5AHUB

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-1326
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
294
structure length
294
Chain Sequence
DGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FARNESYL PYROPHOSPHATE SYNTHASE, PUTATIVE
publication title Inhibition of Trypanosoma Brucei Cell Growth by Lipophilic Bisphosphonates: An in Vitro and in Vivo Investigation.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 115
structure length 294
sequence length 294
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5ahuB00
5B0JA 2Z7IA 3QQVA 4DI5A 1HXAA 2I19A 5DHKA 3N1WF 2ONHA 5E8HA 1KIYA 2E8VA 4KFAA 4LTZA 3TFPA 3KROA 3V66A 5IMNA 4JZBA 2AELA 4KQUA 5I1UA 2PS8A 1YHMA 1WL0A 2PS4A 3UCAA 5IL8A 3PH7A 5HNAA 4JYXA 3VJ8A 3N46F 1YJ4A 2Z4XA 2AETA 4QXSF 3KB9A 2PS5A 4OKMA 3S4JA 2E8UA 4MC0A 3MAVA 3NPRA 2ZCSA 3ACWA 3ACYA 4KVDA 4NKFA 4DWBA 2F8ZF 3N1VF 3PYBA 4KWDA 2ONGA 4JXYA 5AYPA 5IM1A 4FP4A 5EASA 2ZY1A 3ZMBA 4MC8A 2E4OA 5IVGA 1N22A 4KPDA 5IK0A 2Q9ZA 1WL2A 3LG5A 4F6VA 1HM7A 2F7MF 5DGMF 5ERMA 1N1ZA 3S9VA 3WJOA 3KRFB 5DHIA 5B03A 4QPFA 3EGTA 3WCEA 4NFKF 2Z50A 3NF2A 2OPMA 3OACA 3ICZA 3SAEA 2J5CA 3PDEA 1UBXA 3N45F 3N6KF 3WCLA 2J1OA 1UBWA 3WCJA 1HX9A 4GP1A 3G4DA 3SDQA 1WL3A 3AQ0A 2Z4VA 4EA2A 3P5PA 3AE0A 4WK5A 4LPHF 3OABA 3WCIA 3LGKA 5DGSF 5KSXF 2RAHA 3LEEA 3LDWA 5ILIA 3KRPB 3EZ3A 3ICNA 5IMPA 4NKEA 4KQ5A 3LZ9A 4F62A 1V4KA 4ZQ8A 5CG6A 1HXCA 1KIZA 2E8XA 1JFGA 4EA0A 3G4FA 2Z4WA 4LFEA 3LGZB 2F8CF 4LA5A 5E8KA 3AQBB 4RNQA 3VJBA 5EATA 2EWGA 3M00A 5ERNA 5A0KA 1RQIA 3WCCA 3MZVA 3Q30A 4Q23A 5C05A 1WL1A 3CC9A 3KRAA 3V1VA 2QISA 5JUZF 3B7LA 3DYFA 4RXAA 4LFVF 3WCGA 3P5RA 3PYAA 5A0IA 3N3LF 4KK2A 4JVJF 2FORA 3ZOUA 3WJNA 3SDVA 5DGNF 3BNYA 4E9ZA 3ASXA 3WEKA 2E8WA 4LXWA 3APZA 1V4EA 3VJCA 4KVWA 4K10A 1N21A 2ZEUA 2FTZA 5E8LA 3ZL6A 3SDUA 2Z52A 1VG2A 3P41A 5B00A 4N9UA 3N0GA 3DYGA 3WE9A 5ILHA 1PS1A 2P1CA 1V4JA 2F94F 5DIQF 2Z7HA 2H8OA 4LZCA 1ZW5A 5H9DA 3M9UA 3N5JF 5ER8A 1YHKA 4P0XA 3KBKA 3LLWA 2OA6A 4H5CF 5HN7A 3SDRA 3SDTA 4RYPA 3V1XA 2E90A 5B0IA 2Z78A 4NFJF 4FJQA 3NRIA 4PVXF 4LOBA 3AQCB 4H5EF 2Q80A 5CG5A 5IKHA 4LTVA 3RBMA 4OGUA 1N20A 4EA1A 3ICMA 3OACB 2Z4YA 3DYHA 3VJ9A 5ILKA 2PS6A 3Q2QA 3Q2ZA 4NFIF 3WCBA 4KUXA 2Q9YA 1JFAA 3KRCA 5DW7A 5B0MA 3WC9A 3N49F 3CKEA 3TS7A 4DWGA 3WEJA 4LFGA 1RQJA 2PS7A 5IKAA 4LZ3A 3WEFA 3WJKA 4LIXA 3ACXA 2OGDA 5B0KA 3OABB 4XQRF 3M0GA 4RXEA 5JV0F 3PKOA 3WEIA 4KKMA 2E92A 3ICKA 1V4HA 5B0LA 3N5HF 3RYWA 3QKCA 2F92F 3ZMCA 3NPKA 5HN9A 3P8LA 1UBYA 1YYUA 1RTRA 3KRPA 1HXGA 1V4IA 3LOMA 2OPNA 1WMWA 4F6XA 3WCAA 3LJIA 5IL3A 3RYEA 1YHLA 3KRAB 3KROB 5B02A 4N1ZF 1VG7A 4KQSA 1YYTA 3EFQA 3ADZA 4LA6A 5DJVF 3TC1A 4RXDA 3N0FA 4DXJA 2VF6A 5ILDA 3WCDA 1WKZA 3BNXA 4LUUA 3OYRA 3CP6A 1WY0A 5HN8A 3ZCDA 5A0JA 1N23A 1YYRA 3VJAA 3WEGA 3WSAA 3LK5A 3IPIA 2F9KF 4DHDA 4KPJA 3VJEA 5ILZA 4HD1A 2AZJA 2AZKA 5IK6A 3LMDA 4OMHA 2AZLA 5DJPF 3VJDA 4P0VA 1EZFA 3WCFA 4MC3A 4P0WA 1YV5A 5IN8A 3TFNA 5IK9A 4PVYF 2E91A 4OMGA 1YYSA 4UMJA 4LLSA 2E93A 1FPSA 5EROA 2Q58A 4E9UA 5JA0F 4KVIA 4RXCA 3IBAA 3LSNA 3P8RA 5B01A 2Z4ZA 1DGPA 3LVSA 5DJRF 3M02A 5ILJA 3M01A 5JV2F 4OKZA 5AFXA 2E95A 5IMIA 1YYQA 4LZ0A 2AEKA 3KRFA 4H5DF 4NG6A 3RMGA 4E1EA 1VG6A 3N3DA 4L2XF 2ZCQA 4NUAA 4JXNA 5EAUA 2O1OA 4LPGF 1UBVA 3KRCB 4DEMF 4XQTF 3TFVA 2ZCRA 4GA3A 3Q1OA 3WCHA 5DZ2A 4XQSF 1DI1A 4LLTA 3WCMA 1N1BA 1N24A 3WSBA 2ZEVA 1VG4A 4KVYA 2DH4A 2E94A 2J1PA 2F89F 4GAXA 2ZCOA 4JZXA 5JV1F 3ID0A 1HM4A 3W7FA 2E8TA 3WEHA 5AELA 5AHUB 1VG3A 4DZWA 1YQ7A 4GP2A 5ILYA
chains in the Genus database with same CATH superfamily
5B0JA 2Z7IA 3QQVA 4DI5A 1HXAA 2I19A 5DHKA 3N1WF 2ONHA 5E8HA 1KIYA 2E8VA 4KFAA 4LTZA 3TFPA 3KROA 3V66A 5IMNA 4JZBA 2AELA 4KQUA 5I1UA 2PS8A 1YHMA 1WL0A 2PS4A 3UCAA 5IL8A 3PH7A 5HNAA 4JYXA 3VJ8A 3N46F 1YJ4A 2Z4XA 2AETA 4QXSF 3KB9A 2PS5A 4OKMA 3S4JA 2E8UA 4MC0A 3MAVA 3NPRA 2ZCSA 3ACWA 3ACYA 4KVDA 4NKFA 4DWBA 2F8ZF 3N1VF 3PYBA 4KWDA 2ONGA 4JXYA 5AYPA 5IM1A 4FP4A 5EASA 2ZY1A 3ZMBA 4MC8A 2E4OA 5IVGA 1N22A 4KPDA 5IK0A 2Q9ZA 1WL2A 3LG5A 4F6VA 1HM7A 2F7MF 5DGMF 5ERMA 1N1ZA 3S9VA 3WJOA 3KRFB 5DHIA 5B03A 4QPFA 3EGTA 3WCEA 4NFKF 2Z50A 3NF2A 2OPMA 3OACA 3ICZA 3SAEA 2J5CA 3PDEA 1UBXA 3N45F 3N6KF 3WCLA 2J1OA 1UBWA 3WCJA 1HX9A 4GP1A 3G4DA 3SDQA 1WL3A 3AQ0A 2Z4VA 4EA2A 3P5PA 3AE0A 4WK5A 4LPHF 3OABA 3WCIA 3LGKA 5DGSF 5KSXF 2RAHA 3LEEA 3LDWA 5ILIA 3KRPB 3EZ3A 3ICNA 5IMPA 4NKEA 4KQ5A 3LZ9A 4F62A 1V4KA 4ZQ8A 5CG6A 1HXCA 1KIZA 2E8XA 1JFGA 4EA0A 3G4FA 2Z4WA 4LFEA 3LGZB 2F8CF 4LA5A 5E8KA 3AQBB 4RNQA 3VJBA 5EATA 2EWGA 3M00A 5ERNA 5A0KA 1RQIA 3WCCA 3MZVA 3Q30A 4Q23A 5C05A 1WL1A 3CC9A 3KRAA 3V1VA 2QISA 5JUZF 3B7LA 3DYFA 4RXAA 4LFVF 3WCGA 3P5RA 3PYAA 5A0IA 3N3LF 4KK2A 4JVJF 2FORA 3ZOUA 3WJNA 3SDVA 5DGNF 3BNYA 4E9ZA 3ASXA 3WEKA 2E8WA 4LXWA 3APZA 1V4EA 3VJCA 4KVWA 4K10A 1N21A 2ZEUA 2FTZA 5E8LA 3ZL6A 3SDUA 2Z52A 1VG2A 3P41A 5B00A 4N9UA 3N0GA 3DYGA 3WE9A 5ILHA 1PS1A 2P1CA 1V4JA 2F94F 5DIQF 2Z7HA 2H8OA 4LZCA 1ZW5A 5H9DA 3M9UA 3N5JF 5ER8A 1YHKA 4P0XA 3KBKA 3LLWA 2OA6A 4H5CF 5HN7A 3SDRA 3SDTA 4RYPA 3V1XA 2E90A 5B0IA 2Z78A 4NFJF 4FJQA 3NRIA 4PVXF 4LOBA 3AQCB 4H5EF 2Q80A 5CG5A 5IKHA 4LTVA 3RBMA 4OGUA 1N20A 4EA1A 3ICMA 3OACB 2Z4YA 3DYHA 3VJ9A 5ILKA 2PS6A 3Q2QA 3Q2ZA 4NFIF 3WCBA 4KUXA 2Q9YA 1JFAA 3KRCA 5DW7A 5B0MA 3WC9A 3N49F 3CKEA 3TS7A 4DWGA 3WEJA 4LFGA 1RQJA 2PS7A 5IKAA 4LZ3A 3WEFA 3WJKA 4LIXA 3ACXA 2OGDA 5B0KA 3OABB 4XQRF 3M0GA 4RXEA 5JV0F 3PKOA 3WEIA 4KKMA 2E92A 3ICKA 1V4HA 5B0LA 3N5HF 3RYWA 3QKCA 2F92F 3ZMCA 3NPKA 5HN9A 3P8LA 1UBYA 1YYUA 1RTRA 3KRPA 1HXGA 1V4IA 3LOMA 2OPNA 1WMWA 4F6XA 3WCAA 3LJIA 5IL3A 3RYEA 1YHLA 3KRAB 3KROB 5B02A 4N1ZF 1VG7A 4KQSA 1YYTA 3EFQA 3ADZA 4LA6A 5DJVF 3TC1A 4RXDA 3N0FA 4DXJA 2VF6A 5ILDA 3WCDA 1WKZA 3BNXA 4LUUA 3OYRA 3CP6A 1WY0A 5HN8A 3ZCDA 5A0JA 1N23A 1YYRA 3VJAA 3WEGA 3WSAA 3LK5A 3IPIA 2F9KF 4DHDA 4KPJA 3VJEA 5ILZA 4HD1A 2AZJA 2AZKA 5IK6A 3LMDA 4OMHA 2AZLA 5DJPF 3VJDA 4P0VA 1EZFA 3WCFA 4MC3A 4P0WA 1YV5A 5IN8A 3TFNA 5IK9A 4PVYF 2E91A 4OMGA 1YYSA 4UMJA 4LLSA 2E93A 1FPSA 5EROA 2Q58A 4E9UA 5JA0F 4KVIA 4RXCA 3IBAA 3LSNA 3P8RA 5B01A 2Z4ZA 1DGPA 3LVSA 5DJRF 3M02A 5ILJA 3M01A 5JV2F 4OKZA 5AFXA 2E95A 5IMIA 1YYQA 4LZ0A 2AEKA 3KRFA 4H5DF 4NG6A 3RMGA 4E1EA 1VG6A 3N3DA 4L2XF 2ZCQA 4NUAA 4JXNA 5EAUA 2O1OA 4LPGF 1UBVA 3KRCB 4DEMF 4XQTF 3TFVA 2ZCRA 4GA3A 3Q1OA 3WCHA 5DZ2A 4XQSF 1DI1A 4LLTA 3WCMA 1N1BA 1N24A 3WSBA 2ZEVA 1VG4A 4KVYA 2DH4A 2E94A 2J1PA 2F89F 4GAXA 2ZCOA 4JZXA 5JV1F 3ID0A 1HM4A 3W7FA 2E8TA 3WEHA 5AELA 5AHUB 1VG3A 4DZWA 1YQ7A 4GP2A 5ILYA
chains in the Genus database with same CATH topology
5B0JA 2Z7IA 3QQVA 4DI5A 1HXAA 2I19A 5DHKA 3N1WF 2ONHA 5E8HA 1KIYA 2E8VA 4KFAA 4LTZA 3TFPA 3KROA 3V66A 5IMNA 4JZBA 2AELA 4KQUA 5I1UA 2PS8A 1YHMA 1WL0A 2PS4A 3UCAA 5IL8A 3PH7A 5HNAA 4JYXA 3VJ8A 3N46F 1YJ4A 2Z4XA 2AETA 4QXSF 3KB9A 2PS5A 4OKMA 3S4JA 2E8UA 4MC0A 3MAVA 3NPRA 2ZCSA 3ACWA 3ACYA 4KVDA 4NKFA 4DWBA 2F8ZF 3N1VF 3PYBA 4KWDA 2ONGA 4JXYA 5AYPA 5IM1A 4FP4A 5EASA 2ZY1A 3ZMBA 4MC8A 2E4OA 5IVGA 1N22A 4KPDA 5IK0A 2Q9ZA 1WL2A 3LG5A 4F6VA 1HM7A 2F7MF 5DGMF 5ERMA 1N1ZA 3S9VA 3WJOA 3KRFB 5DHIA 5B03A 4QPFA 3EGTA 3WCEA 4NFKF 2Z50A 3NF2A 2OPMA 3OACA 3ICZA 3SAEA 2J5CA 3PDEA 1UBXA 3N45F 3N6KF 3WCLA 2J1OA 1UBWA 3WCJA 1HX9A 4GP1A 3G4DA 3SDQA 1WL3A 3AQ0A 2Z4VA 4EA2A 3P5PA 3AE0A 4WK5A 4LPHF 3OABA 3WCIA 3LGKA 5DGSF 5KSXF 2RAHA 3LEEA 3LDWA 5ILIA 3KRPB 3EZ3A 3ICNA 5IMPA 4NKEA 4KQ5A 3LZ9A 4F62A 1V4KA 4ZQ8A 5CG6A 1HXCA 1KIZA 2E8XA 1JFGA 4EA0A 3G4FA 2Z4WA 4LFEA 3LGZB 2F8CF 4LA5A 5E8KA 3AQBB 4RNQA 3VJBA 5EATA 2EWGA 3M00A 5ERNA 5A0KA 1RQIA 3WCCA 3MZVA 3Q30A 4Q23A 5C05A 1WL1A 3CC9A 3KRAA 3V1VA 2QISA 5JUZF 3B7LA 3DYFA 4RXAA 4LFVF 3WCGA 3P5RA 3PYAA 5A0IA 3N3LF 4KK2A 4JVJF 2FORA 3ZOUA 3WJNA 3SDVA 5DGNF 3BNYA 4E9ZA 3ASXA 3WEKA 2E8WA 4LXWA 3APZA 1V4EA 3VJCA 4KVWA 4K10A 1N21A 2ZEUA 2FTZA 5E8LA 3ZL6A 3SDUA 2Z52A 1VG2A 3P41A 5B00A 4N9UA 3N0GA 3DYGA 3WE9A 5ILHA 1PS1A 2P1CA 1V4JA 2F94F 5DIQF 2Z7HA 2H8OA 4LZCA 1ZW5A 5H9DA 3M9UA 3N5JF 5ER8A 1YHKA 4P0XA 3KBKA 3LLWA 2OA6A 4H5CF 5HN7A 3SDRA 3SDTA 4RYPA 3V1XA 2E90A 5B0IA 2Z78A 4NFJF 4FJQA 3NRIA 4PVXF 4LOBA 3AQCB 4H5EF 2Q80A 5CG5A 5IKHA 4LTVA 3RBMA 4OGUA 1N20A 4EA1A 3ICMA 3OACB 2Z4YA 3DYHA 3VJ9A 5ILKA 2PS6A 3Q2QA 3Q2ZA 4NFIF 3WCBA 4KUXA 2Q9YA 1JFAA 3KRCA 5DW7A 5B0MA 3WC9A 3N49F 3CKEA 3TS7A 4DWGA 3WEJA 4LFGA 1RQJA 2PS7A 5IKAA 4LZ3A 3WEFA 3WJKA 4LIXA 3ACXA 2OGDA 5B0KA 3OABB 4XQRF 3M0GA 4RXEA 5JV0F 3PKOA 3WEIA 4KKMA 2E92A 3ICKA 1V4HA 5B0LA 3N5HF 3RYWA 3QKCA 2F92F 3ZMCA 3NPKA 5HN9A 3P8LA 1UBYA 1YYUA 1RTRA 3KRPA 1HXGA 1V4IA 3LOMA 2OPNA 1WMWA 4F6XA 3WCAA 3LJIA 5IL3A 3RYEA 1YHLA 3KRAB 3KROB 5B02A 4N1ZF 1VG7A 4KQSA 1YYTA 3EFQA 3ADZA 4LA6A 5DJVF 3TC1A 4RXDA 3N0FA 4DXJA 2VF6A 5ILDA 3WCDA 1WKZA 3BNXA 4LUUA 3OYRA 3CP6A 1WY0A 5HN8A 3ZCDA 5A0JA 1N23A 1YYRA 3VJAA 3WEGA 3WSAA 3LK5A 3IPIA 2F9KF 4DHDA 4KPJA 3VJEA 5ILZA 4HD1A 2AZJA 2AZKA 5IK6A 3LMDA 4OMHA 2AZLA 5DJPF 3VJDA 4P0VA 1EZFA 3WCFA 4MC3A 4P0WA 1YV5A 5IN8A 3TFNA 5IK9A 4PVYF 2E91A 4OMGA 1YYSA 4UMJA 4LLSA 2E93A 1FPSA 5EROA 2Q58A 4E9UA 5JA0F 4KVIA 4RXCA 3IBAA 3LSNA 3P8RA 5B01A 2Z4ZA 1DGPA 3LVSA 5DJRF 3M02A 5ILJA 3M01A 5JV2F 4OKZA 5AFXA 2E95A 5IMIA 1YYQA 4LZ0A 2AEKA 3KRFA 4H5DF 4NG6A 3RMGA 4E1EA 1VG6A 3N3DA 4L2XF 2ZCQA 4NUAA 4JXNA 5EAUA 2O1OA 4LPGF 1UBVA 3KRCB 4DEMF 4XQTF 3TFVA 2ZCRA 4GA3A 3Q1OA 3WCHA 5DZ2A 4XQSF 1DI1A 4LLTA 3WCMA 1N1BA 1N24A 3WSBA 2ZEVA 1VG4A 4KVYA 2DH4A 2E94A 2J1PA 2F89F 4GAXA 2ZCOA 4JZXA 5JV1F 3ID0A 1HM4A 3W7FA 2E8TA 3WEHA 5AELA 5AHUB 1VG3A 4DZWA 1YQ7A 4GP2A 5ILYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0J A;  2Z7I A;  3QQV A;  4DI5 A;  1HXA A;  2I19 A;  5DHK A;  3N1W F;  2ONH A;  5E8H A;  1KIY A;  2E8V A;  4KFA A;  4LTZ A;  3TFP A;  3KRO A;  3V66 A;  5IMN A;  4JZB A;  2AEL A;  4KQU A;  5I1U A;  2PS8 A;  1YHM A;  1WL0 A;  2PS4 A;  3UCA A;  5IL8 A;  3PH7 A;  5HNA A;  4JYX A;  3VJ8 A;  3N46 F;  1YJ4 A;  2Z4X A;  2AET A;  4QXS F;  3KB9 A;  2PS5 A;  4OKM A;  3S4J A;  2E8U A;  4MC0 A;  3MAV A;  3NPR A;  2ZCS A;  3ACW A;  3ACY A;  4KVD A;  4NKF A;  4DWB A;  2F8Z F;  3N1V F;  3PYB A;  4KWD A;  2ONG A;  4JXY A;  5AYP A;  5IM1 A;  4FP4 A;  5EAS A;  2ZY1 A;  3ZMB A;  4MC8 A;  2E4O A;  5IVG A;  1N22 A;  4KPD A;  5IK0 A;  2Q9Z A;  1WL2 A;  3LG5 A;  4F6V A;  1HM7 A;  2F7M F;  5DGM F;  5ERM A;  1N1Z A;  3S9V A;  3WJO A;  3KRF B;  5DHI A;  5B03 A;  4QPF A;  3EGT A;  3WCE A;  4NFK F;  2Z50 A;  3NF2 A;  2OPM A;  3OAC A;  3ICZ A;  3SAE A;  2J5C A;  3PDE A;  1UBX A;  3N45 F;  3N6K F;  3WCL A;  2J1O A;  1UBW A;  3WCJ A;  1HX9 A;  4GP1 A;  3G4D A;  3SDQ A;  1WL3 A;  3AQ0 A;  2Z4V A;  4EA2 A;  3P5P A;  3AE0 A;  4WK5 A;  4LPH F;  3OAB A;  3WCI A;  3LGK A;  5DGS F;  5KSX F;  2RAH A;  3LEE A;  3LDW A;  5ILI A;  3KRP B;  3EZ3 A;  3ICN A;  5IMP A;  4NKE A;  4KQ5 A;  3LZ9 A;  4F62 A;  1V4K A;  4ZQ8 A;  5CG6 A;  1HXC A;  1KIZ A;  2E8X A;  1JFG A;  4EA0 A;  3G4F A;  2Z4W A;  4LFE A;  3LGZ B;  2F8C F;  4LA5 A;  5E8K A;  3AQB B;  4RNQ A;  3VJB A;  5EAT A;  2EWG A;  3M00 A;  5ERN A;  5A0K A;  1RQI A;  3WCC A;  3MZV A;  3Q30 A;  4Q23 A;  5C05 A;  1WL1 A;  3CC9 A;  3KRA A;  3V1V A;  2QIS A;  5JUZ F;  3B7L A;  3DYF A;  4RXA A;  4LFV F;  3WCG A;  3P5R A;  3PYA A;  5A0I A;  3N3L F;  4KK2 A;  4JVJ F;  2FOR A;  3ZOU A;  3WJN A;  3SDV A;  5DGN F;  3BNY A;  4E9Z A;  3ASX A;  3WEK A;  2E8W A;  4LXW A;  3APZ A;  1V4E A;  3VJC A;  4KVW A;  4K10 A;  1N21 A;  2ZEU A;  2FTZ A;  5E8L A;  3ZL6 A;  3SDU A;  2Z52 A;  1VG2 A;  3P41 A;  5B00 A;  4N9U A;  3N0G A;  3DYG A;  3WE9 A;  5ILH A;  1PS1 A;  2P1C A;  1V4J A;  2F94 F;  5DIQ F;  2Z7H A;  2H8O A;  4LZC A;  1ZW5 A;  5H9D A;  3M9U A;  3N5J F;  5ER8 A;  1YHK A;  4P0X A;  3KBK A;  3LLW A;  2OA6 A;  4H5C F;  5HN7 A;  3SDR A;  3SDT A;  4RYP A;  3V1X A;  2E90 A;  5B0I A;  2Z78 A;  4NFJ F;  4FJQ A;  3NRI A;  4PVX F;  4LOB A;  3AQC B;  4H5E F;  2Q80 A;  5CG5 A;  5IKH A;  4LTV A;  3RBM A;  4OGU A;  1N20 A;  4EA1 A;  3ICM A;  3OAC B;  2Z4Y A;  3DYH A;  3VJ9 A;  5ILK A;  2PS6 A;  3Q2Q A;  3Q2Z A;  4NFI F;  3WCB A;  4KUX A;  2Q9Y A;  1JFA A;  3KRC A;  5DW7 A;  5B0M A;  3WC9 A;  3N49 F;  3CKE A;  3TS7 A;  4DWG A;  3WEJ A;  4LFG A;  1RQJ A;  2PS7 A;  5IKA A;  4LZ3 A;  3WEF A;  3WJK A;  4LIX A;  3ACX A;  2OGD A;  5B0K A;  3OAB B;  4XQR F;  3M0G A;  4RXE A;  5JV0 F;  3PKO A;  3WEI A;  4KKM A;  2E92 A;  3ICK A;  1V4H A;  5B0L A;  3N5H F;  3RYW A;  3QKC A;  2F92 F;  3ZMC A;  3NPK A;  5HN9 A;  3P8L A;  1UBY A;  1YYU A;  1RTR A;  3KRP A;  1HXG A;  1V4I A;  3LOM A;  2OPN A;  1WMW A;  4F6X A;  3WCA A;  3LJI A;  5IL3 A;  3RYE A;  1YHL A;  3KRA B;  3KRO B;  5B02 A;  4N1Z F;  1VG7 A;  4KQS A;  1YYT A;  3EFQ A;  3ADZ A;  4LA6 A;  5DJV F;  3TC1 A;  4RXD A;  3N0F A;  4DXJ A;  2VF6 A;  5ILD A;  3WCD A;  1WKZ A;  3BNX A;  4LUU A;  3OYR A;  3CP6 A;  1WY0 A;  5HN8 A;  3ZCD A;  5A0J A;  1N23 A;  1YYR A;  3VJA A;  3WEG A;  3WSA A;  3LK5 A;  3IPI A;  2F9K F;  4DHD A;  4KPJ A;  3VJE A;  5ILZ A;  4HD1 A;  2AZJ A;  2AZK A;  5IK6 A;  3LMD A;  4OMH A;  2AZL A;  5DJP F;  3VJD A;  4P0V A;  1EZF A;  3WCF A;  4MC3 A;  4P0W A;  1YV5 A;  5IN8 A;  3TFN A;  5IK9 A;  4PVY F;  2E91 A;  4OMG A;  1YYS A;  4UMJ A;  4LLS A;  2E93 A;  1FPS A;  5ERO A;  2Q58 A;  4E9U A;  5JA0 F;  4KVI A;  4RXC A;  3IBA A;  3LSN A;  3P8R A;  5B01 A;  2Z4Z A;  1DGP A;  3LVS A;  5DJR F;  3M02 A;  5ILJ A;  3M01 A;  5JV2 F;  4OKZ A;  5AFX A;  2E95 A;  5IMI A;  1YYQ A;  4LZ0 A;  2AEK A;  3KRF A;  4H5D F;  4NG6 A;  3RMG A;  4E1E A;  1VG6 A;  3N3D A;  4L2X F;  2ZCQ A;  4NUA A;  4JXN A;  5EAU A;  2O1O A;  4LPG F;  1UBV A;  3KRC B;  4DEM F;  4XQT F;  3TFV A;  2ZCR A;  4GA3 A;  3Q1O A;  3WCH A;  5DZ2 A;  4XQS F;  1DI1 A;  4LLT A;  3WCM A;  1N1B A;  1N24 A;  3WSB A;  2ZEV A;  1VG4 A;  4KVY A;  2DH4 A;  2E94 A;  2J1P A;  2F89 F;  4GAX A;  2ZCO A;  4JZX A;  5JV1 F;  3ID0 A;  1HM4 A;  3W7F A;  2E8T A;  3WEH A;  5AEL A;  5AHU B;  1VG3 A;  4DZW A;  1YQ7 A;  4GP2 A;  5ILY A; 
#chains in the Genus database with same CATH topology
 5B0J A;  2Z7I A;  3QQV A;  4DI5 A;  1HXA A;  2I19 A;  5DHK A;  3N1W F;  2ONH A;  5E8H A;  1KIY A;  2E8V A;  4KFA A;  4LTZ A;  3TFP A;  3KRO A;  3V66 A;  5IMN A;  4JZB A;  2AEL A;  4KQU A;  5I1U A;  2PS8 A;  1YHM A;  1WL0 A;  2PS4 A;  3UCA A;  5IL8 A;  3PH7 A;  5HNA A;  4JYX A;  3VJ8 A;  3N46 F;  1YJ4 A;  2Z4X A;  2AET A;  4QXS F;  3KB9 A;  2PS5 A;  4OKM A;  3S4J A;  2E8U A;  4MC0 A;  3MAV A;  3NPR A;  2ZCS A;  3ACW A;  3ACY A;  4KVD A;  4NKF A;  4DWB A;  2F8Z F;  3N1V F;  3PYB A;  4KWD A;  2ONG A;  4JXY A;  5AYP A;  5IM1 A;  4FP4 A;  5EAS A;  2ZY1 A;  3ZMB A;  4MC8 A;  2E4O A;  5IVG A;  1N22 A;  4KPD A;  5IK0 A;  2Q9Z A;  1WL2 A;  3LG5 A;  4F6V A;  1HM7 A;  2F7M F;  5DGM F;  5ERM A;  1N1Z A;  3S9V A;  3WJO A;  3KRF B;  5DHI A;  5B03 A;  4QPF A;  3EGT A;  3WCE A;  4NFK F;  2Z50 A;  3NF2 A;  2OPM A;  3OAC A;  3ICZ A;  3SAE A;  2J5C A;  3PDE A;  1UBX A;  3N45 F;  3N6K F;  3WCL A;  2J1O A;  1UBW A;  3WCJ A;  1HX9 A;  4GP1 A;  3G4D A;  3SDQ A;  1WL3 A;  3AQ0 A;  2Z4V A;  4EA2 A;  3P5P A;  3AE0 A;  4WK5 A;  4LPH F;  3OAB A;  3WCI A;  3LGK A;  5DGS F;  5KSX F;  2RAH A;  3LEE A;  3LDW A;  5ILI A;  3KRP B;  3EZ3 A;  3ICN A;  5IMP A;  4NKE A;  4KQ5 A;  3LZ9 A;  4F62 A;  1V4K A;  4ZQ8 A;  5CG6 A;  1HXC A;  1KIZ A;  2E8X A;  1JFG A;  4EA0 A;  3G4F A;  2Z4W A;  4LFE A;  3LGZ B;  2F8C F;  4LA5 A;  5E8K A;  3AQB B;  4RNQ A;  3VJB A;  5EAT A;  2EWG A;  3M00 A;  5ERN A;  5A0K A;  1RQI A;  3WCC A;  3MZV A;  3Q30 A;  4Q23 A;  5C05 A;  1WL1 A;  3CC9 A;  3KRA A;  3V1V A;  2QIS A;  5JUZ F;  3B7L A;  3DYF A;  4RXA A;  4LFV F;  3WCG A;  3P5R A;  3PYA A;  5A0I A;  3N3L F;  4KK2 A;  4JVJ F;  2FOR A;  3ZOU A;  3WJN A;  3SDV A;  5DGN F;  3BNY A;  4E9Z A;  3ASX A;  3WEK A;  2E8W A;  4LXW A;  3APZ A;  1V4E A;  3VJC A;  4KVW A;  4K10 A;  1N21 A;  2ZEU A;  2FTZ A;  5E8L A;  3ZL6 A;  3SDU A;  2Z52 A;  1VG2 A;  3P41 A;  5B00 A;  4N9U A;  3N0G A;  3DYG A;  3WE9 A;  5ILH A;  1PS1 A;  2P1C A;  1V4J A;  2F94 F;  5DIQ F;  2Z7H A;  2H8O A;  4LZC A;  1ZW5 A;  5H9D A;  3M9U A;  3N5J F;  5ER8 A;  1YHK A;  4P0X A;  3KBK A;  3LLW A;  2OA6 A;  4H5C F;  5HN7 A;  3SDR A;  3SDT A;  4RYP A;  3V1X A;  2E90 A;  5B0I A;  2Z78 A;  4NFJ F;  4FJQ A;  3NRI A;  4PVX F;  4LOB A;  3AQC B;  4H5E F;  2Q80 A;  5CG5 A;  5IKH A;  4LTV A;  3RBM A;  4OGU A;  1N20 A;  4EA1 A;  3ICM A;  3OAC B;  2Z4Y A;  3DYH A;  3VJ9 A;  5ILK A;  2PS6 A;  3Q2Q A;  3Q2Z A;  4NFI F;  3WCB A;  4KUX A;  2Q9Y A;  1JFA A;  3KRC A;  5DW7 A;  5B0M A;  3WC9 A;  3N49 F;  3CKE A;  3TS7 A;  4DWG A;  3WEJ A;  4LFG A;  1RQJ A;  2PS7 A;  5IKA A;  4LZ3 A;  3WEF A;  3WJK A;  4LIX A;  3ACX A;  2OGD A;  5B0K A;  3OAB B;  4XQR F;  3M0G A;  4RXE A;  5JV0 F;  3PKO A;  3WEI A;  4KKM A;  2E92 A;  3ICK A;  1V4H A;  5B0L A;  3N5H F;  3RYW A;  3QKC A;  2F92 F;  3ZMC A;  3NPK A;  5HN9 A;  3P8L A;  1UBY A;  1YYU A;  1RTR A;  3KRP A;  1HXG A;  1V4I A;  3LOM A;  2OPN A;  1WMW A;  4F6X A;  3WCA A;  3LJI A;  5IL3 A;  3RYE A;  1YHL A;  3KRA B;  3KRO B;  5B02 A;  4N1Z F;  1VG7 A;  4KQS A;  1YYT A;  3EFQ A;  3ADZ A;  4LA6 A;  5DJV F;  3TC1 A;  4RXD A;  3N0F A;  4DXJ A;  2VF6 A;  5ILD A;  3WCD A;  1WKZ A;  3BNX A;  4LUU A;  3OYR A;  3CP6 A;  1WY0 A;  5HN8 A;  3ZCD A;  5A0J A;  1N23 A;  1YYR A;  3VJA A;  3WEG A;  3WSA A;  3LK5 A;  3IPI A;  2F9K F;  4DHD A;  4KPJ A;  3VJE A;  5ILZ A;  4HD1 A;  2AZJ A;  2AZK A;  5IK6 A;  3LMD A;  4OMH A;  2AZL A;  5DJP F;  3VJD A;  4P0V A;  1EZF A;  3WCF A;  4MC3 A;  4P0W A;  1YV5 A;  5IN8 A;  3TFN A;  5IK9 A;  4PVY F;  2E91 A;  4OMG A;  1YYS A;  4UMJ A;  4LLS A;  2E93 A;  1FPS A;  5ERO A;  2Q58 A;  4E9U A;  5JA0 F;  4KVI A;  4RXC A;  3IBA A;  3LSN A;  3P8R A;  5B01 A;  2Z4Z A;  1DGP A;  3LVS A;  5DJR F;  3M02 A;  5ILJ A;  3M01 A;  5JV2 F;  4OKZ A;  5AFX A;  2E95 A;  5IMI A;  1YYQ A;  4LZ0 A;  2AEK A;  3KRF A;  4H5D F;  4NG6 A;  3RMG A;  4E1E A;  1VG6 A;  3N3D A;  4L2X F;  2ZCQ A;  4NUA A;  4JXN A;  5EAU A;  2O1O A;  4LPG F;  1UBV A;  3KRC B;  4DEM F;  4XQT F;  3TFV A;  2ZCR A;  4GA3 A;  3Q1O A;  3WCH A;  5DZ2 A;  4XQS F;  1DI1 A;  4LLT A;  3WCM A;  1N1B A;  1N24 A;  3WSB A;  2ZEV A;  1VG4 A;  4KVY A;  2DH4 A;  2E94 A;  2J1P A;  2F89 F;  4GAX A;  2ZCO A;  4JZX A;  5JV1 F;  3ID0 A;  1HM4 A;  3W7F A;  2E8T A;  3WEH A;  5AEL A;  5AHU B;  1VG3 A;  4DZW A;  1YQ7 A;  4GP2 A;  5ILY A; 
#chains in the Genus database with same CATH homology
 5B0J A;  2Z7I A;  3QQV A;  4DI5 A;  1HXA A;  2I19 A;  5DHK A;  3N1W F;  2ONH A;  5E8H A;  1KIY A;  2E8V A;  4KFA A;  4LTZ A;  3TFP A;  3KRO A;  3V66 A;  5IMN A;  4JZB A;  2AEL A;  4KQU A;  5I1U A;  2PS8 A;  1YHM A;  1WL0 A;  2PS4 A;  3UCA A;  5IL8 A;  3PH7 A;  5HNA A;  4JYX A;  3VJ8 A;  3N46 F;  1YJ4 A;  2Z4X A;  2AET A;  4QXS F;  3KB9 A;  2PS5 A;  4OKM A;  3S4J A;  2E8U A;  4MC0 A;  3MAV A;  3NPR A;  2ZCS A;  3ACW A;  3ACY A;  4KVD A;  4NKF A;  4DWB A;  2F8Z F;  3N1V F;  3PYB A;  4KWD A;  2ONG A;  4JXY A;  5AYP A;  5IM1 A;  4FP4 A;  5EAS A;  2ZY1 A;  3ZMB A;  4MC8 A;  2E4O A;  5IVG A;  1N22 A;  4KPD A;  5IK0 A;  2Q9Z A;  1WL2 A;  3LG5 A;  4F6V A;  1HM7 A;  2F7M F;  5DGM F;  5ERM A;  1N1Z A;  3S9V A;  3WJO A;  3KRF B;  5DHI A;  5B03 A;  4QPF A;  3EGT A;  3WCE A;  4NFK F;  2Z50 A;  3NF2 A;  2OPM A;  3OAC A;  3ICZ A;  3SAE A;  2J5C A;  3PDE A;  1UBX A;  3N45 F;  3N6K F;  3WCL A;  2J1O A;  1UBW A;  3WCJ A;  1HX9 A;  4GP1 A;  3G4D A;  3SDQ A;  1WL3 A;  3AQ0 A;  2Z4V A;  4EA2 A;  3P5P A;  3AE0 A;  4WK5 A;  4LPH F;  3OAB A;  3WCI A;  3LGK A;  5DGS F;  5KSX F;  2RAH A;  3LEE A;  3LDW A;  5ILI A;  3KRP B;  3EZ3 A;  3ICN A;  5IMP A;  4NKE A;  4KQ5 A;  3LZ9 A;  4F62 A;  1V4K A;  4ZQ8 A;  5CG6 A;  1HXC A;  1KIZ A;  2E8X A;  1JFG A;  4EA0 A;  3G4F A;  2Z4W A;  4LFE A;  3LGZ B;  2F8C F;  4LA5 A;  5E8K A;  3AQB B;  4RNQ A;  3VJB A;  5EAT A;  2EWG A;  3M00 A;  5ERN A;  5A0K A;  1RQI A;  3WCC A;  3MZV A;  3Q30 A;  4Q23 A;  5C05 A;  1WL1 A;  3CC9 A;  3KRA A;  3V1V A;  2QIS A;  5JUZ F;  3B7L A;  3DYF A;  4RXA A;  4LFV F;  3WCG A;  3P5R A;  3PYA A;  5A0I A;  3N3L F;  4KK2 A;  4JVJ F;  2FOR A;  3ZOU A;  3WJN A;  3SDV A;  5DGN F;  3BNY A;  4E9Z A;  3ASX A;  3WEK A;  2E8W A;  4LXW A;  3APZ A;  1V4E A;  3VJC A;  4KVW A;  4K10 A;  1N21 A;  2ZEU A;  2FTZ A;  5E8L A;  3ZL6 A;  3SDU A;  2Z52 A;  1VG2 A;  3P41 A;  5B00 A;  4N9U A;  3N0G A;  3DYG A;  3WE9 A;  5ILH A;  1PS1 A;  2P1C A;  1V4J A;  2F94 F;  5DIQ F;  2Z7H A;  2H8O A;  4LZC A;  1ZW5 A;  5H9D A;  3M9U A;  3N5J F;  5ER8 A;  1YHK A;  4P0X A;  3KBK A;  3LLW A;  2OA6 A;  4H5C F;  5HN7 A;  3SDR A;  3SDT A;  4RYP A;  3V1X A;  2E90 A;  5B0I A;  2Z78 A;  4NFJ F;  4FJQ A;  3NRI A;  4PVX F;  4LOB A;  3AQC B;  4H5E F;  2Q80 A;  5CG5 A;  5IKH A;  4LTV A;  3RBM A;  4OGU A;  1N20 A;  4EA1 A;  3ICM A;  3OAC B;  2Z4Y A;  3DYH A;  3VJ9 A;  5ILK A;  2PS6 A;  3Q2Q A;  3Q2Z A;  4NFI F;  3WCB A;  4KUX A;  2Q9Y A;  1JFA A;  3KRC A;  5DW7 A;  5B0M A;  3WC9 A;  3N49 F;  3CKE A;  3TS7 A;  4DWG A;  3WEJ A;  4LFG A;  1RQJ A;  2PS7 A;  5IKA A;  4LZ3 A;  3WEF A;  3WJK A;  4LIX A;  3ACX A;  2OGD A;  5B0K A;  3OAB B;  4XQR F;  3M0G A;  4RXE A;  5JV0 F;  3PKO A;  3WEI A;  4KKM A;  2E92 A;  3ICK A;  1V4H A;  5B0L A;  3N5H F;  3RYW A;  3QKC A;  2F92 F;  3ZMC A;  3NPK A;  5HN9 A;  3P8L A;  1UBY A;  1YYU A;  1RTR A;  3KRP A;  1HXG A;  1V4I A;  3LOM A;  2OPN A;  1WMW A;  4F6X A;  3WCA A;  3LJI A;  5IL3 A;  3RYE A;  1YHL A;  3KRA B;  3KRO B;  5B02 A;  4N1Z F;  1VG7 A;  4KQS A;  1YYT A;  3EFQ A;  3ADZ A;  4LA6 A;  5DJV F;  3TC1 A;  4RXD A;  3N0F A;  4DXJ A;  2VF6 A;  5ILD A;  3WCD A;  1WKZ A;  3BNX A;  4LUU A;  3OYR A;  3CP6 A;  1WY0 A;  5HN8 A;  3ZCD A;  5A0J A;  1N23 A;  1YYR A;  3VJA A;  3WEG A;  3WSA A;  3LK5 A;  3IPI A;  2F9K F;  4DHD A;  4KPJ A;  3VJE A;  5ILZ A;  4HD1 A;  2AZJ A;  2AZK A;  5IK6 A;  3LMD A;  4OMH A;  2AZL A;  5DJP F;  3VJD A;  4P0V A;  1EZF A;  3WCF A;  4MC3 A;  4P0W A;  1YV5 A;  5IN8 A;  3TFN A;  5IK9 A;  4PVY F;  2E91 A;  4OMG A;  1YYS A;  4UMJ A;  4LLS A;  2E93 A;  1FPS A;  5ERO A;  2Q58 A;  4E9U A;  5JA0 F;  4KVI A;  4RXC A;  3IBA A;  3LSN A;  3P8R A;  5B01 A;  2Z4Z A;  1DGP A;  3LVS A;  5DJR F;  3M02 A;  5ILJ A;  3M01 A;  5JV2 F;  4OKZ A;  5AFX A;  2E95 A;  5IMI A;  1YYQ A;  4LZ0 A;  2AEK A;  3KRF A;  4H5D F;  4NG6 A;  3RMG A;  4E1E A;  1VG6 A;  3N3D A;  4L2X F;  2ZCQ A;  4NUA A;  4JXN A;  5EAU A;  2O1O A;  4LPG F;  1UBV A;  3KRC B;  4DEM F;  4XQT F;  3TFV A;  2ZCR A;  4GA3 A;  3Q1O A;  3WCH A;  5DZ2 A;  4XQS F;  1DI1 A;  4LLT A;  3WCM A;  1N1B A;  1N24 A;  3WSB A;  2ZEV A;  1VG4 A;  4KVY A;  2DH4 A;  2E94 A;  2J1P A;  2F89 F;  4GAX A;  2ZCO A;  4JZX A;  5JV1 F;  3ID0 A;  1HM4 A;  3W7F A;  2E8T A;  3WEH A;  5AEL A;  5AHU B;  1VG3 A;  4DZW A;  1YQ7 A;  4GP2 A;  5ILY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...