5IVGA

Crystal structure of aspergillus terreus aristolochene synthase n299a complexed with farnesyl thiolodiphosphate
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
305
structure length
305
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGAELWSQTTLRYSVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Aristolochene synthase
publication title Probing the Role of Active Site Water in the Sesquiterpene Cyclization Reaction Catalyzed by Aristolochene Synthase.
pubmed doi rcsb
source organism Aspergillus terreus
total genus 129
structure length 305
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2016-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5ivgA00
3WCFA 4RYPA 4OMGA 3KRAA 2FORA 4QPFA 3NPKA 3KRCA 5ER8A 5ILIA 3P5PA 4Q23A 3P5RA 5IL8A 1N24A 1V4KA 3V1XA 4LA5A 1YYRA 1N1BA 4K10A 4LFGA 3ADZA 4RNQA 4LXWA 5IVGA 2OA6A 5IK6A 4H5DF 3LK5A 4RXCA 5B0JA 3WC9A 3LSNA 3M00A 4LOBA 3ASXA 2E8UA 4JXNA 5ILYA 2E93A 3IBAA 5IK0A 4H5CF 4KKMA 5CG5A 4LZCA 1V4JA 3NRIA 5AYPA 1KIZA 5ILZA 5A0JA 4DWGA 3SDRA 4FJQA 4DI5A 4KQUA 3KRPA 2OGDA 1UBXA 4N1ZF 4LPGF 2AZLA 1JFGA 1YHLA 2F94F 3S9VA 3ZCDA 4NKFA 3TFNA 4P0WA 2E94A 3B7LA 2QISA 3VJAA 2ZCSA 3AQ0A 1HM4A 2Z4ZA 2F92F 4KUXA 5DGSF 2ONHA 3G4DA 5DHKA 3NF2A 2F89F 3OABB 5ILJA 1VG6A 3P41A 3N49F 3G4FA 5IM1A 1HXAA 4DZWA 3ACYA 3LDWA 2OPMA 4XQSF 2Z78A 3CC9A 5IKAA 4N9UA 2ZEUA 3TFPA 1VG3A 3WCBA 3WCCA 4LFVF 2AZKA 3VJEA 1N1ZA 3ZOUA 4OKMA 1V4HA 4LLSA 3TFVA 2AELA 2I19A 2Z4VA 4LUUA 3RMGA 2E8XA 3AQCB 3WEHA 4GA3A 1WMWA 5IMNA 3ZL6A 4OKZA 1YHMA 5CG6A 3BNYA 4LZ0A 4DHDA 3ICMA 4GP1A 2AEKA 1RQIA 5JV1F 5JUZF 3APZA 3WJKA 4DEMF 1EZFA 5IN8A 4NUAA 3CP6A 3VJ9A 2ZCRA 2Z4YA 3N6KF 4WK5A 2OPNA 4MC0A 4NFKF 4NKEA 4KK2A 5JV0F 3ICKA 5HNAA 1RQJA 1UBVA 2Q9YA 3DYFA 5IMPA 5JA0F 1YYQA 5B02A 1HM7A 2ZCOA 1FPSA 2ONGA 5E8HA 3LVSA 4ZQ8A 1N23A 1VG7A 2PS6A 3ZMBA 1WL3A 3ICNA 2ZCQA 3KRFB 1KIYA 5EATA 3TS7A 3SDQA 4KWDA 3W7FA 4KVYA 1WL2A 3PH7A 4L2XF 2PS8A 2Z52A 3WJOA 4MC3A 1UBWA 3S4JA 3KRAB 3WEFA 3OABA 2F7MF 3KRCB 5B03A 3KROA 4LFEA 5ILDA 5B0IA 3LJIA 5A0IA 4F62A 5B0MA 2J1PA 3SDVA 3Q1OA 4NG6A 5DGMF 4KQ5A 5EAUA 4EA1A 3M02A 4KQSA 4KPDA 3WCAA 4UMJA 2F8ZF 5JV2F 1YV5A 4KVDA 2DH4A 3ID0A 1N20A 1UBYA 2AZJA 3RYEA 3ICZA 2E92A 3NPRA 3QKCA 3VJCA 2VF6A 3IPIA 4P0VA 3KBKA 3EFQA 3PYAA 3TC1A 3LOMA 3N3DA 3KB9A 3WEKA 2PS7A 3LGZB 1WL0A 3Q30A 3PYBA 4LPHF 4KPJA 2H8OA 3M0GA 5EROA 5KSXF 1WY0A 5IL3A 1YQ7A 5AELA 2E95A 3N45F 3QQVA 3WCDA 1HX9A 3PKOA 5H9DA 3WSBA 2E8TA 3OACB 3WCJA 4E1EA 5A0KA 2J5CA 3N0FA 3M9UA 2Z50A 3SDTA 1V4EA 5ILKA 3WCHA 5E8KA 2Q9ZA 5DHIA 5C05A 3MZVA 3PDEA 4HD1A 4DXJA 4F6VA 2FTZA 5HN8A 2Z4WA 2Z7IA 3SAEA 4OGUA 3N5JF 5DJVF 4GAXA 3LZ9A 1N21A 4GP2A 3WEJA 3EGTA 3EZ3A 2E8WA 5B01A 2PS5A 4FP4A 5IMIA 1WKZA 2Z7HA 4LA6A 3VJ8A 3V66A 3N3LF 4LZ3A 1N22A 2ZEVA 5B0LA 4JZXA 3Q2ZA 3P8RA 4PVYF 3N5HF 3WCLA 3LEEA 3N46F 3M01A 3LGKA 5ERNA 5DIQF 2E90A 3RBMA 1VG4A 2J1OA 2P1CA 3ACXA 5I1UA 4DWBA 2F9KF 3WSAA 3AQBB 4F6XA 4P0XA 2E91A 5IK9A 5E8LA 1YYSA 3VJBA 5ERMA 5IKHA 2F8CF 4H5EF 3LLWA 1DI1A 4LTZA 2Q80A 5HN7A 2EWGA 3WCMA 5DZ2A 3RYWA 1HXCA 5DGNF 3WCIA 4EA2A 5B00A 3WCEA 5AHUB 4LTVA 1VG2A 1RTRA 5HN9A 3DYHA 1YYUA 3LG5A 5B0KA 3LMDA 3V1VA 3UCAA 3KRPB 5DJPF 1JFAA 1YJ4A 2E8VA 3ZMCA 3CKEA 4XQTF 3OACA 1V4IA 4JYXA 3KROB 1PS1A 2ZY1A 1HXGA 3ACWA 2Z4XA 5ILHA 3WEIA 4RXAA 4EA0A 1WL1A 3AE0A 4LIXA 4KFAA 3SDUA 1ZW5A 4E9UA 1YYTA 4E9ZA 3BNXA 3Q2QA 2O1OA 2E4OA 4OMHA 3P8LA 3N1WF 3OYRA 4NFJF 3MAVA 3WCGA 4MC8A 3WEGA 4JXYA 4XQRF 4KVIA 3WE9A 2Q58A 4LLTA 4QXSF 5DW7A 3VJDA 3DYGA 1DGPA 5AFXA 3KRFA 5DJRF 1YHKA 4RXEA 3N0GA 4KVWA 4PVXF 3WJNA 4NFIF 3N1VF 2PS4A 2AETA 2RAHA 5EASA 4JVJF 4RXDA 4JZBA
chains in the Genus database with same CATH superfamily
3WCFA 4RYPA 4OMGA 3KRAA 2FORA 4QPFA 3NPKA 3KRCA 5ER8A 5ILIA 3P5PA 4Q23A 3P5RA 5IL8A 1N24A 1V4KA 3V1XA 4LA5A 1YYRA 1N1BA 4K10A 4LFGA 3ADZA 4RNQA 4LXWA 5IVGA 2OA6A 5IK6A 4H5DF 3LK5A 4RXCA 5B0JA 3WC9A 3LSNA 3M00A 4LOBA 3ASXA 2E8UA 4JXNA 5ILYA 2E93A 3IBAA 5IK0A 4H5CF 4KKMA 5CG5A 4LZCA 1V4JA 3NRIA 5AYPA 1KIZA 5ILZA 5A0JA 4DWGA 3SDRA 4FJQA 4DI5A 4KQUA 3KRPA 2OGDA 1UBXA 4N1ZF 4LPGF 2AZLA 1JFGA 1YHLA 2F94F 3S9VA 3ZCDA 4NKFA 3TFNA 4P0WA 2E94A 3B7LA 2QISA 3VJAA 2ZCSA 3AQ0A 1HM4A 2Z4ZA 2F92F 4KUXA 5DGSF 2ONHA 3G4DA 5DHKA 3NF2A 2F89F 3OABB 5ILJA 1VG6A 3P41A 3N49F 3G4FA 5IM1A 1HXAA 4DZWA 3ACYA 3LDWA 2OPMA 4XQSF 2Z78A 3CC9A 5IKAA 4N9UA 2ZEUA 3TFPA 1VG3A 3WCBA 3WCCA 4LFVF 2AZKA 3VJEA 1N1ZA 3ZOUA 4OKMA 1V4HA 4LLSA 3TFVA 2AELA 2I19A 2Z4VA 4LUUA 3RMGA 2E8XA 3AQCB 3WEHA 4GA3A 1WMWA 5IMNA 3ZL6A 4OKZA 1YHMA 5CG6A 3BNYA 4LZ0A 4DHDA 3ICMA 4GP1A 2AEKA 1RQIA 5JV1F 5JUZF 3APZA 3WJKA 4DEMF 1EZFA 5IN8A 4NUAA 3CP6A 3VJ9A 2ZCRA 2Z4YA 3N6KF 4WK5A 2OPNA 4MC0A 4NFKF 4NKEA 4KK2A 5JV0F 3ICKA 5HNAA 1RQJA 1UBVA 2Q9YA 3DYFA 5IMPA 5JA0F 1YYQA 5B02A 1HM7A 2ZCOA 1FPSA 2ONGA 5E8HA 3LVSA 4ZQ8A 1N23A 1VG7A 2PS6A 3ZMBA 1WL3A 3ICNA 2ZCQA 3KRFB 1KIYA 5EATA 3TS7A 3SDQA 4KWDA 3W7FA 4KVYA 1WL2A 3PH7A 4L2XF 2PS8A 2Z52A 3WJOA 4MC3A 1UBWA 3S4JA 3KRAB 3WEFA 3OABA 2F7MF 3KRCB 5B03A 3KROA 4LFEA 5ILDA 5B0IA 3LJIA 5A0IA 4F62A 5B0MA 2J1PA 3SDVA 3Q1OA 4NG6A 5DGMF 4KQ5A 5EAUA 4EA1A 3M02A 4KQSA 4KPDA 3WCAA 4UMJA 2F8ZF 5JV2F 1YV5A 4KVDA 2DH4A 3ID0A 1N20A 1UBYA 2AZJA 3RYEA 3ICZA 2E92A 3NPRA 3QKCA 3VJCA 2VF6A 3IPIA 4P0VA 3KBKA 3EFQA 3PYAA 3TC1A 3LOMA 3N3DA 3KB9A 3WEKA 2PS7A 3LGZB 1WL0A 3Q30A 3PYBA 4LPHF 4KPJA 2H8OA 3M0GA 5EROA 5KSXF 1WY0A 5IL3A 1YQ7A 5AELA 2E95A 3N45F 3QQVA 3WCDA 1HX9A 3PKOA 5H9DA 3WSBA 2E8TA 3OACB 3WCJA 4E1EA 5A0KA 2J5CA 3N0FA 3M9UA 2Z50A 3SDTA 1V4EA 5ILKA 3WCHA 5E8KA 2Q9ZA 5DHIA 5C05A 3MZVA 3PDEA 4HD1A 4DXJA 4F6VA 2FTZA 5HN8A 2Z4WA 2Z7IA 3SAEA 4OGUA 3N5JF 5DJVF 4GAXA 3LZ9A 1N21A 4GP2A 3WEJA 3EGTA 3EZ3A 2E8WA 5B01A 2PS5A 4FP4A 5IMIA 1WKZA 2Z7HA 4LA6A 3VJ8A 3V66A 3N3LF 4LZ3A 1N22A 2ZEVA 5B0LA 4JZXA 3Q2ZA 3P8RA 4PVYF 3N5HF 3WCLA 3LEEA 3N46F 3M01A 3LGKA 5ERNA 5DIQF 2E90A 3RBMA 1VG4A 2J1OA 2P1CA 3ACXA 5I1UA 4DWBA 2F9KF 3WSAA 3AQBB 4F6XA 4P0XA 2E91A 5IK9A 5E8LA 1YYSA 3VJBA 5ERMA 5IKHA 2F8CF 4H5EF 3LLWA 1DI1A 4LTZA 2Q80A 5HN7A 2EWGA 3WCMA 5DZ2A 3RYWA 1HXCA 5DGNF 3WCIA 4EA2A 5B00A 3WCEA 5AHUB 4LTVA 1VG2A 1RTRA 5HN9A 3DYHA 1YYUA 3LG5A 5B0KA 3LMDA 3V1VA 3UCAA 3KRPB 5DJPF 1JFAA 1YJ4A 2E8VA 3ZMCA 3CKEA 4XQTF 3OACA 1V4IA 4JYXA 3KROB 1PS1A 2ZY1A 1HXGA 3ACWA 2Z4XA 5ILHA 3WEIA 4RXAA 4EA0A 1WL1A 3AE0A 4LIXA 4KFAA 3SDUA 1ZW5A 4E9UA 1YYTA 4E9ZA 3BNXA 3Q2QA 2O1OA 2E4OA 4OMHA 3P8LA 3N1WF 3OYRA 4NFJF 3MAVA 3WCGA 4MC8A 3WEGA 4JXYA 4XQRF 4KVIA 3WE9A 2Q58A 4LLTA 4QXSF 5DW7A 3VJDA 3DYGA 1DGPA 5AFXA 3KRFA 5DJRF 1YHKA 4RXEA 3N0GA 4KVWA 4PVXF 3WJNA 4NFIF 3N1VF 2PS4A 2AETA 2RAHA 5EASA 4JVJF 4RXDA 4JZBA
chains in the Genus database with same CATH topology
3WCFA 4RYPA 4OMGA 3KRAA 2FORA 4QPFA 3NPKA 3KRCA 5ER8A 5ILIA 3P5PA 4Q23A 3P5RA 5IL8A 1N24A 1V4KA 3V1XA 4LA5A 1YYRA 1N1BA 4K10A 4LFGA 3ADZA 4RNQA 4LXWA 5IVGA 2OA6A 5IK6A 4H5DF 3LK5A 4RXCA 5B0JA 3WC9A 3LSNA 3M00A 4LOBA 3ASXA 2E8UA 4JXNA 5ILYA 2E93A 3IBAA 5IK0A 4H5CF 4KKMA 5CG5A 4LZCA 1V4JA 3NRIA 5AYPA 1KIZA 5ILZA 5A0JA 4DWGA 3SDRA 4FJQA 4DI5A 4KQUA 3KRPA 2OGDA 1UBXA 4N1ZF 4LPGF 2AZLA 1JFGA 1YHLA 2F94F 3S9VA 3ZCDA 4NKFA 3TFNA 4P0WA 2E94A 3B7LA 2QISA 3VJAA 2ZCSA 3AQ0A 1HM4A 2Z4ZA 2F92F 4KUXA 5DGSF 2ONHA 3G4DA 5DHKA 3NF2A 2F89F 3OABB 5ILJA 1VG6A 3P41A 3N49F 3G4FA 5IM1A 1HXAA 4DZWA 3ACYA 3LDWA 2OPMA 4XQSF 2Z78A 3CC9A 5IKAA 4N9UA 2ZEUA 3TFPA 1VG3A 3WCBA 3WCCA 4LFVF 2AZKA 3VJEA 1N1ZA 3ZOUA 4OKMA 1V4HA 4LLSA 3TFVA 2AELA 2I19A 2Z4VA 4LUUA 3RMGA 2E8XA 3AQCB 3WEHA 4GA3A 1WMWA 5IMNA 3ZL6A 4OKZA 1YHMA 5CG6A 3BNYA 4LZ0A 4DHDA 3ICMA 4GP1A 2AEKA 1RQIA 5JV1F 5JUZF 3APZA 3WJKA 4DEMF 1EZFA 5IN8A 4NUAA 3CP6A 3VJ9A 2ZCRA 2Z4YA 3N6KF 4WK5A 2OPNA 4MC0A 4NFKF 4NKEA 4KK2A 5JV0F 3ICKA 5HNAA 1RQJA 1UBVA 2Q9YA 3DYFA 5IMPA 5JA0F 1YYQA 5B02A 1HM7A 2ZCOA 1FPSA 2ONGA 5E8HA 3LVSA 4ZQ8A 1N23A 1VG7A 2PS6A 3ZMBA 1WL3A 3ICNA 2ZCQA 3KRFB 1KIYA 5EATA 3TS7A 3SDQA 4KWDA 3W7FA 4KVYA 1WL2A 3PH7A 4L2XF 2PS8A 2Z52A 3WJOA 4MC3A 1UBWA 3S4JA 3KRAB 3WEFA 3OABA 2F7MF 3KRCB 5B03A 3KROA 4LFEA 5ILDA 5B0IA 3LJIA 5A0IA 4F62A 5B0MA 2J1PA 3SDVA 3Q1OA 4NG6A 5DGMF 4KQ5A 5EAUA 4EA1A 3M02A 4KQSA 4KPDA 3WCAA 4UMJA 2F8ZF 5JV2F 1YV5A 4KVDA 2DH4A 3ID0A 1N20A 1UBYA 2AZJA 3RYEA 3ICZA 2E92A 3NPRA 3QKCA 3VJCA 2VF6A 3IPIA 4P0VA 3KBKA 3EFQA 3PYAA 3TC1A 3LOMA 3N3DA 3KB9A 3WEKA 2PS7A 3LGZB 1WL0A 3Q30A 3PYBA 4LPHF 4KPJA 2H8OA 3M0GA 5EROA 5KSXF 1WY0A 5IL3A 1YQ7A 5AELA 2E95A 3N45F 3QQVA 3WCDA 1HX9A 3PKOA 5H9DA 3WSBA 2E8TA 3OACB 3WCJA 4E1EA 5A0KA 2J5CA 3N0FA 3M9UA 2Z50A 3SDTA 1V4EA 5ILKA 3WCHA 5E8KA 2Q9ZA 5DHIA 5C05A 3MZVA 3PDEA 4HD1A 4DXJA 4F6VA 2FTZA 5HN8A 2Z4WA 2Z7IA 3SAEA 4OGUA 3N5JF 5DJVF 4GAXA 3LZ9A 1N21A 4GP2A 3WEJA 3EGTA 3EZ3A 2E8WA 5B01A 2PS5A 4FP4A 5IMIA 1WKZA 2Z7HA 4LA6A 3VJ8A 3V66A 3N3LF 4LZ3A 1N22A 2ZEVA 5B0LA 4JZXA 3Q2ZA 3P8RA 4PVYF 3N5HF 3WCLA 3LEEA 3N46F 3M01A 3LGKA 5ERNA 5DIQF 2E90A 3RBMA 1VG4A 2J1OA 2P1CA 3ACXA 5I1UA 4DWBA 2F9KF 3WSAA 3AQBB 4F6XA 4P0XA 2E91A 5IK9A 5E8LA 1YYSA 3VJBA 5ERMA 5IKHA 2F8CF 4H5EF 3LLWA 1DI1A 4LTZA 2Q80A 5HN7A 2EWGA 3WCMA 5DZ2A 3RYWA 1HXCA 5DGNF 3WCIA 4EA2A 5B00A 3WCEA 5AHUB 4LTVA 1VG2A 1RTRA 5HN9A 3DYHA 1YYUA 3LG5A 5B0KA 3LMDA 3V1VA 3UCAA 3KRPB 5DJPF 1JFAA 1YJ4A 2E8VA 3ZMCA 3CKEA 4XQTF 3OACA 1V4IA 4JYXA 3KROB 1PS1A 2ZY1A 1HXGA 3ACWA 2Z4XA 5ILHA 3WEIA 4RXAA 4EA0A 1WL1A 3AE0A 4LIXA 4KFAA 3SDUA 1ZW5A 4E9UA 1YYTA 4E9ZA 3BNXA 3Q2QA 2O1OA 2E4OA 4OMHA 3P8LA 3N1WF 3OYRA 4NFJF 3MAVA 3WCGA 4MC8A 3WEGA 4JXYA 4XQRF 4KVIA 3WE9A 2Q58A 4LLTA 4QXSF 5DW7A 3VJDA 3DYGA 1DGPA 5AFXA 3KRFA 5DJRF 1YHKA 4RXEA 3N0GA 4KVWA 4PVXF 3WJNA 4NFIF 3N1VF 2PS4A 2AETA 2RAHA 5EASA 4JVJF 4RXDA 4JZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCF A;  4RYP A;  4OMG A;  3KRA A;  2FOR A;  4QPF A;  3NPK A;  3KRC A;  5ER8 A;  5ILI A;  3P5P A;  4Q23 A;  3P5R A;  5IL8 A;  1N24 A;  1V4K A;  3V1X A;  4LA5 A;  1YYR A;  1N1B A;  4K10 A;  4LFG A;  3ADZ A;  4RNQ A;  4LXW A;  5IVG A;  2OA6 A;  5IK6 A;  4H5D F;  3LK5 A;  4RXC A;  5B0J A;  3WC9 A;  3LSN A;  3M00 A;  4LOB A;  3ASX A;  2E8U A;  4JXN A;  5ILY A;  2E93 A;  3IBA A;  5IK0 A;  4H5C F;  4KKM A;  5CG5 A;  4LZC A;  1V4J A;  3NRI A;  5AYP A;  1KIZ A;  5ILZ A;  5A0J A;  4DWG A;  3SDR A;  4FJQ A;  4DI5 A;  4KQU A;  3KRP A;  2OGD A;  1UBX A;  4N1Z F;  4LPG F;  2AZL A;  1JFG A;  1YHL A;  2F94 F;  3S9V A;  3ZCD A;  4NKF A;  3TFN A;  4P0W A;  2E94 A;  3B7L A;  2QIS A;  3VJA A;  2ZCS A;  3AQ0 A;  1HM4 A;  2Z4Z A;  2F92 F;  4KUX A;  5DGS F;  2ONH A;  3G4D A;  5DHK A;  3NF2 A;  2F89 F;  3OAB B;  5ILJ A;  1VG6 A;  3P41 A;  3N49 F;  3G4F A;  5IM1 A;  1HXA A;  4DZW A;  3ACY A;  3LDW A;  2OPM A;  4XQS F;  2Z78 A;  3CC9 A;  5IKA A;  4N9U A;  2ZEU A;  3TFP A;  1VG3 A;  3WCB A;  3WCC A;  4LFV F;  2AZK A;  3VJE A;  1N1Z A;  3ZOU A;  4OKM A;  1V4H A;  4LLS A;  3TFV A;  2AEL A;  2I19 A;  2Z4V A;  4LUU A;  3RMG A;  2E8X A;  3AQC B;  3WEH A;  4GA3 A;  1WMW A;  5IMN A;  3ZL6 A;  4OKZ A;  1YHM A;  5CG6 A;  3BNY A;  4LZ0 A;  4DHD A;  3ICM A;  4GP1 A;  2AEK A;  1RQI A;  5JV1 F;  5JUZ F;  3APZ A;  3WJK A;  4DEM F;  1EZF A;  5IN8 A;  4NUA A;  3CP6 A;  3VJ9 A;  2ZCR A;  2Z4Y A;  3N6K F;  4WK5 A;  2OPN A;  4MC0 A;  4NFK F;  4NKE A;  4KK2 A;  5JV0 F;  3ICK A;  5HNA A;  1RQJ A;  1UBV A;  2Q9Y A;  3DYF A;  5IMP A;  5JA0 F;  1YYQ A;  5B02 A;  1HM7 A;  2ZCO A;  1FPS A;  2ONG A;  5E8H A;  3LVS A;  4ZQ8 A;  1N23 A;  1VG7 A;  2PS6 A;  3ZMB A;  1WL3 A;  3ICN A;  2ZCQ A;  3KRF B;  1KIY A;  5EAT A;  3TS7 A;  3SDQ A;  4KWD A;  3W7F A;  4KVY A;  1WL2 A;  3PH7 A;  4L2X F;  2PS8 A;  2Z52 A;  3WJO A;  4MC3 A;  1UBW A;  3S4J A;  3KRA B;  3WEF A;  3OAB A;  2F7M F;  3KRC B;  5B03 A;  3KRO A;  4LFE A;  5ILD A;  5B0I A;  3LJI A;  5A0I A;  4F62 A;  5B0M A;  2J1P A;  3SDV A;  3Q1O A;  4NG6 A;  5DGM F;  4KQ5 A;  5EAU A;  4EA1 A;  3M02 A;  4KQS A;  4KPD A;  3WCA A;  4UMJ A;  2F8Z F;  5JV2 F;  1YV5 A;  4KVD A;  2DH4 A;  3ID0 A;  1N20 A;  1UBY A;  2AZJ A;  3RYE A;  3ICZ A;  2E92 A;  3NPR A;  3QKC A;  3VJC A;  2VF6 A;  3IPI A;  4P0V A;  3KBK A;  3EFQ A;  3PYA A;  3TC1 A;  3LOM A;  3N3D A;  3KB9 A;  3WEK A;  2PS7 A;  3LGZ B;  1WL0 A;  3Q30 A;  3PYB A;  4LPH F;  4KPJ A;  2H8O A;  3M0G A;  5ERO A;  5KSX F;  1WY0 A;  5IL3 A;  1YQ7 A;  5AEL A;  2E95 A;  3N45 F;  3QQV A;  3WCD A;  1HX9 A;  3PKO A;  5H9D A;  3WSB A;  2E8T A;  3OAC B;  3WCJ A;  4E1E A;  5A0K A;  2J5C A;  3N0F A;  3M9U A;  2Z50 A;  3SDT A;  1V4E A;  5ILK A;  3WCH A;  5E8K A;  2Q9Z A;  5DHI A;  5C05 A;  3MZV A;  3PDE A;  4HD1 A;  4DXJ A;  4F6V A;  2FTZ A;  5HN8 A;  2Z4W A;  2Z7I A;  3SAE A;  4OGU A;  3N5J F;  5DJV F;  4GAX A;  3LZ9 A;  1N21 A;  4GP2 A;  3WEJ A;  3EGT A;  3EZ3 A;  2E8W A;  5B01 A;  2PS5 A;  4FP4 A;  5IMI A;  1WKZ A;  2Z7H A;  4LA6 A;  3VJ8 A;  3V66 A;  3N3L F;  4LZ3 A;  1N22 A;  2ZEV A;  5B0L A;  4JZX A;  3Q2Z A;  3P8R A;  4PVY F;  3N5H F;  3WCL A;  3LEE A;  3N46 F;  3M01 A;  3LGK A;  5ERN A;  5DIQ F;  2E90 A;  3RBM A;  1VG4 A;  2J1O A;  2P1C A;  3ACX A;  5I1U A;  4DWB A;  2F9K F;  3WSA A;  3AQB B;  4F6X A;  4P0X A;  2E91 A;  5IK9 A;  5E8L A;  1YYS A;  3VJB A;  5ERM A;  5IKH A;  2F8C F;  4H5E F;  3LLW A;  1DI1 A;  4LTZ A;  2Q80 A;  5HN7 A;  2EWG A;  3WCM A;  5DZ2 A;  3RYW A;  1HXC A;  5DGN F;  3WCI A;  4EA2 A;  5B00 A;  3WCE A;  5AHU B;  4LTV A;  1VG2 A;  1RTR A;  5HN9 A;  3DYH A;  1YYU A;  3LG5 A;  5B0K A;  3LMD A;  3V1V A;  3UCA A;  3KRP B;  5DJP F;  1JFA A;  1YJ4 A;  2E8V A;  3ZMC A;  3CKE A;  4XQT F;  3OAC A;  1V4I A;  4JYX A;  3KRO B;  1PS1 A;  2ZY1 A;  1HXG A;  3ACW A;  2Z4X A;  5ILH A;  3WEI A;  4RXA A;  4EA0 A;  1WL1 A;  3AE0 A;  4LIX A;  4KFA A;  3SDU A;  1ZW5 A;  4E9U A;  1YYT A;  4E9Z A;  3BNX A;  3Q2Q A;  2O1O A;  2E4O A;  4OMH A;  3P8L A;  3N1W F;  3OYR A;  4NFJ F;  3MAV A;  3WCG A;  4MC8 A;  3WEG A;  4JXY A;  4XQR F;  4KVI A;  3WE9 A;  2Q58 A;  4LLT A;  4QXS F;  5DW7 A;  3VJD A;  3DYG A;  1DGP A;  5AFX A;  3KRF A;  5DJR F;  1YHK A;  4RXE A;  3N0G A;  4KVW A;  4PVX F;  3WJN A;  4NFI F;  3N1V F;  2PS4 A;  2AET A;  2RAH A;  5EAS A;  4JVJ F;  4RXD A;  4JZB A; 
#chains in the Genus database with same CATH topology
 3WCF A;  4RYP A;  4OMG A;  3KRA A;  2FOR A;  4QPF A;  3NPK A;  3KRC A;  5ER8 A;  5ILI A;  3P5P A;  4Q23 A;  3P5R A;  5IL8 A;  1N24 A;  1V4K A;  3V1X A;  4LA5 A;  1YYR A;  1N1B A;  4K10 A;  4LFG A;  3ADZ A;  4RNQ A;  4LXW A;  5IVG A;  2OA6 A;  5IK6 A;  4H5D F;  3LK5 A;  4RXC A;  5B0J A;  3WC9 A;  3LSN A;  3M00 A;  4LOB A;  3ASX A;  2E8U A;  4JXN A;  5ILY A;  2E93 A;  3IBA A;  5IK0 A;  4H5C F;  4KKM A;  5CG5 A;  4LZC A;  1V4J A;  3NRI A;  5AYP A;  1KIZ A;  5ILZ A;  5A0J A;  4DWG A;  3SDR A;  4FJQ A;  4DI5 A;  4KQU A;  3KRP A;  2OGD A;  1UBX A;  4N1Z F;  4LPG F;  2AZL A;  1JFG A;  1YHL A;  2F94 F;  3S9V A;  3ZCD A;  4NKF A;  3TFN A;  4P0W A;  2E94 A;  3B7L A;  2QIS A;  3VJA A;  2ZCS A;  3AQ0 A;  1HM4 A;  2Z4Z A;  2F92 F;  4KUX A;  5DGS F;  2ONH A;  3G4D A;  5DHK A;  3NF2 A;  2F89 F;  3OAB B;  5ILJ A;  1VG6 A;  3P41 A;  3N49 F;  3G4F A;  5IM1 A;  1HXA A;  4DZW A;  3ACY A;  3LDW A;  2OPM A;  4XQS F;  2Z78 A;  3CC9 A;  5IKA A;  4N9U A;  2ZEU A;  3TFP A;  1VG3 A;  3WCB A;  3WCC A;  4LFV F;  2AZK A;  3VJE A;  1N1Z A;  3ZOU A;  4OKM A;  1V4H A;  4LLS A;  3TFV A;  2AEL A;  2I19 A;  2Z4V A;  4LUU A;  3RMG A;  2E8X A;  3AQC B;  3WEH A;  4GA3 A;  1WMW A;  5IMN A;  3ZL6 A;  4OKZ A;  1YHM A;  5CG6 A;  3BNY A;  4LZ0 A;  4DHD A;  3ICM A;  4GP1 A;  2AEK A;  1RQI A;  5JV1 F;  5JUZ F;  3APZ A;  3WJK A;  4DEM F;  1EZF A;  5IN8 A;  4NUA A;  3CP6 A;  3VJ9 A;  2ZCR A;  2Z4Y A;  3N6K F;  4WK5 A;  2OPN A;  4MC0 A;  4NFK F;  4NKE A;  4KK2 A;  5JV0 F;  3ICK A;  5HNA A;  1RQJ A;  1UBV A;  2Q9Y A;  3DYF A;  5IMP A;  5JA0 F;  1YYQ A;  5B02 A;  1HM7 A;  2ZCO A;  1FPS A;  2ONG A;  5E8H A;  3LVS A;  4ZQ8 A;  1N23 A;  1VG7 A;  2PS6 A;  3ZMB A;  1WL3 A;  3ICN A;  2ZCQ A;  3KRF B;  1KIY A;  5EAT A;  3TS7 A;  3SDQ A;  4KWD A;  3W7F A;  4KVY A;  1WL2 A;  3PH7 A;  4L2X F;  2PS8 A;  2Z52 A;  3WJO A;  4MC3 A;  1UBW A;  3S4J A;  3KRA B;  3WEF A;  3OAB A;  2F7M F;  3KRC B;  5B03 A;  3KRO A;  4LFE A;  5ILD A;  5B0I A;  3LJI A;  5A0I A;  4F62 A;  5B0M A;  2J1P A;  3SDV A;  3Q1O A;  4NG6 A;  5DGM F;  4KQ5 A;  5EAU A;  4EA1 A;  3M02 A;  4KQS A;  4KPD A;  3WCA A;  4UMJ A;  2F8Z F;  5JV2 F;  1YV5 A;  4KVD A;  2DH4 A;  3ID0 A;  1N20 A;  1UBY A;  2AZJ A;  3RYE A;  3ICZ A;  2E92 A;  3NPR A;  3QKC A;  3VJC A;  2VF6 A;  3IPI A;  4P0V A;  3KBK A;  3EFQ A;  3PYA A;  3TC1 A;  3LOM A;  3N3D A;  3KB9 A;  3WEK A;  2PS7 A;  3LGZ B;  1WL0 A;  3Q30 A;  3PYB A;  4LPH F;  4KPJ A;  2H8O A;  3M0G A;  5ERO A;  5KSX F;  1WY0 A;  5IL3 A;  1YQ7 A;  5AEL A;  2E95 A;  3N45 F;  3QQV A;  3WCD A;  1HX9 A;  3PKO A;  5H9D A;  3WSB A;  2E8T A;  3OAC B;  3WCJ A;  4E1E A;  5A0K A;  2J5C A;  3N0F A;  3M9U A;  2Z50 A;  3SDT A;  1V4E A;  5ILK A;  3WCH A;  5E8K A;  2Q9Z A;  5DHI A;  5C05 A;  3MZV A;  3PDE A;  4HD1 A;  4DXJ A;  4F6V A;  2FTZ A;  5HN8 A;  2Z4W A;  2Z7I A;  3SAE A;  4OGU A;  3N5J F;  5DJV F;  4GAX A;  3LZ9 A;  1N21 A;  4GP2 A;  3WEJ A;  3EGT A;  3EZ3 A;  2E8W A;  5B01 A;  2PS5 A;  4FP4 A;  5IMI A;  1WKZ A;  2Z7H A;  4LA6 A;  3VJ8 A;  3V66 A;  3N3L F;  4LZ3 A;  1N22 A;  2ZEV A;  5B0L A;  4JZX A;  3Q2Z A;  3P8R A;  4PVY F;  3N5H F;  3WCL A;  3LEE A;  3N46 F;  3M01 A;  3LGK A;  5ERN A;  5DIQ F;  2E90 A;  3RBM A;  1VG4 A;  2J1O A;  2P1C A;  3ACX A;  5I1U A;  4DWB A;  2F9K F;  3WSA A;  3AQB B;  4F6X A;  4P0X A;  2E91 A;  5IK9 A;  5E8L A;  1YYS A;  3VJB A;  5ERM A;  5IKH A;  2F8C F;  4H5E F;  3LLW A;  1DI1 A;  4LTZ A;  2Q80 A;  5HN7 A;  2EWG A;  3WCM A;  5DZ2 A;  3RYW A;  1HXC A;  5DGN F;  3WCI A;  4EA2 A;  5B00 A;  3WCE A;  5AHU B;  4LTV A;  1VG2 A;  1RTR A;  5HN9 A;  3DYH A;  1YYU A;  3LG5 A;  5B0K A;  3LMD A;  3V1V A;  3UCA A;  3KRP B;  5DJP F;  1JFA A;  1YJ4 A;  2E8V A;  3ZMC A;  3CKE A;  4XQT F;  3OAC A;  1V4I A;  4JYX A;  3KRO B;  1PS1 A;  2ZY1 A;  1HXG A;  3ACW A;  2Z4X A;  5ILH A;  3WEI A;  4RXA A;  4EA0 A;  1WL1 A;  3AE0 A;  4LIX A;  4KFA A;  3SDU A;  1ZW5 A;  4E9U A;  1YYT A;  4E9Z A;  3BNX A;  3Q2Q A;  2O1O A;  2E4O A;  4OMH A;  3P8L A;  3N1W F;  3OYR A;  4NFJ F;  3MAV A;  3WCG A;  4MC8 A;  3WEG A;  4JXY A;  4XQR F;  4KVI A;  3WE9 A;  2Q58 A;  4LLT A;  4QXS F;  5DW7 A;  3VJD A;  3DYG A;  1DGP A;  5AFX A;  3KRF A;  5DJR F;  1YHK A;  4RXE A;  3N0G A;  4KVW A;  4PVX F;  3WJN A;  4NFI F;  3N1V F;  2PS4 A;  2AET A;  2RAH A;  5EAS A;  4JVJ F;  4RXD A;  4JZB A; 
#chains in the Genus database with same CATH homology
 3WCF A;  4RYP A;  4OMG A;  3KRA A;  2FOR A;  4QPF A;  3NPK A;  3KRC A;  5ER8 A;  5ILI A;  3P5P A;  4Q23 A;  3P5R A;  5IL8 A;  1N24 A;  1V4K A;  3V1X A;  4LA5 A;  1YYR A;  1N1B A;  4K10 A;  4LFG A;  3ADZ A;  4RNQ A;  4LXW A;  5IVG A;  2OA6 A;  5IK6 A;  4H5D F;  3LK5 A;  4RXC A;  5B0J A;  3WC9 A;  3LSN A;  3M00 A;  4LOB A;  3ASX A;  2E8U A;  4JXN A;  5ILY A;  2E93 A;  3IBA A;  5IK0 A;  4H5C F;  4KKM A;  5CG5 A;  4LZC A;  1V4J A;  3NRI A;  5AYP A;  1KIZ A;  5ILZ A;  5A0J A;  4DWG A;  3SDR A;  4FJQ A;  4DI5 A;  4KQU A;  3KRP A;  2OGD A;  1UBX A;  4N1Z F;  4LPG F;  2AZL A;  1JFG A;  1YHL A;  2F94 F;  3S9V A;  3ZCD A;  4NKF A;  3TFN A;  4P0W A;  2E94 A;  3B7L A;  2QIS A;  3VJA A;  2ZCS A;  3AQ0 A;  1HM4 A;  2Z4Z A;  2F92 F;  4KUX A;  5DGS F;  2ONH A;  3G4D A;  5DHK A;  3NF2 A;  2F89 F;  3OAB B;  5ILJ A;  1VG6 A;  3P41 A;  3N49 F;  3G4F A;  5IM1 A;  1HXA A;  4DZW A;  3ACY A;  3LDW A;  2OPM A;  4XQS F;  2Z78 A;  3CC9 A;  5IKA A;  4N9U A;  2ZEU A;  3TFP A;  1VG3 A;  3WCB A;  3WCC A;  4LFV F;  2AZK A;  3VJE A;  1N1Z A;  3ZOU A;  4OKM A;  1V4H A;  4LLS A;  3TFV A;  2AEL A;  2I19 A;  2Z4V A;  4LUU A;  3RMG A;  2E8X A;  3AQC B;  3WEH A;  4GA3 A;  1WMW A;  5IMN A;  3ZL6 A;  4OKZ A;  1YHM A;  5CG6 A;  3BNY A;  4LZ0 A;  4DHD A;  3ICM A;  4GP1 A;  2AEK A;  1RQI A;  5JV1 F;  5JUZ F;  3APZ A;  3WJK A;  4DEM F;  1EZF A;  5IN8 A;  4NUA A;  3CP6 A;  3VJ9 A;  2ZCR A;  2Z4Y A;  3N6K F;  4WK5 A;  2OPN A;  4MC0 A;  4NFK F;  4NKE A;  4KK2 A;  5JV0 F;  3ICK A;  5HNA A;  1RQJ A;  1UBV A;  2Q9Y A;  3DYF A;  5IMP A;  5JA0 F;  1YYQ A;  5B02 A;  1HM7 A;  2ZCO A;  1FPS A;  2ONG A;  5E8H A;  3LVS A;  4ZQ8 A;  1N23 A;  1VG7 A;  2PS6 A;  3ZMB A;  1WL3 A;  3ICN A;  2ZCQ A;  3KRF B;  1KIY A;  5EAT A;  3TS7 A;  3SDQ A;  4KWD A;  3W7F A;  4KVY A;  1WL2 A;  3PH7 A;  4L2X F;  2PS8 A;  2Z52 A;  3WJO A;  4MC3 A;  1UBW A;  3S4J A;  3KRA B;  3WEF A;  3OAB A;  2F7M F;  3KRC B;  5B03 A;  3KRO A;  4LFE A;  5ILD A;  5B0I A;  3LJI A;  5A0I A;  4F62 A;  5B0M A;  2J1P A;  3SDV A;  3Q1O A;  4NG6 A;  5DGM F;  4KQ5 A;  5EAU A;  4EA1 A;  3M02 A;  4KQS A;  4KPD A;  3WCA A;  4UMJ A;  2F8Z F;  5JV2 F;  1YV5 A;  4KVD A;  2DH4 A;  3ID0 A;  1N20 A;  1UBY A;  2AZJ A;  3RYE A;  3ICZ A;  2E92 A;  3NPR A;  3QKC A;  3VJC A;  2VF6 A;  3IPI A;  4P0V A;  3KBK A;  3EFQ A;  3PYA A;  3TC1 A;  3LOM A;  3N3D A;  3KB9 A;  3WEK A;  2PS7 A;  3LGZ B;  1WL0 A;  3Q30 A;  3PYB A;  4LPH F;  4KPJ A;  2H8O A;  3M0G A;  5ERO A;  5KSX F;  1WY0 A;  5IL3 A;  1YQ7 A;  5AEL A;  2E95 A;  3N45 F;  3QQV A;  3WCD A;  1HX9 A;  3PKO A;  5H9D A;  3WSB A;  2E8T A;  3OAC B;  3WCJ A;  4E1E A;  5A0K A;  2J5C A;  3N0F A;  3M9U A;  2Z50 A;  3SDT A;  1V4E A;  5ILK A;  3WCH A;  5E8K A;  2Q9Z A;  5DHI A;  5C05 A;  3MZV A;  3PDE A;  4HD1 A;  4DXJ A;  4F6V A;  2FTZ A;  5HN8 A;  2Z4W A;  2Z7I A;  3SAE A;  4OGU A;  3N5J F;  5DJV F;  4GAX A;  3LZ9 A;  1N21 A;  4GP2 A;  3WEJ A;  3EGT A;  3EZ3 A;  2E8W A;  5B01 A;  2PS5 A;  4FP4 A;  5IMI A;  1WKZ A;  2Z7H A;  4LA6 A;  3VJ8 A;  3V66 A;  3N3L F;  4LZ3 A;  1N22 A;  2ZEV A;  5B0L A;  4JZX A;  3Q2Z A;  3P8R A;  4PVY F;  3N5H F;  3WCL A;  3LEE A;  3N46 F;  3M01 A;  3LGK A;  5ERN A;  5DIQ F;  2E90 A;  3RBM A;  1VG4 A;  2J1O A;  2P1C A;  3ACX A;  5I1U A;  4DWB A;  2F9K F;  3WSA A;  3AQB B;  4F6X A;  4P0X A;  2E91 A;  5IK9 A;  5E8L A;  1YYS A;  3VJB A;  5ERM A;  5IKH A;  2F8C F;  4H5E F;  3LLW A;  1DI1 A;  4LTZ A;  2Q80 A;  5HN7 A;  2EWG A;  3WCM A;  5DZ2 A;  3RYW A;  1HXC A;  5DGN F;  3WCI A;  4EA2 A;  5B00 A;  3WCE A;  5AHU B;  4LTV A;  1VG2 A;  1RTR A;  5HN9 A;  3DYH A;  1YYU A;  3LG5 A;  5B0K A;  3LMD A;  3V1V A;  3UCA A;  3KRP B;  5DJP F;  1JFA A;  1YJ4 A;  2E8V A;  3ZMC A;  3CKE A;  4XQT F;  3OAC A;  1V4I A;  4JYX A;  3KRO B;  1PS1 A;  2ZY1 A;  1HXG A;  3ACW A;  2Z4X A;  5ILH A;  3WEI A;  4RXA A;  4EA0 A;  1WL1 A;  3AE0 A;  4LIX A;  4KFA A;  3SDU A;  1ZW5 A;  4E9U A;  1YYT A;  4E9Z A;  3BNX A;  3Q2Q A;  2O1O A;  2E4O A;  4OMH A;  3P8L A;  3N1W F;  3OYR A;  4NFJ F;  3MAV A;  3WCG A;  4MC8 A;  3WEG A;  4JXY A;  4XQR F;  4KVI A;  3WE9 A;  2Q58 A;  4LLT A;  4QXS F;  5DW7 A;  3VJD A;  3DYG A;  1DGP A;  5AFX A;  3KRF A;  5DJR F;  1YHK A;  4RXE A;  3N0G A;  4KVW A;  4PVX F;  3WJN A;  4NFI F;  3N1V F;  2PS4 A;  2AET A;  2RAH A;  5EAS A;  4JVJ F;  4RXD A;  4JZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...