5AHUB

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-1326
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
294
structure length
294
Chain Sequence
DGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FARNESYL PYROPHOSPHATE SYNTHASE, PUTATIVE
publication title Inhibition of Trypanosoma Brucei Cell Growth by Lipophilic Bisphosphonates: An in Vitro and in Vivo Investigation.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 115
structure length 294
sequence length 294
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5ahuB00
5ILZA 2OGDA 2EWGA 4JXNA 4LTVA 3VJDA 4Q23A 5H9DA 3N5HF 3NRIA 4F6XA 3AE0A 4OGUA 5IKAA 3TS7A 5IKHA 2ONHA 3ACWA 3LZ9A 5IM1A 2FTZA 1VG4A 4L2XF 3Q30A 5B0JA 5B00A 3PDEA 3VJ8A 3SDRA 5IVGA 4E1EA 3OACB 3Q2ZA 3VJBA 5A0IA 3DYGA 4DHDA 2FORA 1N24A 3M9UA 2PS4A 5IK6A 3TFVA 4H5EF 4P0WA 1V4EA 2F7MF 3VJAA 2F8ZF 4DWBA 3PH7A 4LFEA 4NKEA 3ZMBA 2P1CA 3KRPA 5IMPA 1N1ZA 3G4FA 4EA1A 2PS7A 4KK2A 4RXEA 5AELA 3LJIA 2F94F 3SDQA 2Z4ZA 2PS6A 1KIZA 3BNXA 5DJVF 3WEIA 3WEJA 2E92A 1VG2A 2OPNA 3LEEA 4GP2A 3WSAA 3KRAA 1WMWA 4PVYF 3KROA 3WCIA 3PYBA 3N3LF 2J1PA 4LFGA 1YYUA 1HX9A 3DYHA 5DHIA 3N5JF 3KB9A 3WJNA 3KRPB 4GAXA 4OKZA 4F6VA 5DIQF 4OKMA 5IL8A 5HNAA 3OYRA 3ZL6A 2Z4YA 3RYWA 2F9KF 2E8VA 2PS5A 5ILYA 1N23A 3WCJA 1V4IA 5HN7A 5DGMF 2Z7IA 5ER8A 3KRAB 5AFXA 3Q1OA 4ZQ8A 3WCBA 3LDWA 1UBWA 1WL2A 5JUZF 4LIXA 2Z7HA 1WL3A 3VJEA 2O1OA 2VF6A 4K10A 4XQTF 4XQRF 5B0LA 4H5DF 4JXYA 1WL0A 3B7LA 5I1UA 5B0MA 3QKCA 3VJ9A 5IK9A 5A0KA 3NPKA 3WCGA 4LA6A 4E9UA 3WCMA 3M02A 1HM7A 3WJKA 2OA6A 3ICZA 1N21A 2E95A 2ZEVA 4FP4A 5DJRF 3DYFA 3ICKA 3ICNA 4KWDA 2DH4A 5JA0F 2F8CF 4KVYA 1RQIA 3ASXA 1HM4A 3RMGA 5ILJA 5DGSF 1YJ4A 5C05A 2Z4VA 4MC8A 4OMHA 1YV5A 4LPGF 3LGKA 4MC3A 2E8UA 5AYPA 4LA5A 1YYSA 2AZKA 2E93A 3G4DA 4RXAA 4GP1A 5DZ2A 5ILHA 3LK5A 4UMJA 2AEKA 5B02A 4LUUA 5CG6A 4E9ZA 3N46F 3AQCB 3WCDA 2ONGA 1VG7A 3WEFA 4LZCA 1N22A 3WEHA 2H8OA 4N1ZF 4RXCA 2RAHA 5DHKA 3SDVA 4RNQA 4DEMF 3OABA 2E90A 4KPJA 1JFGA 5EROA 2Z52A 1FPSA 3NPRA 3N0GA 4NG6A 3V1XA 2I19A 5HN8A 4P0VA 5EATA 2ZCOA 5ILIA 5E8HA 1RQJA 3S4JA 3WEGA 5B0KA 5B01A 5EASA 3S9VA 2AELA 5IMIA 3ADZA 2AZJA 3ACYA 3SDUA 4LFVF 2Z4WA 3P41A 4JYXA 3W7FA 3RBMA 4HD1A 4JZXA 5ILDA 3OABB 4PVXF 3M0GA 1V4JA 4F62A 2E8XA 3CC9A 5KSXF 4KQ5A 1DGPA 3TFPA 2Z78A 3LOMA 5E8LA 3NF2A 5IN8A 1JFAA 3M00A 1VG6A 4JVJF 5ERMA 4LTZA 3V1VA 3LLWA 3N1VF 5DGNF 2Z4XA 5CG5A 5ERNA 4NFKF 1KIYA 3ICMA 1HXGA 3N1WF 2ZCSA 3WC9A 3SAEA 1DI1A 3P5PA 4EA0A 2AZLA 1V4KA 3WCCA 1WKZA 3VJCA 2Q9YA 3RYEA 3QQVA 4MC0A 2ZCQA 4KQUA 4P0XA 1N1BA 3MZVA 1YYQA 3P8RA 3LG5A 2F89F 3IBAA 5HN9A 4KPDA 4LZ3A 3WCFA 3P5RA 4N9UA 3N6KF 3N45F 4DWGA 3Q2QA 1YHMA 1UBYA 1YYTA 3ID0A 3SDTA 4KUXA 5E8KA 3WCEA 4LZ0A 1VG3A 3P8LA 5B03A 5ILKA 5IMNA 1WY0A 3TC1A 3KRCA 3WEKA 3LMDA 3WJOA 4LOBA 2QISA 3LGZB 4H5CF 4EA2A 1HXCA 2ZCRA 4DI5A 5AHUB 4QXSF 4WK5A 3CP6A 2Q58A 3AQBB 4KQSA 2ZY1A 4KKMA 5EAUA 1YHLA 3KRFA 3ACXA 3APZA 2E4OA 2PS8A 4DZWA 3CKEA 4RYPA 5DW7A 1UBVA 2ZEUA 2OPMA 3EZ3A 2Q80A 5JV2F 5B0IA 4KVWA 3WCAA 2AETA 4JZBA 1PS1A 3N3DA 1EZFA 3WCLA 1YQ7A 3ZMCA 2J5CA 4LXWA 3PYAA 3KBKA 3MAVA 3N49F 3TFNA 3KRCB 2Z50A 3V66A 5JV0F 5IL3A 4GA3A 4OMGA 1N20A 2F92F 5IK0A 4LPHF 3IPIA 2E91A 2E94A 3WCHA 4QPFA 3WE9A 2Q9ZA 4NUAA 3KRFB 4NFJF 5DJPF 1YHKA 3EGTA 1RTRA 3BNYA 3LSNA 4LLSA 4RXDA 3UCAA 5A0JA 4KVDA 1HXAA 3M01A 3ZOUA 4LLTA 4NFIF 2E8TA 2J1OA 3PKOA 4KVIA 5JV1F 3OACA 3KROB 3WSBA 1WL1A 1YYRA 1ZW5A 2E8WA 3AQ0A 4FJQA 1V4HA 3EFQA 3N0FA 4KFAA 4XQSF 4NKFA 3ZCDA 4DXJA 1UBXA 3LVSA
chains in the Genus database with same CATH superfamily
5ILZA 2OGDA 2EWGA 4JXNA 4LTVA 3VJDA 4Q23A 5H9DA 3N5HF 3NRIA 4F6XA 3AE0A 4OGUA 5IKAA 3TS7A 5IKHA 2ONHA 3ACWA 3LZ9A 5IM1A 2FTZA 1VG4A 4L2XF 3Q30A 5B0JA 5B00A 3PDEA 3VJ8A 3SDRA 5IVGA 4E1EA 3OACB 3Q2ZA 3VJBA 5A0IA 3DYGA 4DHDA 2FORA 1N24A 3M9UA 2PS4A 5IK6A 3TFVA 4H5EF 4P0WA 1V4EA 2F7MF 3VJAA 2F8ZF 4DWBA 3PH7A 4LFEA 4NKEA 3ZMBA 2P1CA 3KRPA 5IMPA 1N1ZA 3G4FA 4EA1A 2PS7A 4KK2A 4RXEA 5AELA 3LJIA 2F94F 3SDQA 2Z4ZA 2PS6A 1KIZA 3BNXA 5DJVF 3WEIA 3WEJA 2E92A 1VG2A 2OPNA 3LEEA 4GP2A 3WSAA 3KRAA 1WMWA 4PVYF 3KROA 3WCIA 3PYBA 3N3LF 2J1PA 4LFGA 1YYUA 1HX9A 3DYHA 5DHIA 3N5JF 3KB9A 3WJNA 3KRPB 4GAXA 4OKZA 4F6VA 5DIQF 4OKMA 5IL8A 5HNAA 3OYRA 3ZL6A 2Z4YA 3RYWA 2F9KF 2E8VA 2PS5A 5ILYA 1N23A 3WCJA 1V4IA 5HN7A 5DGMF 2Z7IA 5ER8A 3KRAB 5AFXA 3Q1OA 4ZQ8A 3WCBA 3LDWA 1UBWA 1WL2A 5JUZF 4LIXA 2Z7HA 1WL3A 3VJEA 2O1OA 2VF6A 4K10A 4XQTF 4XQRF 5B0LA 4H5DF 4JXYA 1WL0A 3B7LA 5I1UA 5B0MA 3QKCA 3VJ9A 5IK9A 5A0KA 3NPKA 3WCGA 4LA6A 4E9UA 3WCMA 3M02A 1HM7A 3WJKA 2OA6A 3ICZA 1N21A 2E95A 2ZEVA 4FP4A 5DJRF 3DYFA 3ICKA 3ICNA 4KWDA 2DH4A 5JA0F 2F8CF 4KVYA 1RQIA 3ASXA 1HM4A 3RMGA 5ILJA 5DGSF 1YJ4A 5C05A 2Z4VA 4MC8A 4OMHA 1YV5A 4LPGF 3LGKA 4MC3A 2E8UA 5AYPA 4LA5A 1YYSA 2AZKA 2E93A 3G4DA 4RXAA 4GP1A 5DZ2A 5ILHA 3LK5A 4UMJA 2AEKA 5B02A 4LUUA 5CG6A 4E9ZA 3N46F 3AQCB 3WCDA 2ONGA 1VG7A 3WEFA 4LZCA 1N22A 3WEHA 2H8OA 4N1ZF 4RXCA 2RAHA 5DHKA 3SDVA 4RNQA 4DEMF 3OABA 2E90A 4KPJA 1JFGA 5EROA 2Z52A 1FPSA 3NPRA 3N0GA 4NG6A 3V1XA 2I19A 5HN8A 4P0VA 5EATA 2ZCOA 5ILIA 5E8HA 1RQJA 3S4JA 3WEGA 5B0KA 5B01A 5EASA 3S9VA 2AELA 5IMIA 3ADZA 2AZJA 3ACYA 3SDUA 4LFVF 2Z4WA 3P41A 4JYXA 3W7FA 3RBMA 4HD1A 4JZXA 5ILDA 3OABB 4PVXF 3M0GA 1V4JA 4F62A 2E8XA 3CC9A 5KSXF 4KQ5A 1DGPA 3TFPA 2Z78A 3LOMA 5E8LA 3NF2A 5IN8A 1JFAA 3M00A 1VG6A 4JVJF 5ERMA 4LTZA 3V1VA 3LLWA 3N1VF 5DGNF 2Z4XA 5CG5A 5ERNA 4NFKF 1KIYA 3ICMA 1HXGA 3N1WF 2ZCSA 3WC9A 3SAEA 1DI1A 3P5PA 4EA0A 2AZLA 1V4KA 3WCCA 1WKZA 3VJCA 2Q9YA 3RYEA 3QQVA 4MC0A 2ZCQA 4KQUA 4P0XA 1N1BA 3MZVA 1YYQA 3P8RA 3LG5A 2F89F 3IBAA 5HN9A 4KPDA 4LZ3A 3WCFA 3P5RA 4N9UA 3N6KF 3N45F 4DWGA 3Q2QA 1YHMA 1UBYA 1YYTA 3ID0A 3SDTA 4KUXA 5E8KA 3WCEA 4LZ0A 1VG3A 3P8LA 5B03A 5ILKA 5IMNA 1WY0A 3TC1A 3KRCA 3WEKA 3LMDA 3WJOA 4LOBA 2QISA 3LGZB 4H5CF 4EA2A 1HXCA 2ZCRA 4DI5A 5AHUB 4QXSF 4WK5A 3CP6A 2Q58A 3AQBB 4KQSA 2ZY1A 4KKMA 5EAUA 1YHLA 3KRFA 3ACXA 3APZA 2E4OA 2PS8A 4DZWA 3CKEA 4RYPA 5DW7A 1UBVA 2ZEUA 2OPMA 3EZ3A 2Q80A 5JV2F 5B0IA 4KVWA 3WCAA 2AETA 4JZBA 1PS1A 3N3DA 1EZFA 3WCLA 1YQ7A 3ZMCA 2J5CA 4LXWA 3PYAA 3KBKA 3MAVA 3N49F 3TFNA 3KRCB 2Z50A 3V66A 5JV0F 5IL3A 4GA3A 4OMGA 1N20A 2F92F 5IK0A 4LPHF 3IPIA 2E91A 2E94A 3WCHA 4QPFA 3WE9A 2Q9ZA 4NUAA 3KRFB 4NFJF 5DJPF 1YHKA 3EGTA 1RTRA 3BNYA 3LSNA 4LLSA 4RXDA 3UCAA 5A0JA 4KVDA 1HXAA 3M01A 3ZOUA 4LLTA 4NFIF 2E8TA 2J1OA 3PKOA 4KVIA 5JV1F 3OACA 3KROB 3WSBA 1WL1A 1YYRA 1ZW5A 2E8WA 3AQ0A 4FJQA 1V4HA 3EFQA 3N0FA 4KFAA 4XQSF 4NKFA 3ZCDA 4DXJA 1UBXA 3LVSA
chains in the Genus database with same CATH topology
5ILZA 2OGDA 2EWGA 4JXNA 4LTVA 3VJDA 4Q23A 5H9DA 3N5HF 3NRIA 4F6XA 3AE0A 4OGUA 5IKAA 3TS7A 5IKHA 2ONHA 3ACWA 3LZ9A 5IM1A 2FTZA 1VG4A 4L2XF 3Q30A 5B0JA 5B00A 3PDEA 3VJ8A 3SDRA 5IVGA 4E1EA 3OACB 3Q2ZA 3VJBA 5A0IA 3DYGA 4DHDA 2FORA 1N24A 3M9UA 2PS4A 5IK6A 3TFVA 4H5EF 4P0WA 1V4EA 2F7MF 3VJAA 2F8ZF 4DWBA 3PH7A 4LFEA 4NKEA 3ZMBA 2P1CA 3KRPA 5IMPA 1N1ZA 3G4FA 4EA1A 2PS7A 4KK2A 4RXEA 5AELA 3LJIA 2F94F 3SDQA 2Z4ZA 2PS6A 1KIZA 3BNXA 5DJVF 3WEIA 3WEJA 2E92A 1VG2A 2OPNA 3LEEA 4GP2A 3WSAA 3KRAA 1WMWA 4PVYF 3KROA 3WCIA 3PYBA 3N3LF 2J1PA 4LFGA 1YYUA 1HX9A 3DYHA 5DHIA 3N5JF 3KB9A 3WJNA 3KRPB 4GAXA 4OKZA 4F6VA 5DIQF 4OKMA 5IL8A 5HNAA 3OYRA 3ZL6A 2Z4YA 3RYWA 2F9KF 2E8VA 2PS5A 5ILYA 1N23A 3WCJA 1V4IA 5HN7A 5DGMF 2Z7IA 5ER8A 3KRAB 5AFXA 3Q1OA 4ZQ8A 3WCBA 3LDWA 1UBWA 1WL2A 5JUZF 4LIXA 2Z7HA 1WL3A 3VJEA 2O1OA 2VF6A 4K10A 4XQTF 4XQRF 5B0LA 4H5DF 4JXYA 1WL0A 3B7LA 5I1UA 5B0MA 3QKCA 3VJ9A 5IK9A 5A0KA 3NPKA 3WCGA 4LA6A 4E9UA 3WCMA 3M02A 1HM7A 3WJKA 2OA6A 3ICZA 1N21A 2E95A 2ZEVA 4FP4A 5DJRF 3DYFA 3ICKA 3ICNA 4KWDA 2DH4A 5JA0F 2F8CF 4KVYA 1RQIA 3ASXA 1HM4A 3RMGA 5ILJA 5DGSF 1YJ4A 5C05A 2Z4VA 4MC8A 4OMHA 1YV5A 4LPGF 3LGKA 4MC3A 2E8UA 5AYPA 4LA5A 1YYSA 2AZKA 2E93A 3G4DA 4RXAA 4GP1A 5DZ2A 5ILHA 3LK5A 4UMJA 2AEKA 5B02A 4LUUA 5CG6A 4E9ZA 3N46F 3AQCB 3WCDA 2ONGA 1VG7A 3WEFA 4LZCA 1N22A 3WEHA 2H8OA 4N1ZF 4RXCA 2RAHA 5DHKA 3SDVA 4RNQA 4DEMF 3OABA 2E90A 4KPJA 1JFGA 5EROA 2Z52A 1FPSA 3NPRA 3N0GA 4NG6A 3V1XA 2I19A 5HN8A 4P0VA 5EATA 2ZCOA 5ILIA 5E8HA 1RQJA 3S4JA 3WEGA 5B0KA 5B01A 5EASA 3S9VA 2AELA 5IMIA 3ADZA 2AZJA 3ACYA 3SDUA 4LFVF 2Z4WA 3P41A 4JYXA 3W7FA 3RBMA 4HD1A 4JZXA 5ILDA 3OABB 4PVXF 3M0GA 1V4JA 4F62A 2E8XA 3CC9A 5KSXF 4KQ5A 1DGPA 3TFPA 2Z78A 3LOMA 5E8LA 3NF2A 5IN8A 1JFAA 3M00A 1VG6A 4JVJF 5ERMA 4LTZA 3V1VA 3LLWA 3N1VF 5DGNF 2Z4XA 5CG5A 5ERNA 4NFKF 1KIYA 3ICMA 1HXGA 3N1WF 2ZCSA 3WC9A 3SAEA 1DI1A 3P5PA 4EA0A 2AZLA 1V4KA 3WCCA 1WKZA 3VJCA 2Q9YA 3RYEA 3QQVA 4MC0A 2ZCQA 4KQUA 4P0XA 1N1BA 3MZVA 1YYQA 3P8RA 3LG5A 2F89F 3IBAA 5HN9A 4KPDA 4LZ3A 3WCFA 3P5RA 4N9UA 3N6KF 3N45F 4DWGA 3Q2QA 1YHMA 1UBYA 1YYTA 3ID0A 3SDTA 4KUXA 5E8KA 3WCEA 4LZ0A 1VG3A 3P8LA 5B03A 5ILKA 5IMNA 1WY0A 3TC1A 3KRCA 3WEKA 3LMDA 3WJOA 4LOBA 2QISA 3LGZB 4H5CF 4EA2A 1HXCA 2ZCRA 4DI5A 5AHUB 4QXSF 4WK5A 3CP6A 2Q58A 3AQBB 4KQSA 2ZY1A 4KKMA 5EAUA 1YHLA 3KRFA 3ACXA 3APZA 2E4OA 2PS8A 4DZWA 3CKEA 4RYPA 5DW7A 1UBVA 2ZEUA 2OPMA 3EZ3A 2Q80A 5JV2F 5B0IA 4KVWA 3WCAA 2AETA 4JZBA 1PS1A 3N3DA 1EZFA 3WCLA 1YQ7A 3ZMCA 2J5CA 4LXWA 3PYAA 3KBKA 3MAVA 3N49F 3TFNA 3KRCB 2Z50A 3V66A 5JV0F 5IL3A 4GA3A 4OMGA 1N20A 2F92F 5IK0A 4LPHF 3IPIA 2E91A 2E94A 3WCHA 4QPFA 3WE9A 2Q9ZA 4NUAA 3KRFB 4NFJF 5DJPF 1YHKA 3EGTA 1RTRA 3BNYA 3LSNA 4LLSA 4RXDA 3UCAA 5A0JA 4KVDA 1HXAA 3M01A 3ZOUA 4LLTA 4NFIF 2E8TA 2J1OA 3PKOA 4KVIA 5JV1F 3OACA 3KROB 3WSBA 1WL1A 1YYRA 1ZW5A 2E8WA 3AQ0A 4FJQA 1V4HA 3EFQA 3N0FA 4KFAA 4XQSF 4NKFA 3ZCDA 4DXJA 1UBXA 3LVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILZ A;  2OGD A;  2EWG A;  4JXN A;  4LTV A;  3VJD A;  4Q23 A;  5H9D A;  3N5H F;  3NRI A;  4F6X A;  3AE0 A;  4OGU A;  5IKA A;  3TS7 A;  5IKH A;  2ONH A;  3ACW A;  3LZ9 A;  5IM1 A;  2FTZ A;  1VG4 A;  4L2X F;  3Q30 A;  5B0J A;  5B00 A;  3PDE A;  3VJ8 A;  3SDR A;  5IVG A;  4E1E A;  3OAC B;  3Q2Z A;  3VJB A;  5A0I A;  3DYG A;  4DHD A;  2FOR A;  1N24 A;  3M9U A;  2PS4 A;  5IK6 A;  3TFV A;  4H5E F;  4P0W A;  1V4E A;  2F7M F;  3VJA A;  2F8Z F;  4DWB A;  3PH7 A;  4LFE A;  4NKE A;  3ZMB A;  2P1C A;  3KRP A;  5IMP A;  1N1Z A;  3G4F A;  4EA1 A;  2PS7 A;  4KK2 A;  4RXE A;  5AEL A;  3LJI A;  2F94 F;  3SDQ A;  2Z4Z A;  2PS6 A;  1KIZ A;  3BNX A;  5DJV F;  3WEI A;  3WEJ A;  2E92 A;  1VG2 A;  2OPN A;  3LEE A;  4GP2 A;  3WSA A;  3KRA A;  1WMW A;  4PVY F;  3KRO A;  3WCI A;  3PYB A;  3N3L F;  2J1P A;  4LFG A;  1YYU A;  1HX9 A;  3DYH A;  5DHI A;  3N5J F;  3KB9 A;  3WJN A;  3KRP B;  4GAX A;  4OKZ A;  4F6V A;  5DIQ F;  4OKM A;  5IL8 A;  5HNA A;  3OYR A;  3ZL6 A;  2Z4Y A;  3RYW A;  2F9K F;  2E8V A;  2PS5 A;  5ILY A;  1N23 A;  3WCJ A;  1V4I A;  5HN7 A;  5DGM F;  2Z7I A;  5ER8 A;  3KRA B;  5AFX A;  3Q1O A;  4ZQ8 A;  3WCB A;  3LDW A;  1UBW A;  1WL2 A;  5JUZ F;  4LIX A;  2Z7H A;  1WL3 A;  3VJE A;  2O1O A;  2VF6 A;  4K10 A;  4XQT F;  4XQR F;  5B0L A;  4H5D F;  4JXY A;  1WL0 A;  3B7L A;  5I1U A;  5B0M A;  3QKC A;  3VJ9 A;  5IK9 A;  5A0K A;  3NPK A;  3WCG A;  4LA6 A;  4E9U A;  3WCM A;  3M02 A;  1HM7 A;  3WJK A;  2OA6 A;  3ICZ A;  1N21 A;  2E95 A;  2ZEV A;  4FP4 A;  5DJR F;  3DYF A;  3ICK A;  3ICN A;  4KWD A;  2DH4 A;  5JA0 F;  2F8C F;  4KVY A;  1RQI A;  3ASX A;  1HM4 A;  3RMG A;  5ILJ A;  5DGS F;  1YJ4 A;  5C05 A;  2Z4V A;  4MC8 A;  4OMH A;  1YV5 A;  4LPG F;  3LGK A;  4MC3 A;  2E8U A;  5AYP A;  4LA5 A;  1YYS A;  2AZK A;  2E93 A;  3G4D A;  4RXA A;  4GP1 A;  5DZ2 A;  5ILH A;  3LK5 A;  4UMJ A;  2AEK A;  5B02 A;  4LUU A;  5CG6 A;  4E9Z A;  3N46 F;  3AQC B;  3WCD A;  2ONG A;  1VG7 A;  3WEF A;  4LZC A;  1N22 A;  3WEH A;  2H8O A;  4N1Z F;  4RXC A;  2RAH A;  5DHK A;  3SDV A;  4RNQ A;  4DEM F;  3OAB A;  2E90 A;  4KPJ A;  1JFG A;  5ERO A;  2Z52 A;  1FPS A;  3NPR A;  3N0G A;  4NG6 A;  3V1X A;  2I19 A;  5HN8 A;  4P0V A;  5EAT A;  2ZCO A;  5ILI A;  5E8H A;  1RQJ A;  3S4J A;  3WEG A;  5B0K A;  5B01 A;  5EAS A;  3S9V A;  2AEL A;  5IMI A;  3ADZ A;  2AZJ A;  3ACY A;  3SDU A;  4LFV F;  2Z4W A;  3P41 A;  4JYX A;  3W7F A;  3RBM A;  4HD1 A;  4JZX A;  5ILD A;  3OAB B;  4PVX F;  3M0G A;  1V4J A;  4F62 A;  2E8X A;  3CC9 A;  5KSX F;  4KQ5 A;  1DGP A;  3TFP A;  2Z78 A;  3LOM A;  5E8L A;  3NF2 A;  5IN8 A;  1JFA A;  3M00 A;  1VG6 A;  4JVJ F;  5ERM A;  4LTZ A;  3V1V A;  3LLW A;  3N1V F;  5DGN F;  2Z4X A;  5CG5 A;  5ERN A;  4NFK F;  1KIY A;  3ICM A;  1HXG A;  3N1W F;  2ZCS A;  3WC9 A;  3SAE A;  1DI1 A;  3P5P A;  4EA0 A;  2AZL A;  1V4K A;  3WCC A;  1WKZ A;  3VJC A;  2Q9Y A;  3RYE A;  3QQV A;  4MC0 A;  2ZCQ A;  4KQU A;  4P0X A;  1N1B A;  3MZV A;  1YYQ A;  3P8R A;  3LG5 A;  2F89 F;  3IBA A;  5HN9 A;  4KPD A;  4LZ3 A;  3WCF A;  3P5R A;  4N9U A;  3N6K F;  3N45 F;  4DWG A;  3Q2Q A;  1YHM A;  1UBY A;  1YYT A;  3ID0 A;  3SDT A;  4KUX A;  5E8K A;  3WCE A;  4LZ0 A;  1VG3 A;  3P8L A;  5B03 A;  5ILK A;  5IMN A;  1WY0 A;  3TC1 A;  3KRC A;  3WEK A;  3LMD A;  3WJO A;  4LOB A;  2QIS A;  3LGZ B;  4H5C F;  4EA2 A;  1HXC A;  2ZCR A;  4DI5 A;  5AHU B;  4QXS F;  4WK5 A;  3CP6 A;  2Q58 A;  3AQB B;  4KQS A;  2ZY1 A;  4KKM A;  5EAU A;  1YHL A;  3KRF A;  3ACX A;  3APZ A;  2E4O A;  2PS8 A;  4DZW A;  3CKE A;  4RYP A;  5DW7 A;  1UBV A;  2ZEU A;  2OPM A;  3EZ3 A;  2Q80 A;  5JV2 F;  5B0I A;  4KVW A;  3WCA A;  2AET A;  4JZB A;  1PS1 A;  3N3D A;  1EZF A;  3WCL A;  1YQ7 A;  3ZMC A;  2J5C A;  4LXW A;  3PYA A;  3KBK A;  3MAV A;  3N49 F;  3TFN A;  3KRC B;  2Z50 A;  3V66 A;  5JV0 F;  5IL3 A;  4GA3 A;  4OMG A;  1N20 A;  2F92 F;  5IK0 A;  4LPH F;  3IPI A;  2E91 A;  2E94 A;  3WCH A;  4QPF A;  3WE9 A;  2Q9Z A;  4NUA A;  3KRF B;  4NFJ F;  5DJP F;  1YHK A;  3EGT A;  1RTR A;  3BNY A;  3LSN A;  4LLS A;  4RXD A;  3UCA A;  5A0J A;  4KVD A;  1HXA A;  3M01 A;  3ZOU A;  4LLT A;  4NFI F;  2E8T A;  2J1O A;  3PKO A;  4KVI A;  5JV1 F;  3OAC A;  3KRO B;  3WSB A;  1WL1 A;  1YYR A;  1ZW5 A;  2E8W A;  3AQ0 A;  4FJQ A;  1V4H A;  3EFQ A;  3N0F A;  4KFA A;  4XQS F;  4NKF A;  3ZCD A;  4DXJ A;  1UBX A;  3LVS A; 
#chains in the Genus database with same CATH topology
 5ILZ A;  2OGD A;  2EWG A;  4JXN A;  4LTV A;  3VJD A;  4Q23 A;  5H9D A;  3N5H F;  3NRI A;  4F6X A;  3AE0 A;  4OGU A;  5IKA A;  3TS7 A;  5IKH A;  2ONH A;  3ACW A;  3LZ9 A;  5IM1 A;  2FTZ A;  1VG4 A;  4L2X F;  3Q30 A;  5B0J A;  5B00 A;  3PDE A;  3VJ8 A;  3SDR A;  5IVG A;  4E1E A;  3OAC B;  3Q2Z A;  3VJB A;  5A0I A;  3DYG A;  4DHD A;  2FOR A;  1N24 A;  3M9U A;  2PS4 A;  5IK6 A;  3TFV A;  4H5E F;  4P0W A;  1V4E A;  2F7M F;  3VJA A;  2F8Z F;  4DWB A;  3PH7 A;  4LFE A;  4NKE A;  3ZMB A;  2P1C A;  3KRP A;  5IMP A;  1N1Z A;  3G4F A;  4EA1 A;  2PS7 A;  4KK2 A;  4RXE A;  5AEL A;  3LJI A;  2F94 F;  3SDQ A;  2Z4Z A;  2PS6 A;  1KIZ A;  3BNX A;  5DJV F;  3WEI A;  3WEJ A;  2E92 A;  1VG2 A;  2OPN A;  3LEE A;  4GP2 A;  3WSA A;  3KRA A;  1WMW A;  4PVY F;  3KRO A;  3WCI A;  3PYB A;  3N3L F;  2J1P A;  4LFG A;  1YYU A;  1HX9 A;  3DYH A;  5DHI A;  3N5J F;  3KB9 A;  3WJN A;  3KRP B;  4GAX A;  4OKZ A;  4F6V A;  5DIQ F;  4OKM A;  5IL8 A;  5HNA A;  3OYR A;  3ZL6 A;  2Z4Y A;  3RYW A;  2F9K F;  2E8V A;  2PS5 A;  5ILY A;  1N23 A;  3WCJ A;  1V4I A;  5HN7 A;  5DGM F;  2Z7I A;  5ER8 A;  3KRA B;  5AFX A;  3Q1O A;  4ZQ8 A;  3WCB A;  3LDW A;  1UBW A;  1WL2 A;  5JUZ F;  4LIX A;  2Z7H A;  1WL3 A;  3VJE A;  2O1O A;  2VF6 A;  4K10 A;  4XQT F;  4XQR F;  5B0L A;  4H5D F;  4JXY A;  1WL0 A;  3B7L A;  5I1U A;  5B0M A;  3QKC A;  3VJ9 A;  5IK9 A;  5A0K A;  3NPK A;  3WCG A;  4LA6 A;  4E9U A;  3WCM A;  3M02 A;  1HM7 A;  3WJK A;  2OA6 A;  3ICZ A;  1N21 A;  2E95 A;  2ZEV A;  4FP4 A;  5DJR F;  3DYF A;  3ICK A;  3ICN A;  4KWD A;  2DH4 A;  5JA0 F;  2F8C F;  4KVY A;  1RQI A;  3ASX A;  1HM4 A;  3RMG A;  5ILJ A;  5DGS F;  1YJ4 A;  5C05 A;  2Z4V A;  4MC8 A;  4OMH A;  1YV5 A;  4LPG F;  3LGK A;  4MC3 A;  2E8U A;  5AYP A;  4LA5 A;  1YYS A;  2AZK A;  2E93 A;  3G4D A;  4RXA A;  4GP1 A;  5DZ2 A;  5ILH A;  3LK5 A;  4UMJ A;  2AEK A;  5B02 A;  4LUU A;  5CG6 A;  4E9Z A;  3N46 F;  3AQC B;  3WCD A;  2ONG A;  1VG7 A;  3WEF A;  4LZC A;  1N22 A;  3WEH A;  2H8O A;  4N1Z F;  4RXC A;  2RAH A;  5DHK A;  3SDV A;  4RNQ A;  4DEM F;  3OAB A;  2E90 A;  4KPJ A;  1JFG A;  5ERO A;  2Z52 A;  1FPS A;  3NPR A;  3N0G A;  4NG6 A;  3V1X A;  2I19 A;  5HN8 A;  4P0V A;  5EAT A;  2ZCO A;  5ILI A;  5E8H A;  1RQJ A;  3S4J A;  3WEG A;  5B0K A;  5B01 A;  5EAS A;  3S9V A;  2AEL A;  5IMI A;  3ADZ A;  2AZJ A;  3ACY A;  3SDU A;  4LFV F;  2Z4W A;  3P41 A;  4JYX A;  3W7F A;  3RBM A;  4HD1 A;  4JZX A;  5ILD A;  3OAB B;  4PVX F;  3M0G A;  1V4J A;  4F62 A;  2E8X A;  3CC9 A;  5KSX F;  4KQ5 A;  1DGP A;  3TFP A;  2Z78 A;  3LOM A;  5E8L A;  3NF2 A;  5IN8 A;  1JFA A;  3M00 A;  1VG6 A;  4JVJ F;  5ERM A;  4LTZ A;  3V1V A;  3LLW A;  3N1V F;  5DGN F;  2Z4X A;  5CG5 A;  5ERN A;  4NFK F;  1KIY A;  3ICM A;  1HXG A;  3N1W F;  2ZCS A;  3WC9 A;  3SAE A;  1DI1 A;  3P5P A;  4EA0 A;  2AZL A;  1V4K A;  3WCC A;  1WKZ A;  3VJC A;  2Q9Y A;  3RYE A;  3QQV A;  4MC0 A;  2ZCQ A;  4KQU A;  4P0X A;  1N1B A;  3MZV A;  1YYQ A;  3P8R A;  3LG5 A;  2F89 F;  3IBA A;  5HN9 A;  4KPD A;  4LZ3 A;  3WCF A;  3P5R A;  4N9U A;  3N6K F;  3N45 F;  4DWG A;  3Q2Q A;  1YHM A;  1UBY A;  1YYT A;  3ID0 A;  3SDT A;  4KUX A;  5E8K A;  3WCE A;  4LZ0 A;  1VG3 A;  3P8L A;  5B03 A;  5ILK A;  5IMN A;  1WY0 A;  3TC1 A;  3KRC A;  3WEK A;  3LMD A;  3WJO A;  4LOB A;  2QIS A;  3LGZ B;  4H5C F;  4EA2 A;  1HXC A;  2ZCR A;  4DI5 A;  5AHU B;  4QXS F;  4WK5 A;  3CP6 A;  2Q58 A;  3AQB B;  4KQS A;  2ZY1 A;  4KKM A;  5EAU A;  1YHL A;  3KRF A;  3ACX A;  3APZ A;  2E4O A;  2PS8 A;  4DZW A;  3CKE A;  4RYP A;  5DW7 A;  1UBV A;  2ZEU A;  2OPM A;  3EZ3 A;  2Q80 A;  5JV2 F;  5B0I A;  4KVW A;  3WCA A;  2AET A;  4JZB A;  1PS1 A;  3N3D A;  1EZF A;  3WCL A;  1YQ7 A;  3ZMC A;  2J5C A;  4LXW A;  3PYA A;  3KBK A;  3MAV A;  3N49 F;  3TFN A;  3KRC B;  2Z50 A;  3V66 A;  5JV0 F;  5IL3 A;  4GA3 A;  4OMG A;  1N20 A;  2F92 F;  5IK0 A;  4LPH F;  3IPI A;  2E91 A;  2E94 A;  3WCH A;  4QPF A;  3WE9 A;  2Q9Z A;  4NUA A;  3KRF B;  4NFJ F;  5DJP F;  1YHK A;  3EGT A;  1RTR A;  3BNY A;  3LSN A;  4LLS A;  4RXD A;  3UCA A;  5A0J A;  4KVD A;  1HXA A;  3M01 A;  3ZOU A;  4LLT A;  4NFI F;  2E8T A;  2J1O A;  3PKO A;  4KVI A;  5JV1 F;  3OAC A;  3KRO B;  3WSB A;  1WL1 A;  1YYR A;  1ZW5 A;  2E8W A;  3AQ0 A;  4FJQ A;  1V4H A;  3EFQ A;  3N0F A;  4KFA A;  4XQS F;  4NKF A;  3ZCD A;  4DXJ A;  1UBX A;  3LVS A; 
#chains in the Genus database with same CATH homology
 5ILZ A;  2OGD A;  2EWG A;  4JXN A;  4LTV A;  3VJD A;  4Q23 A;  5H9D A;  3N5H F;  3NRI A;  4F6X A;  3AE0 A;  4OGU A;  5IKA A;  3TS7 A;  5IKH A;  2ONH A;  3ACW A;  3LZ9 A;  5IM1 A;  2FTZ A;  1VG4 A;  4L2X F;  3Q30 A;  5B0J A;  5B00 A;  3PDE A;  3VJ8 A;  3SDR A;  5IVG A;  4E1E A;  3OAC B;  3Q2Z A;  3VJB A;  5A0I A;  3DYG A;  4DHD A;  2FOR A;  1N24 A;  3M9U A;  2PS4 A;  5IK6 A;  3TFV A;  4H5E F;  4P0W A;  1V4E A;  2F7M F;  3VJA A;  2F8Z F;  4DWB A;  3PH7 A;  4LFE A;  4NKE A;  3ZMB A;  2P1C A;  3KRP A;  5IMP A;  1N1Z A;  3G4F A;  4EA1 A;  2PS7 A;  4KK2 A;  4RXE A;  5AEL A;  3LJI A;  2F94 F;  3SDQ A;  2Z4Z A;  2PS6 A;  1KIZ A;  3BNX A;  5DJV F;  3WEI A;  3WEJ A;  2E92 A;  1VG2 A;  2OPN A;  3LEE A;  4GP2 A;  3WSA A;  3KRA A;  1WMW A;  4PVY F;  3KRO A;  3WCI A;  3PYB A;  3N3L F;  2J1P A;  4LFG A;  1YYU A;  1HX9 A;  3DYH A;  5DHI A;  3N5J F;  3KB9 A;  3WJN A;  3KRP B;  4GAX A;  4OKZ A;  4F6V A;  5DIQ F;  4OKM A;  5IL8 A;  5HNA A;  3OYR A;  3ZL6 A;  2Z4Y A;  3RYW A;  2F9K F;  2E8V A;  2PS5 A;  5ILY A;  1N23 A;  3WCJ A;  1V4I A;  5HN7 A;  5DGM F;  2Z7I A;  5ER8 A;  3KRA B;  5AFX A;  3Q1O A;  4ZQ8 A;  3WCB A;  3LDW A;  1UBW A;  1WL2 A;  5JUZ F;  4LIX A;  2Z7H A;  1WL3 A;  3VJE A;  2O1O A;  2VF6 A;  4K10 A;  4XQT F;  4XQR F;  5B0L A;  4H5D F;  4JXY A;  1WL0 A;  3B7L A;  5I1U A;  5B0M A;  3QKC A;  3VJ9 A;  5IK9 A;  5A0K A;  3NPK A;  3WCG A;  4LA6 A;  4E9U A;  3WCM A;  3M02 A;  1HM7 A;  3WJK A;  2OA6 A;  3ICZ A;  1N21 A;  2E95 A;  2ZEV A;  4FP4 A;  5DJR F;  3DYF A;  3ICK A;  3ICN A;  4KWD A;  2DH4 A;  5JA0 F;  2F8C F;  4KVY A;  1RQI A;  3ASX A;  1HM4 A;  3RMG A;  5ILJ A;  5DGS F;  1YJ4 A;  5C05 A;  2Z4V A;  4MC8 A;  4OMH A;  1YV5 A;  4LPG F;  3LGK A;  4MC3 A;  2E8U A;  5AYP A;  4LA5 A;  1YYS A;  2AZK A;  2E93 A;  3G4D A;  4RXA A;  4GP1 A;  5DZ2 A;  5ILH A;  3LK5 A;  4UMJ A;  2AEK A;  5B02 A;  4LUU A;  5CG6 A;  4E9Z A;  3N46 F;  3AQC B;  3WCD A;  2ONG A;  1VG7 A;  3WEF A;  4LZC A;  1N22 A;  3WEH A;  2H8O A;  4N1Z F;  4RXC A;  2RAH A;  5DHK A;  3SDV A;  4RNQ A;  4DEM F;  3OAB A;  2E90 A;  4KPJ A;  1JFG A;  5ERO A;  2Z52 A;  1FPS A;  3NPR A;  3N0G A;  4NG6 A;  3V1X A;  2I19 A;  5HN8 A;  4P0V A;  5EAT A;  2ZCO A;  5ILI A;  5E8H A;  1RQJ A;  3S4J A;  3WEG A;  5B0K A;  5B01 A;  5EAS A;  3S9V A;  2AEL A;  5IMI A;  3ADZ A;  2AZJ A;  3ACY A;  3SDU A;  4LFV F;  2Z4W A;  3P41 A;  4JYX A;  3W7F A;  3RBM A;  4HD1 A;  4JZX A;  5ILD A;  3OAB B;  4PVX F;  3M0G A;  1V4J A;  4F62 A;  2E8X A;  3CC9 A;  5KSX F;  4KQ5 A;  1DGP A;  3TFP A;  2Z78 A;  3LOM A;  5E8L A;  3NF2 A;  5IN8 A;  1JFA A;  3M00 A;  1VG6 A;  4JVJ F;  5ERM A;  4LTZ A;  3V1V A;  3LLW A;  3N1V F;  5DGN F;  2Z4X A;  5CG5 A;  5ERN A;  4NFK F;  1KIY A;  3ICM A;  1HXG A;  3N1W F;  2ZCS A;  3WC9 A;  3SAE A;  1DI1 A;  3P5P A;  4EA0 A;  2AZL A;  1V4K A;  3WCC A;  1WKZ A;  3VJC A;  2Q9Y A;  3RYE A;  3QQV A;  4MC0 A;  2ZCQ A;  4KQU A;  4P0X A;  1N1B A;  3MZV A;  1YYQ A;  3P8R A;  3LG5 A;  2F89 F;  3IBA A;  5HN9 A;  4KPD A;  4LZ3 A;  3WCF A;  3P5R A;  4N9U A;  3N6K F;  3N45 F;  4DWG A;  3Q2Q A;  1YHM A;  1UBY A;  1YYT A;  3ID0 A;  3SDT A;  4KUX A;  5E8K A;  3WCE A;  4LZ0 A;  1VG3 A;  3P8L A;  5B03 A;  5ILK A;  5IMN A;  1WY0 A;  3TC1 A;  3KRC A;  3WEK A;  3LMD A;  3WJO A;  4LOB A;  2QIS A;  3LGZ B;  4H5C F;  4EA2 A;  1HXC A;  2ZCR A;  4DI5 A;  5AHU B;  4QXS F;  4WK5 A;  3CP6 A;  2Q58 A;  3AQB B;  4KQS A;  2ZY1 A;  4KKM A;  5EAU A;  1YHL A;  3KRF A;  3ACX A;  3APZ A;  2E4O A;  2PS8 A;  4DZW A;  3CKE A;  4RYP A;  5DW7 A;  1UBV A;  2ZEU A;  2OPM A;  3EZ3 A;  2Q80 A;  5JV2 F;  5B0I A;  4KVW A;  3WCA A;  2AET A;  4JZB A;  1PS1 A;  3N3D A;  1EZF A;  3WCL A;  1YQ7 A;  3ZMC A;  2J5C A;  4LXW A;  3PYA A;  3KBK A;  3MAV A;  3N49 F;  3TFN A;  3KRC B;  2Z50 A;  3V66 A;  5JV0 F;  5IL3 A;  4GA3 A;  4OMG A;  1N20 A;  2F92 F;  5IK0 A;  4LPH F;  3IPI A;  2E91 A;  2E94 A;  3WCH A;  4QPF A;  3WE9 A;  2Q9Z A;  4NUA A;  3KRF B;  4NFJ F;  5DJP F;  1YHK A;  3EGT A;  1RTR A;  3BNY A;  3LSN A;  4LLS A;  4RXD A;  3UCA A;  5A0J A;  4KVD A;  1HXA A;  3M01 A;  3ZOU A;  4LLT A;  4NFI F;  2E8T A;  2J1O A;  3PKO A;  4KVI A;  5JV1 F;  3OAC A;  3KRO B;  3WSB A;  1WL1 A;  1YYR A;  1ZW5 A;  2E8W A;  3AQ0 A;  4FJQ A;  1V4H A;  3EFQ A;  3N0F A;  4KFA A;  4XQS F;  4NKF A;  3ZCD A;  4DXJ A;  1UBX A;  3LVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...