 A;  5B02 A;  3RYW A;  3BNX A;  3WCD A;  3WCC A;  4LFV F;  2Z4W A;  1JFG A;  3TFV A;  4LPH F;  2PS6 A;  4NG6 A;  5DGM F;  1V4H A;  3SAE A;  5JA0 F;  3ACW A;  3KRC B;  4KK2 A;  2P1C A;  3W7F A;  5EAT A;  3RMG A;  1UBY A;  3TS7 A;  4P0W A;  2FTZ A;  1KIY A;  3PYB A;  4EA2 A;  3CKE A;  3B7L A;  3WCF A;  5JV1 F;  2F89 F;  4OMH A;  3RBM A;  2QIS A;  4JZB A;  3ZMB A;  3OAC A;  5ILY A;  4KQS A;  4XQT F;  5IK6 A;  5IMI A;  3DYH A;  4LOB A;  4LXW A;  3S4J A;  3AQB B;  1UBW A;  5IK9 A;  2AEL A;  3KRF A;  3G4F A;  3N1V F;  3LG5 A;  2ONG A;  2O1O A;  4KVI A;  3V1V A;  5I1U A;  2OA6 A;  3WEF A;  2E95 A;  1N1Z A;  5B0M A;  3PH7 A;  3WEJ A;  4PVX F;  2E93 A;  4KWD A;  2E92 A;  1RTR A;  1PS1 A;  1YHL A;  3AQC B;  3WC9 A;  1YYS A;  3ACX A;  3NPR A;  4P0X A;  5DJP F;  1YQ7 A;  4DI5 A;  4GA3 A;  2Z78 A;  4KFA A;  4OMG A;  3WCM A;  3N49 F;  1KIZ A;  3LGK A;  3LJI A;  4LA6 A;  4LIX A;  3WEH A;  3VJC A;  1N20 A;  4GAX A;  3ACY A;  5ILZ A;  3TC1 A;  4N9U A;  3ID0 A;  4UMJ A;  5B00 A;  5EAU A;  1JFA A;  2ZEV A;  2AZL A;  2E4O A;  4KQ5 A;  4E9Z A;  3Q30 A;  3EGT A;  5HN9 A;  2J1O A;  2Z7H A;  4EA0 A;  1DGP A;  3PDE A;  3CP6 A;  1V4E A;  4LPG F;  5DJV F;  4F6V A;  1HXG A;  2PS8 A;  4E1E A;  4LZ0 A;  4NKF A;  1N23 A;  3M0G A;  4QXS F;  4HD1 A;  3WEI A;  1WMW A;  5E8L A;  3P5R A;  3KRA A;  3Q2Z A;  3M01 A;  3N5H F;  3LEE A;  3LVS A;  4DXJ A;  3N0F A;  3BNY A;  3WE9 A;  4KKM A;  5IKA A;  5IKH A;  2ONH A;  1VG4 A;  4DHD A;  3VJA A;  3WCI A;  5ERO A;  1V4I A;  3DYF A;  5DGN F;  3P5P A;  1WL2 A;  2Q9Z A;  5A0I A;  1EZF A;  2OPN A;  3KRP A;  4L2X F;  4KPJ A;  5ER8 A;  2ZCO A;  4KVY A;  4NKE A;  3AE0 A;  1UBV A;  5DHI A;  4KPD A;  4DEM F;  4MC3 A;  3N45 F;  3WEG A;  3ZL6 A;  2F8Z F;  2PS7 A;  3Q1O A;  4LLS A;  5CG6 A;  4F6X A;  3VJE A;  1HM4 A;  4JXN A;  3NPK A;  3N0G A;  2J1P A;  4NUA A;  5A0J A;  2Z7I A;  1YYR A;  2E8W A;  3SDQ A;  4LLT A;  4JXY A;  4KUX A;  4JZX A;  4F62 A;  3ZOU A;  1ZW5 A;  5IL8 A;  4LFE A;  4DZW A;  2E8T A;  2ZEU A;  2ZCQ A;  1N21 A;  5DW7 A;  2I19 A;  3VJ9 A;  2Z4Z A;  5JV0 F;  4RXD A;  3N5J F;  4OKZ A;  3WCE A;  5IMN A;  4LZ3 A;  3MAV A;  4JYX A;  2ZY1 A;  5B01 A;  4K10 A;  3V66 A;  3OAC B;  5H9D A;  3KRO A;  4KVW A;  5ERN A;  5DHK A;  3M02 A;  5HNA A;  5B0L A;  4JVJ F;  2Q58 A;  4KQU A; 
#chains in the Genus database with same CATH topology
 3SDT A;  3IPI A;  4KVD A;  3WSB A;  3P8L A;  4MC0 A;  3Q2Q A;  5EAS A;  3IBA A;  4RXE A;  5DGS F;  4H5D F;  4LFG A;  4LZC A;  4WK5 A;  1VG6 A;  2Q80 A;  4GP2 A;  2Z4Y A;  2Z4X A;  1RQI A;  2AEK A;  4RXA A;  1WKZ A;  3P8R A;  1HX9 A;  4OGU A;  5AEL A;  3ICZ A;  2RAH A;  1VG3 A;  3QKC A;  4EA1 A;  1VG7 A;  4RXC A;  4NFK F;  5ILK A;  2AZK A;  3OYR A;  1VG2 A;  3N46 F;  2ZCS A;  3M9U A;  4LTV A;  4GP1 A;  3WCL A;  5IM1 A;  5ERM A;  3ICK A;  1YHM A;  3N6K F;  3KRC A;  3OAB B;  3V1X A;  5CG5 A;  3CC9 A;  4FP4 A;  2E94 A;  5IK0 A;  3LLW A;  2Q9Y A;  5KSX F;  3N3D A;  1YV5 A;  2E91 A;  1V4K A;  4RYP A;  3QQV A;  2Z50 A;  1WL0 A;  5JV2 F;  3MZV A;  4LUU A;  4Q23 A;  4PVY F;  3PYA A;  3NRI A;  4QPF A;  4NFJ F;  3WJK A;  3SDU A;  4DWG A;  3N1W F;  1UBX A;  2AZJ A;  3KRA B;  3AQ0 A;  1HM7 A;  2PS4 A;  5A0K A;  3EFQ A;  4LTZ A;  3LOM A;  4ZQ8 A;  5ILI A;  3WCB A;  1FPS A;  3PKO A;  5HN7 A;  3KBK A;  3APZ A;  2ZCR A;  5DJR F;  2E8X A;  5IVG A;  2DH4 A;  5AFX A;  3ZCD A;  5E8H A;  3WEK A;  1HXC A;  2OGD A;  3KRP B;  3NF2 A;  4XQR F;  1YHK A;  3WCJ A;  1HXA A;  3EZ3 A;  1RQJ A;  4P0V A;  1V4J A;  2F8C F;  2H8O A;  3WCG A;  3UCA A;  5DZ2 A;  3WCH A;  3LK5 A;  3SDR A;  3P41 A;  5B03 A;  5IL3 A;  2Z52 A;  4E9U A;  5ILJ A;  3RYE A;  4NFI F;  3ICN A;  1YYU A;  3N3L F;  1N1B A;  3KRF B;  4XQS F;  5ILD A;  2FOR A;  3WJN A;  2Z4V A;  3G4D A;  5IMP A;  3LZ9 A;  2E8V A;  3ZMC A;  1N22 A;  2F7M F;  4LA5 A;  4OKM A;  5AHU B;  4H5C F;  3WCA A;  4RNQ A;  3VJD A;  3ADZ A;  4H5E F;  2F94 F;  4N1Z F;  3SDV A;  1N24 A;  3S9V A;  5DIQ F;  5B0K A;  2J5C A;  3LGZ B;  5HN8 A;  3KRO B;  3OAB A;  2AET A;  2PS5 A;  3M00 A;  1DI1 A;  4DWB A;  5E8K A;  2F9K F;  3LSN A;  5JUZ F;  5ILH A;  3VJB A;  4MC8 A;  1YYT A;  5C05 A;  3LDW A;  3ASX A;  3WJO A;  1WL1 A;  3WSA A;  3DYG A;  2E90 A;  5B0I A;  1WY0 A;  3VJ8 A;  3TFP A;  2VF6 A;  5B0J A;  3LMD A;  2F92 F;  2E8U A;  2OPM A;  1YJ4 A;  3TFN A;  5IN8 A;  4FJQ A;  5AYP A;  1WL3 A;  2EWG A;  1YYQ A;  3ICM A;  3KB9 A;  5B02 A;  3RYW A;  3BNX A;  3WCD A;  3WCC A;  4LFV F;  2Z4W A;  1JFG A;  3TFV A;  4LPH F;  2PS6 A;  4NG6 A;  5DGM F;  1V4H A;  3SAE A;  5JA0 F;  3ACW A;  3KRC B;  4KK2 A;  2P1C A;  3W7F A;  5EAT A;  3RMG A;  1UBY A;  3TS7 A;  4P0W A;  2FTZ A;  1KIY A;  3PYB A;  4EA2 A;  3CKE A;  3B7L A;  3WCF A;  5JV1 F;  2F89 F;  4OMH A;  3RBM A;  2QIS A;  4JZB A;  3ZMB A;  3OAC A;  5ILY A;  4KQS A;  4XQT F;  5IK6 A;  5IMI A;  3DYH A;  4LOB A;  4LXW A;  3S4J A;  3AQB B;  1UBW A;  5IK9 A;  2AEL A;  3KRF A;  3G4F A;  3N1V F;  3LG5 A;  2ONG A;  2O1O A;  4KVI A;  3V1V A;  5I1U A;  2OA6 A;  3WEF A;  2E95 A;  1N1Z A;  5B0M A;  3PH7 A;  3WEJ A;  4PVX F;  2E93 A;  4KWD A;  2E92 A;  1RTR A;  1PS1 A;  1YHL A;  3AQC B;  3WC9 A;  1YYS A;  3ACX A;  3NPR A;  4P0X A;  5DJP F;  1YQ7 A;  4DI5 A;  4GA3 A;  2Z78 A;  4KFA A;  4OMG A;  3WCM A;  3N49 F;  1KIZ A;  3LGK A;  3LJI A;  4LA6 A;  4LIX A;  3WEH A;  3VJC A;  1N20 A;  4GAX A;  3ACY A;  5ILZ A;  3TC1 A;  4N9U A;  3ID0 A;  4UMJ A;  5B00 A;  5EAU A;  1JFA A;  2ZEV A;  2AZL A;  2E4O A;  4KQ5 A;  4E9Z A;  3Q30 A;  3EGT A;  5HN9 A;  2J1O A;  2Z7H A;  4EA0 A;  1DGP A;  3PDE A;  3CP6 A;  1V4E A;  4LPG F;  5DJV F;  4F6V A;  1HXG A;  2PS8 A;  4E1E A;  4LZ0 A;  4NKF A;  1N23 A;  3M0G A;  4QXS F;  4HD1 A;  3WEI A;  1WMW A;  5E8L A;  3P5R A;  3KRA A;  3Q2Z A;  3M01 A;  3N5H F;  3LEE A;  3LVS A;  4DXJ A;  3N0F A;  3BNY A;  3WE9 A;  4KKM A;  5IKA A;  5IKH A;  2ONH A;  1VG4 A;  4DHD A;  3VJA A;  3WCI A;  5ERO A;  1V4I A;  3DYF A;  5DGN F;  3P5P A;  1WL2 A;  2Q9Z A;  5A0I A;  1EZF A;  2OPN A;  3KRP A;  4L2X F;  4KPJ A;  5ER8 A;  2ZCO A;  4KVY A;  4NKE A;  3AE0 A;  1UBV A;  5DHI A;  4KPD A;  4DEM F;  4MC3 A;  3N45 F;  3WEG A;  3ZL6 A;  2F8Z F;  2PS7 A;  3Q1O A;  4LLS A;  5CG6 A;  4F6X A;  3VJE A;  1HM4 A;  4JXN A;  3NPK A;  3N0G A;  2J1P A;  4NUA A;  5A0J A;  2Z7I A;  1YYR A;  2E8W A;  3SDQ A;  4LLT A;  4JXY A;  4KUX A;  4JZX A;  4F62 A;  3ZOU A;  1ZW5 A;  5IL8 A;  4LFE A;  4DZW A;  2E8T A;  2ZEU A;  2ZCQ A;  1N21 A;  5DW7 A;  2I19 A;  3VJ9 A;  2Z4Z A;  5JV0 F;  4RXD A;  3N5J F;  4OKZ A;  3WCE A;  5IMN A;  4LZ3 A;  3MAV A;  4JYX A;  2ZY1 A;  5B01 A;  4K10 A;  3V66 A;  3OAC B;  5H9D A;  3KRO A;  4KVW A;  5ERN A;  5DHK A;  3M02 A;  5HNA A;  5B0L A;  4JVJ F;  2Q58 A;  4KQU A; 
#chains in the Genus database with same CATH homology
 3SDT A;  3IPI A;  4KVD A;  3WSB A;  3P8L A;  4MC0 A;  3Q2Q A;  5EAS A;  3IBA A;  4RXE A;  5DGS F;  4H5D F;  4LFG A;  4LZC A;  4WK5 A;  1VG6 A;  2Q80 A;  4GP2 A;  2Z4Y A;  2Z4X A;  1RQI A;  2AEK A;  4RXA A;  1WKZ A;  3P8R A;  1HX9 A;  4OGU A;  5AEL A;  3ICZ A;  2RAH A;  1VG3 A;  3QKC A;  4EA1 A;  1VG7 A;  4RXC A;  4NFK F;  5ILK A;  2AZK A;  3OYR A;  1VG2 A;  3N46 F;  2ZCS A;  3M9U A;  4LTV A;  4GP1 A;  3WCL A;  5IM1 A;  5ERM A;  3ICK A;  1YHM A;  3N6K F;  3KRC A;  3OAB B;  3V1X A;  5CG5 A;  3CC9 A;  4FP4 A;  2E94 A;  5IK0 A;  3LLW A;  2Q9Y A;  5KSX F;  3N3D A;  1YV5 A;  2E91 A;  1V4K A;  4RYP A;  3QQV A;  2Z50 A;  1WL0 A;  5JV2 F;  3MZV A;  4LUU A;  4Q23 A;  4PVY F;  3PYA A;  3NRI A;  4QPF A;  4NFJ F;  3WJK A;  3SDU A;  4DWG A;  3N1W F;  1UBX A;  2AZJ A;  3KRA B;  3AQ0 A;  1HM7 A;  2PS4 A;  5A0K A;  3EFQ A;  4LTZ A;  3LOM A;  4ZQ8 A;  5ILI A;  3WCB A;  1FPS A;  3PKO A;  5HN7 A;  3KBK A;  3APZ A;  2ZCR A;  5DJR F;  2E8X A;  5IVG A;  2DH4 A;  5AFX A;  3ZCD A;  5E8H A;  3WEK A;  1HXC A;  2OGD A;  3KRP B;  3NF2 A;  4XQR F;  1YHK A;  3WCJ A;  1HXA A;  3EZ3 A;  1RQJ A;  4P0V A;  1V4J A;  2F8C F;  2H8O A;  3WCG A;  3UCA A;  5DZ2 A;  3WCH A;  3LK5 A;  3SDR A;  3P41 A;  5B03 A;  5IL3 A;  2Z52 A;  4E9U A;  5ILJ A;  3RYE A;  4NFI F;  3ICN A;  1YYU A;  3N3L F;  1N1B A;  3KRF B;  4XQS F;  5ILD A;  2FOR A;  3WJN A;  2Z4V A;  3G4D A;  5IMP A;  3LZ9 A;  2E8V A;  3ZMC A;  1N22 A;  2F7M F;  4LA5 A;  4OKM A;  5AHU B;  4H5C F;  3WCA A;  4RNQ A;  3VJD A;  3ADZ A;  4H5E F;  2F94 F;  4N1Z F;  3SDV A;  1N24 A;  3S9V A;  5DIQ F;  5B0K A;  2J5C A;  3LGZ B;  5HN8 A;  3KRO B;  3OAB A;  2AET A;  2PS5 A;  3M00 A;  1DI1 A;  4DWB A;  5E8K A;  2F9K F;  3LSN A;  5JUZ F;  5ILH A;  3VJB A;  4MC8 A;  1YYT A;  5C05 A;  3LDW A;  3ASX A;  3WJO A;  1WL1 A;  3WSA A;  3DYG A;  2E90 A;  5B0I A;  1WY0 A;  3VJ8 A;  3TFP A;  2VF6 A;  5B0J A;  3LMD A;  2F92 F;  2E8U A;  2OPM A;  1YJ4 A;  3TFN A;  5IN8 A;  4FJQ A;  5AYP A;  1WL3 A;  2EWG A;  1YYQ A;  3ICM A;  3KB9 A;  5B02 A;  3RYW A;  3BNX A;  3WCD A;  3WCC A;  4LFV F;  2Z4W A;  1JFG A;  3TFV A;  4LPH F;  2PS6 A;  4NG6 A;  5DGM F;  1V4H A;  3SAE A;  5JA0 F;  3ACW A;  3KRC B;  4KK2 A;  2P1C A;  3W7F A;  5EAT A;  3RMG A;  1UBY A;  3TS7 A;  4P0W A;  2FTZ A;  1KIY A;  3PYB A;  4EA2 A;  3CKE A;  3B7L A;  3WCF A;  5JV1 F;  2F89 F;  4OMH A;  3RBM A;  2QIS A;  4JZB A;  3ZMB A;  3OAC A;  5ILY A;  4KQS A;  4XQT F;  5IK6 A;  5IMI A;  3DYH A;  4LOB A;  4LXW A;  3S4J A;  3AQB B;  1UBW A;  5IK9 A;  2AEL A;  3KRF A;  3G4F A;  3N1V F;  3LG5 A;  2ONG A;  2O1O A;  4KVI A;  3V1V A;  5I1U A;  2OA6 A;  3WEF A;  2E95 A;  1N1Z A;  5B0M A;  3PH7 A;  3WEJ A;  4PVX F;  2E93 A;  4KWD A;  2E92 A;  1RTR A;  1PS1 A;  1YHL A;  3AQC B;  3WC9 A;  1YYS A;  3ACX A;  3NPR A;  4P0X A;  5DJP F;  1YQ7 A;  4DI5 A;  4GA3 A;  2Z78 A;  4KFA A;  4OMG A;  3WCM A;  3N49 F;  1KIZ A;  3LGK A;  3LJI A;  4LA6 A;  4LIX A;  3WEH A;  3VJC A;  1N20 A;  4GAX A;  3ACY A;  5ILZ A;  3TC1 A;  4N9U A;  3ID0 A;  4UMJ A;  5B00 A;  5EAU A;  1JFA A;  2ZEV A;  2AZL A;  2E4O A;  4KQ5 A;  4E9Z A;  3Q30 A;  3EGT A;  5HN9 A;  2J1O A;  2Z7H A;  4EA0 A;  1DGP A;  3PDE A;  3CP6 A;  1V4E A;  4LPG F;  5DJV F;  4F6V A;  1HXG A;  2PS8 A;  4E1E A;  4LZ0 A;  4NKF A;  1N23 A;  3M0G A;  4QXS F;  4HD1 A;  3WEI A;  1WMW A;  5E8L A;  3P5R A;  3KRA A;  3Q2Z A;  3M01 A;  3N5H F;  3LEE A;  3LVS A;  4DXJ A;  3N0F A;  3BNY A;  3WE9 A;  4KKM A;  5IKA A;  5IKH A;  2ONH A;  1VG4 A;  4DHD A;  3VJA A;  3WCI A;  5ERO A;  1V4I A;  3DYF A;  5DGN F;  3P5P A;  1WL2 A;  2Q9Z A;  5A0I A;  1EZF A;  2OPN A;  3KRP A;  4L2X F;  4KPJ A;  5ER8 A;  2ZCO A;  4KVY A;  4NKE A;  3AE0 A;  1UBV A;  5DHI A;  4KPD A;  4DEM F;  4MC3 A;  3N45 F;  3WEG A;  3ZL6 A;  2F8Z F;  2PS7 A;  3Q1O A;  4LLS A;  5CG6 A;  4F6X A;  3VJE A;  1HM4 A;  4JXN A;  3NPK A;  3N0G A;  2J1P A;  4NUA A;  5A0J A;  2Z7I A;  1YYR A;  2E8W A;  3SDQ A;  4LLT A;  4JXY A;  4KUX A;  4JZX A;  4F62 A;  3ZOU A;  1ZW5 A;  5IL8 A;  4LFE A;  4DZW A;  2E8T A;  2ZEU A;  2ZCQ A;  1N21 A;  5DW7 A;  2I19 A;  3VJ9 A;  2Z4Z A;  5JV0 F;  4RXD A;  3N5J F;  4OKZ A;  3WCE A;  5IMN A;  4LZ3 A;  3MAV A;  4JYX A;  2ZY1 A;  5B01 A;  4K10 A;  3V66 A;  3OAC B;  5H9D A;  3KRO A;  4KVW A;  5ERN A;  5DHK A;  3M02 A;  5HNA A;  5B0L A;  4JVJ F;  2Q58 A;  4KQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...