3WE9A

The crystal structure of yisp from bacillus subtilis subsp. subtilis strain 168
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
272
structure length
247
Chain Sequence
IHRSEKMKEIKEAYQQCGQIVGEYAPACFKALSYLPLKQRQASWAVLSFCHTAASHLWKAFDHAYRTFTLESEPFREFIAAQKEDAKPYDDLDELLMYAYRTGGAAGLMLLPILTRRKQDQLKQAAVSLGLAIQLVRFLSDLGTDQQKNRIPRQVMQQFGYTEADLQKGTVNKAFTMTWEYIAFEAEAYLEECQDALPLFPQYSQKTVKAALHLHRAVLEKIRAKQHDVFQYHFALTETEVKQILSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative phytoene/squalene synthase YisP
publication title Crystal structure of Bacillus subtilis YisP in complex with a PEG fragment
rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 94
structure length 247
sequence length 272
ec nomenclature ec 2.5.1.-:
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3we9A00
1JFGA 1YYRA 3WJKA 3ZCDA 1HX9A 2Z52A 3V1XA 3ICMA 4EA0A 5IK0A 4E9UA 1N1ZA 4KVIA 1VG6A 4KPDA 1KIYA 5EASA 4RYPA 5AYPA 3WCBA 3ACWA 5IMIA 3P8LA 3IBAA 3VJEA 3WCFA 2PS6A 3WEIA 4ZQ8A 4LLTA 4L2XF 3P41A 4NG6A 4LOBA 5JA0F 3M0GA 3QQVA 3NPKA 5IK9A 1N22A 3ICZA 3RYEA 4HD1A 3LG5A 3DYFA 4LUUA 5IL3A 3WCLA 5B0IA 3KROA 4LZCA 3ADZA 3LJIA 1VG2A 4KKMA 1N24A 2QISA 2J1OA 4OGUA 5I1UA 1RTRA 4XQSF 5DHKA 4KVYA 3LOMA 3VJCA 3SDRA 2ZEVA 3AE0A 4DEMF 4RNQA 3G4DA 3NPRA 3RMGA 2F9KF 2ONGA 4MC3A 3N5JF 3PDEA 3WCIA 4KPJA 3P8RA 3LGZB 3DYHA 4RXCA 3EGTA 3LGKA 4LIXA 5ILKA 1YYUA 2F7MF 3ZMBA 5E8LA 3N3LF 4LPHF 1WY0A 3SDQA 4KQUA 5DW7A 4DI5A 5HNAA 4WK5A 4DXJA 4LPGF 3EFQA 3OABB 3SDUA 1YJ4A 5IN8A 3SDVA 1FPSA 2FTZA 3N6KF 4EA2A 3PH7A 2E91A 2Q80A 3WC9A 1UBYA 1PS1A 5DIQF 3WCGA 5DJPF 5B03A 5JUZF 3VJAA 4GAXA 1HXCA 5IKAA 2Q9YA 4GP2A 3N5HF 2PS8A 4KVDA 2AEKA 2ZCRA 3WCEA 5JV2F 1UBXA 2ZCSA 3ID0A 3WEGA 1UBVA 3Q2QA 3WE9A 3M9UA 3ZOUA 1VG7A 4KQSA 2OPNA 3VJ9A 3ICKA 3PKOA 4DHDA 5B01A 3NRIA 5DJRF 4LA5A 5DZ2A 4DWGA 2Q9ZA 4OMGA 1YHMA 5IL8A 1UBWA 2P1CA 5JV0F 2Z4WA 4MC0A 5ILYA 4NFJF 5HN9A 3LSNA 3RBMA 1JFAA 1V4KA 3TS7A 2E92A 2OGDA 4NFIF 4Q23A 2PS7A 4KQ5A 4P0XA 5IVGA 2E93A 3LMDA 3CC9A 3TC1A 5EROA 2AELA 2F92F 2Z4ZA 3LDWA 5IK6A 3Q2ZA 4LFEA 3WCDA 5HN7A 4LZ3A 1YYQA 3N45F 5IMNA 3WEKA 3P5RA 2AZLA 1V4JA 3WCCA 1YHKA 2AZJA 3N46F 5DGSF 3Q1OA 4F6XA 5ILIA 3BNYA 3ICNA 4E1EA 3N3DA 4LTVA 2AZKA 5ILZA 4UMJA 2F8ZF 3KRCB 3ACXA 5H9DA 1WKZA 3W7FA 4JZBA 2Z78A 2I19A 5A0KA 1WL0A 2E94A 1N23A 3IPIA 3VJDA 2J1PA 3KRPB 5B0KA 3PYAA 2E8UA 4OKZA 4LTZA 3WSBA 4OMHA 4N9UA 3M00A 3MZVA 1VG4A 2H8OA 3N1VF 4JXNA 2Z50A 2AETA 5E8KA 1ZW5A 3KB9A 5ERMA 3TFPA 1YHLA 3DYGA 2PS4A 4NKFA 1N20A 4JXYA 2E90A 2OA6A 3WCMA 3AQCB 3KRFB 4KK2A 1RQIA 4RXEA 1RQJA 3KRAB 1V4IA 3LVSA 2E8TA 4QPFA 3V66A 1V4HA 1V4EA 5EAUA 3OACB 2J5CA 2E8XA 2Z4VA 3M01A 3AQ0A 2Z4YA 3OYRA 3TFNA 5KSXF 2Z7IA 3ASXA 5B00A 4P0WA 3N1WF 5DJVF 4EA1A 4GA3A 2E8WA 3LK5A 4E9ZA 2VF6A 3WSAA 3CKEA 3PYBA 5ILJA 5B02A 3LEEA 3N0GA 3ZL6A 5CG5A 1DGPA 4OKMA 3N0FA 5IKHA 4N1ZF 2ONHA 4FP4A 5B0JA 5E8HA 2O1OA 2ZEUA 2PS5A 5CG6A 4H5CF 4NUAA 3S4JA 5C05A 4NKEA 3WJNA 4H5EF 2OPMA 3BNXA 4JZXA 3WCAA 3AQBB 4P0VA 4FJQA 1YQ7A 4QXSF 3S9VA 1WL1A 4RXDA 3UCAA 3VJBA 3KRCA 4KFAA 3WEHA 1N1BA 1HM4A 2RAHA 2FORA 3WCHA 4MC8A 3VJ8A 2Z4XA 4NFKF 3KRPA 4DWBA 2ZY1A 3V1VA 5A0IA 4LXWA 4F6VA 3MAVA 5AHUB 5ILHA 4PVYF 5JV1F 3G4FA 5A0JA 2F8CF 3OABA 1YYTA 3EZ3A 3LLWA 4LZ0A 1EZFA 3ACYA 3QKCA 2ZCOA 5ERNA 1HXAA 3N49F 3KROB 5B0LA 3WEJA 5DGMF 2Q58A 5DGNF 2Z7HA 3LZ9A 5HN8A 1WL2A 4KVWA 5EATA 4RXAA 1YV5A 4F62A 4KWDA 3KRFA 3WJOA 3APZA 3CP6A 3KRAA 2DH4A 1VG3A 4H5DF 1N21A 3OACA 4XQTF 5DHIA 2ZCQA 3SAEA 1HXGA 1HM7A 1WL3A 1WMWA 3WCJA 3NF2A 4LA6A 3SDTA 4LFVF 4DZWA 5B0MA 3RYWA 4JVJF 3M02A 4JYXA 4LFGA 1KIZA 3WEFA 3ZMCA 4LLSA 1YYSA 2E8VA 2E4OA 3P5PA 2F94F 2E95A 4GP1A 2F89F 4KUXA 4PVXF 5ILDA 5ER8A 4XQRF 3Q30A 3B7LA 3KBKA 5AELA 4K10A 5AFXA 3TFVA 1DI1A 5IMPA 2EWGA 5IM1A
chains in the Genus database with same CATH superfamily
1JFGA 1YYRA 3WJKA 3ZCDA 1HX9A 2Z52A 3V1XA 3ICMA 4EA0A 5IK0A 4E9UA 1N1ZA 4KVIA 1VG6A 4KPDA 1KIYA 5EASA 4RYPA 5AYPA 3WCBA 3ACWA 5IMIA 3P8LA 3IBAA 3VJEA 3WCFA 2PS6A 3WEIA 4ZQ8A 4LLTA 4L2XF 3P41A 4NG6A 4LOBA 5JA0F 3M0GA 3QQVA 3NPKA 5IK9A 1N22A 3ICZA 3RYEA 4HD1A 3LG5A 3DYFA 4LUUA 5IL3A 3WCLA 5B0IA 3KROA 4LZCA 3ADZA 3LJIA 1VG2A 4KKMA 1N24A 2QISA 2J1OA 4OGUA 5I1UA 1RTRA 4XQSF 5DHKA 4KVYA 3LOMA 3VJCA 3SDRA 2ZEVA 3AE0A 4DEMF 4RNQA 3G4DA 3NPRA 3RMGA 2F9KF 2ONGA 4MC3A 3N5JF 3PDEA 3WCIA 4KPJA 3P8RA 3LGZB 3DYHA 4RXCA 3EGTA 3LGKA 4LIXA 5ILKA 1YYUA 2F7MF 3ZMBA 5E8LA 3N3LF 4LPHF 1WY0A 3SDQA 4KQUA 5DW7A 4DI5A 5HNAA 4WK5A 4DXJA 4LPGF 3EFQA 3OABB 3SDUA 1YJ4A 5IN8A 3SDVA 1FPSA 2FTZA 3N6KF 4EA2A 3PH7A 2E91A 2Q80A 3WC9A 1UBYA 1PS1A 5DIQF 3WCGA 5DJPF 5B03A 5JUZF 3VJAA 4GAXA 1HXCA 5IKAA 2Q9YA 4GP2A 3N5HF 2PS8A 4KVDA 2AEKA 2ZCRA 3WCEA 5JV2F 1UBXA 2ZCSA 3ID0A 3WEGA 1UBVA 3Q2QA 3WE9A 3M9UA 3ZOUA 1VG7A 4KQSA 2OPNA 3VJ9A 3ICKA 3PKOA 4DHDA 5B01A 3NRIA 5DJRF 4LA5A 5DZ2A 4DWGA 2Q9ZA 4OMGA 1YHMA 5IL8A 1UBWA 2P1CA 5JV0F 2Z4WA 4MC0A 5ILYA 4NFJF 5HN9A 3LSNA 3RBMA 1JFAA 1V4KA 3TS7A 2E92A 2OGDA 4NFIF 4Q23A 2PS7A 4KQ5A 4P0XA 5IVGA 2E93A 3LMDA 3CC9A 3TC1A 5EROA 2AELA 2F92F 2Z4ZA 3LDWA 5IK6A 3Q2ZA 4LFEA 3WCDA 5HN7A 4LZ3A 1YYQA 3N45F 5IMNA 3WEKA 3P5RA 2AZLA 1V4JA 3WCCA 1YHKA 2AZJA 3N46F 5DGSF 3Q1OA 4F6XA 5ILIA 3BNYA 3ICNA 4E1EA 3N3DA 4LTVA 2AZKA 5ILZA 4UMJA 2F8ZF 3KRCB 3ACXA 5H9DA 1WKZA 3W7FA 4JZBA 2Z78A 2I19A 5A0KA 1WL0A 2E94A 1N23A 3IPIA 3VJDA 2J1PA 3KRPB 5B0KA 3PYAA 2E8UA 4OKZA 4LTZA 3WSBA 4OMHA 4N9UA 3M00A 3MZVA 1VG4A 2H8OA 3N1VF 4JXNA 2Z50A 2AETA 5E8KA 1ZW5A 3KB9A 5ERMA 3TFPA 1YHLA 3DYGA 2PS4A 4NKFA 1N20A 4JXYA 2E90A 2OA6A 3WCMA 3AQCB 3KRFB 4KK2A 1RQIA 4RXEA 1RQJA 3KRAB 1V4IA 3LVSA 2E8TA 4QPFA 3V66A 1V4HA 1V4EA 5EAUA 3OACB 2J5CA 2E8XA 2Z4VA 3M01A 3AQ0A 2Z4YA 3OYRA 3TFNA 5KSXF 2Z7IA 3ASXA 5B00A 4P0WA 3N1WF 5DJVF 4EA1A 4GA3A 2E8WA 3LK5A 4E9ZA 2VF6A 3WSAA 3CKEA 3PYBA 5ILJA 5B02A 3LEEA 3N0GA 3ZL6A 5CG5A 1DGPA 4OKMA 3N0FA 5IKHA 4N1ZF 2ONHA 4FP4A 5B0JA 5E8HA 2O1OA 2ZEUA 2PS5A 5CG6A 4H5CF 4NUAA 3S4JA 5C05A 4NKEA 3WJNA 4H5EF 2OPMA 3BNXA 4JZXA 3WCAA 3AQBB 4P0VA 4FJQA 1YQ7A 4QXSF 3S9VA 1WL1A 4RXDA 3UCAA 3VJBA 3KRCA 4KFAA 3WEHA 1N1BA 1HM4A 2RAHA 2FORA 3WCHA 4MC8A 3VJ8A 2Z4XA 4NFKF 3KRPA 4DWBA 2ZY1A 3V1VA 5A0IA 4LXWA 4F6VA 3MAVA 5AHUB 5ILHA 4PVYF 5JV1F 3G4FA 5A0JA 2F8CF 3OABA 1YYTA 3EZ3A 3LLWA 4LZ0A 1EZFA 3ACYA 3QKCA 2ZCOA 5ERNA 1HXAA 3N49F 3KROB 5B0LA 3WEJA 5DGMF 2Q58A 5DGNF 2Z7HA 3LZ9A 5HN8A 1WL2A 4KVWA 5EATA 4RXAA 1YV5A 4F62A 4KWDA 3KRFA 3WJOA 3APZA 3CP6A 3KRAA 2DH4A 1VG3A 4H5DF 1N21A 3OACA 4XQTF 5DHIA 2ZCQA 3SAEA 1HXGA 1HM7A 1WL3A 1WMWA 3WCJA 3NF2A 4LA6A 3SDTA 4LFVF 4DZWA 5B0MA 3RYWA 4JVJF 3M02A 4JYXA 4LFGA 1KIZA 3WEFA 3ZMCA 4LLSA 1YYSA 2E8VA 2E4OA 3P5PA 2F94F 2E95A 4GP1A 2F89F 4KUXA 4PVXF 5ILDA 5ER8A 4XQRF 3Q30A 3B7LA 3KBKA 5AELA 4K10A 5AFXA 3TFVA 1DI1A 5IMPA 2EWGA 5IM1A
chains in the Genus database with same CATH topology
1JFGA 1YYRA 3WJKA 3ZCDA 1HX9A 2Z52A 3V1XA 3ICMA 4EA0A 5IK0A 4E9UA 1N1ZA 4KVIA 1VG6A 4KPDA 1KIYA 5EASA 4RYPA 5AYPA 3WCBA 3ACWA 5IMIA 3P8LA 3IBAA 3VJEA 3WCFA 2PS6A 3WEIA 4ZQ8A 4LLTA 4L2XF 3P41A 4NG6A 4LOBA 5JA0F 3M0GA 3QQVA 3NPKA 5IK9A 1N22A 3ICZA 3RYEA 4HD1A 3LG5A 3DYFA 4LUUA 5IL3A 3WCLA 5B0IA 3KROA 4LZCA 3ADZA 3LJIA 1VG2A 4KKMA 1N24A 2QISA 2J1OA 4OGUA 5I1UA 1RTRA 4XQSF 5DHKA 4KVYA 3LOMA 3VJCA 3SDRA 2ZEVA 3AE0A 4DEMF 4RNQA 3G4DA 3NPRA 3RMGA 2F9KF 2ONGA 4MC3A 3N5JF 3PDEA 3WCIA 4KPJA 3P8RA 3LGZB 3DYHA 4RXCA 3EGTA 3LGKA 4LIXA 5ILKA 1YYUA 2F7MF 3ZMBA 5E8LA 3N3LF 4LPHF 1WY0A 3SDQA 4KQUA 5DW7A 4DI5A 5HNAA 4WK5A 4DXJA 4LPGF 3EFQA 3OABB 3SDUA 1YJ4A 5IN8A 3SDVA 1FPSA 2FTZA 3N6KF 4EA2A 3PH7A 2E91A 2Q80A 3WC9A 1UBYA 1PS1A 5DIQF 3WCGA 5DJPF 5B03A 5JUZF 3VJAA 4GAXA 1HXCA 5IKAA 2Q9YA 4GP2A 3N5HF 2PS8A 4KVDA 2AEKA 2ZCRA 3WCEA 5JV2F 1UBXA 2ZCSA 3ID0A 3WEGA 1UBVA 3Q2QA 3WE9A 3M9UA 3ZOUA 1VG7A 4KQSA 2OPNA 3VJ9A 3ICKA 3PKOA 4DHDA 5B01A 3NRIA 5DJRF 4LA5A 5DZ2A 4DWGA 2Q9ZA 4OMGA 1YHMA 5IL8A 1UBWA 2P1CA 5JV0F 2Z4WA 4MC0A 5ILYA 4NFJF 5HN9A 3LSNA 3RBMA 1JFAA 1V4KA 3TS7A 2E92A 2OGDA 4NFIF 4Q23A 2PS7A 4KQ5A 4P0XA 5IVGA 2E93A 3LMDA 3CC9A 3TC1A 5EROA 2AELA 2F92F 2Z4ZA 3LDWA 5IK6A 3Q2ZA 4LFEA 3WCDA 5HN7A 4LZ3A 1YYQA 3N45F 5IMNA 3WEKA 3P5RA 2AZLA 1V4JA 3WCCA 1YHKA 2AZJA 3N46F 5DGSF 3Q1OA 4F6XA 5ILIA 3BNYA 3ICNA 4E1EA 3N3DA 4LTVA 2AZKA 5ILZA 4UMJA 2F8ZF 3KRCB 3ACXA 5H9DA 1WKZA 3W7FA 4JZBA 2Z78A 2I19A 5A0KA 1WL0A 2E94A 1N23A 3IPIA 3VJDA 2J1PA 3KRPB 5B0KA 3PYAA 2E8UA 4OKZA 4LTZA 3WSBA 4OMHA 4N9UA 3M00A 3MZVA 1VG4A 2H8OA 3N1VF 4JXNA 2Z50A 2AETA 5E8KA 1ZW5A 3KB9A 5ERMA 3TFPA 1YHLA 3DYGA 2PS4A 4NKFA 1N20A 4JXYA 2E90A 2OA6A 3WCMA 3AQCB 3KRFB 4KK2A 1RQIA 4RXEA 1RQJA 3KRAB 1V4IA 3LVSA 2E8TA 4QPFA 3V66A 1V4HA 1V4EA 5EAUA 3OACB 2J5CA 2E8XA 2Z4VA 3M01A 3AQ0A 2Z4YA 3OYRA 3TFNA 5KSXF 2Z7IA 3ASXA 5B00A 4P0WA 3N1WF 5DJVF 4EA1A 4GA3A 2E8WA 3LK5A 4E9ZA 2VF6A 3WSAA 3CKEA 3PYBA 5ILJA 5B02A 3LEEA 3N0GA 3ZL6A 5CG5A 1DGPA 4OKMA 3N0FA 5IKHA 4N1ZF 2ONHA 4FP4A 5B0JA 5E8HA 2O1OA 2ZEUA 2PS5A 5CG6A 4H5CF 4NUAA 3S4JA 5C05A 4NKEA 3WJNA 4H5EF 2OPMA 3BNXA 4JZXA 3WCAA 3AQBB 4P0VA 4FJQA 1YQ7A 4QXSF 3S9VA 1WL1A 4RXDA 3UCAA 3VJBA 3KRCA 4KFAA 3WEHA 1N1BA 1HM4A 2RAHA 2FORA 3WCHA 4MC8A 3VJ8A 2Z4XA 4NFKF 3KRPA 4DWBA 2ZY1A 3V1VA 5A0IA 4LXWA 4F6VA 3MAVA 5AHUB 5ILHA 4PVYF 5JV1F 3G4FA 5A0JA 2F8CF 3OABA 1YYTA 3EZ3A 3LLWA 4LZ0A 1EZFA 3ACYA 3QKCA 2ZCOA 5ERNA 1HXAA 3N49F 3KROB 5B0LA 3WEJA 5DGMF 2Q58A 5DGNF 2Z7HA 3LZ9A 5HN8A 1WL2A 4KVWA 5EATA 4RXAA 1YV5A 4F62A 4KWDA 3KRFA 3WJOA 3APZA 3CP6A 3KRAA 2DH4A 1VG3A 4H5DF 1N21A 3OACA 4XQTF 5DHIA 2ZCQA 3SAEA 1HXGA 1HM7A 1WL3A 1WMWA 3WCJA 3NF2A 4LA6A 3SDTA 4LFVF 4DZWA 5B0MA 3RYWA 4JVJF 3M02A 4JYXA 4LFGA 1KIZA 3WEFA 3ZMCA 4LLSA 1YYSA 2E8VA 2E4OA 3P5PA 2F94F 2E95A 4GP1A 2F89F 4KUXA 4PVXF 5ILDA 5ER8A 4XQRF 3Q30A 3B7LA 3KBKA 5AELA 4K10A 5AFXA 3TFVA 1DI1A 5IMPA 2EWGA 5IM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFG A;  1YYR A;  3WJK A;  3ZCD A;  1HX9 A;  2Z52 A;  3V1X A;  3ICM A;  4EA0 A;  5IK0 A;  4E9U A;  1N1Z A;  4KVI A;  1VG6 A;  4KPD A;  1KIY A;  5EAS A;  4RYP A;  5AYP A;  3WCB A;  3ACW A;  5IMI A;  3P8L A;  3IBA A;  3VJE A;  3WCF A;  2PS6 A;  3WEI A;  4ZQ8 A;  4LLT A;  4L2X F;  3P41 A;  4NG6 A;  4LOB A;  5JA0 F;  3M0G A;  3QQV A;  3NPK A;  5IK9 A;  1N22 A;  3ICZ A;  3RYE A;  4HD1 A;  3LG5 A;  3DYF A;  4LUU A;  5IL3 A;  3WCL A;  5B0I A;  3KRO A;  4LZC A;  3ADZ A;  3LJI A;  1VG2 A;  4KKM A;  1N24 A;  2QIS A;  2J1O A;  4OGU A;  5I1U A;  1RTR A;  4XQS F;  5DHK A;  4KVY A;  3LOM A;  3VJC A;  3SDR A;  2ZEV A;  3AE0 A;  4DEM F;  4RNQ A;  3G4D A;  3NPR A;  3RMG A;  2F9K F;  2ONG A;  4MC3 A;  3N5J F;  3PDE A;  3WCI A;  4KPJ A;  3P8R A;  3LGZ B;  3DYH A;  4RXC A;  3EGT A;  3LGK A;  4LIX A;  5ILK A;  1YYU A;  2F7M F;  3ZMB A;  5E8L A;  3N3L F;  4LPH F;  1WY0 A;  3SDQ A;  4KQU A;  5DW7 A;  4DI5 A;  5HNA A;  4WK5 A;  4DXJ A;  4LPG F;  3EFQ A;  3OAB B;  3SDU A;  1YJ4 A;  5IN8 A;  3SDV A;  1FPS A;  2FTZ A;  3N6K F;  4EA2 A;  3PH7 A;  2E91 A;  2Q80 A;  3WC9 A;  1UBY A;  1PS1 A;  5DIQ F;  3WCG A;  5DJP F;  5B03 A;  5JUZ F;  3VJA A;  4GAX A;  1HXC A;  5IKA A;  2Q9Y A;  4GP2 A;  3N5H F;  2PS8 A;  4KVD A;  2AEK A;  2ZCR A;  3WCE A;  5JV2 F;  1UBX A;  2ZCS A;  3ID0 A;  3WEG A;  1UBV A;  3Q2Q A;  3WE9 A;  3M9U A;  3ZOU A;  1VG7 A;  4KQS A;  2OPN A;  3VJ9 A;  3ICK A;  3PKO A;  4DHD A;  5B01 A;  3NRI A;  5DJR F;  4LA5 A;  5DZ2 A;  4DWG A;  2Q9Z A;  4OMG A;  1YHM A;  5IL8 A;  1UBW A;  2P1C A;  5JV0 F;  2Z4W A;  4MC0 A;  5ILY A;  4NFJ F;  5HN9 A;  3LSN A;  3RBM A;  1JFA A;  1V4K A;  3TS7 A;  2E92 A;  2OGD A;  4NFI F;  4Q23 A;  2PS7 A;  4KQ5 A;  4P0X A;  5IVG A;  2E93 A;  3LMD A;  3CC9 A;  3TC1 A;  5ERO A;  2AEL A;  2F92 F;  2Z4Z A;  3LDW A;  5IK6 A;  3Q2Z A;  4LFE A;  3WCD A;  5HN7 A;  4LZ3 A;  1YYQ A;  3N45 F;  5IMN A;  3WEK A;  3P5R A;  2AZL A;  1V4J A;  3WCC A;  1YHK A;  2AZJ A;  3N46 F;  5DGS F;  3Q1O A;  4F6X A;  5ILI A;  3BNY A;  3ICN A;  4E1E A;  3N3D A;  4LTV A;  2AZK A;  5ILZ A;  4UMJ A;  2F8Z F;  3KRC B;  3ACX A;  5H9D A;  1WKZ A;  3W7F A;  4JZB A;  2Z78 A;  2I19 A;  5A0K A;  1WL0 A;  2E94 A;  1N23 A;  3IPI A;  3VJD A;  2J1P A;  3KRP B;  5B0K A;  3PYA A;  2E8U A;  4OKZ A;  4LTZ A;  3WSB A;  4OMH A;  4N9U A;  3M00 A;  3MZV A;  1VG4 A;  2H8O A;  3N1V F;  4JXN A;  2Z50 A;  2AET A;  5E8K A;  1ZW5 A;  3KB9 A;  5ERM A;  3TFP A;  1YHL A;  3DYG A;  2PS4 A;  4NKF A;  1N20 A;  4JXY A;  2E90 A;  2OA6 A;  3WCM A;  3AQC B;  3KRF B;  4KK2 A;  1RQI A;  4RXE A;  1RQJ A;  3KRA B;  1V4I A;  3LVS A;  2E8T A;  4QPF A;  3V66 A;  1V4H A;  1V4E A;  5EAU A;  3OAC B;  2J5C A;  2E8X A;  2Z4V A;  3M01 A;  3AQ0 A;  2Z4Y A;  3OYR A;  3TFN A;  5KSX F;  2Z7I A;  3ASX A;  5B00 A;  4P0W A;  3N1W F;  5DJV F;  4EA1 A;  4GA3 A;  2E8W A;  3LK5 A;  4E9Z A;  2VF6 A;  3WSA A;  3CKE A;  3PYB A;  5ILJ A;  5B02 A;  3LEE A;  3N0G A;  3ZL6 A;  5CG5 A;  1DGP A;  4OKM A;  3N0F A;  5IKH A;  4N1Z F;  2ONH A;  4FP4 A;  5B0J A;  5E8H A;  2O1O A;  2ZEU A;  2PS5 A;  5CG6 A;  4H5C F;  4NUA A;  3S4J A;  5C05 A;  4NKE A;  3WJN A;  4H5E F;  2OPM A;  3BNX A;  4JZX A;  3WCA A;  3AQB B;  4P0V A;  4FJQ A;  1YQ7 A;  4QXS F;  3S9V A;  1WL1 A;  4RXD A;  3UCA A;  3VJB A;  3KRC A;  4KFA A;  3WEH A;  1N1B A;  1HM4 A;  2RAH A;  2FOR A;  3WCH A;  4MC8 A;  3VJ8 A;  2Z4X A;  4NFK F;  3KRP A;  4DWB A;  2ZY1 A;  3V1V A;  5A0I A;  4LXW A;  4F6V A;  3MAV A;  5AHU B;  5ILH A;  4PVY F;  5JV1 F;  3G4F A;  5A0J A;  2F8C F;  3OAB A;  1YYT A;  3EZ3 A;  3LLW A;  4LZ0 A;  1EZF A;  3ACY A;  3QKC A;  2ZCO A;  5ERN A;  1HXA A;  3N49 F;  3KRO B;  5B0L A;  3WEJ A;  5DGM F;  2Q58 A;  5DGN F;  2Z7H A;  3LZ9 A;  5HN8 A;  1WL2 A;  4KVW A;  5EAT A;  4RXA A;  1YV5 A;  4F62 A;  4KWD A;  3KRF A;  3WJO A;  3APZ A;  3CP6 A;  3KRA A;  2DH4 A;  1VG3 A;  4H5D F;  1N21 A;  3OAC A;  4XQT F;  5DHI A;  2ZCQ A;  3SAE A;  1HXG A;  1HM7 A;  1WL3 A;  1WMW A;  3WCJ A;  3NF2 A;  4LA6 A;  3SDT A;  4LFV F;  4DZW A;  5B0M A;  3RYW A;  4JVJ F;  3M02 A;  4JYX A;  4LFG A;  1KIZ A;  3WEF A;  3ZMC A;  4LLS A;  1YYS A;  2E8V A;  2E4O A;  3P5P A;  2F94 F;  2E95 A;  4GP1 A;  2F89 F;  4KUX A;  4PVX F;  5ILD A;  5ER8 A;  4XQR F;  3Q30 A;  3B7L A;  3KBK A;  5AEL A;  4K10 A;  5AFX A;  3TFV A;  1DI1 A;  5IMP A;  2EWG A;  5IM1 A; 
#chains in the Genus database with same CATH topology
 1JFG A;  1YYR A;  3WJK A;  3ZCD A;  1HX9 A;  2Z52 A;  3V1X A;  3ICM A;  4EA0 A;  5IK0 A;  4E9U A;  1N1Z A;  4KVI A;  1VG6 A;  4KPD A;  1KIY A;  5EAS A;  4RYP A;  5AYP A;  3WCB A;  3ACW A;  5IMI A;  3P8L A;  3IBA A;  3VJE A;  3WCF A;  2PS6 A;  3WEI A;  4ZQ8 A;  4LLT A;  4L2X F;  3P41 A;  4NG6 A;  4LOB A;  5JA0 F;  3M0G A;  3QQV A;  3NPK A;  5IK9 A;  1N22 A;  3ICZ A;  3RYE A;  4HD1 A;  3LG5 A;  3DYF A;  4LUU A;  5IL3 A;  3WCL A;  5B0I A;  3KRO A;  4LZC A;  3ADZ A;  3LJI A;  1VG2 A;  4KKM A;  1N24 A;  2QIS A;  2J1O A;  4OGU A;  5I1U A;  1RTR A;  4XQS F;  5DHK A;  4KVY A;  3LOM A;  3VJC A;  3SDR A;  2ZEV A;  3AE0 A;  4DEM F;  4RNQ A;  3G4D A;  3NPR A;  3RMG A;  2F9K F;  2ONG A;  4MC3 A;  3N5J F;  3PDE A;  3WCI A;  4KPJ A;  3P8R A;  3LGZ B;  3DYH A;  4RXC A;  3EGT A;  3LGK A;  4LIX A;  5ILK A;  1YYU A;  2F7M F;  3ZMB A;  5E8L A;  3N3L F;  4LPH F;  1WY0 A;  3SDQ A;  4KQU A;  5DW7 A;  4DI5 A;  5HNA A;  4WK5 A;  4DXJ A;  4LPG F;  3EFQ A;  3OAB B;  3SDU A;  1YJ4 A;  5IN8 A;  3SDV A;  1FPS A;  2FTZ A;  3N6K F;  4EA2 A;  3PH7 A;  2E91 A;  2Q80 A;  3WC9 A;  1UBY A;  1PS1 A;  5DIQ F;  3WCG A;  5DJP F;  5B03 A;  5JUZ F;  3VJA A;  4GAX A;  1HXC A;  5IKA A;  2Q9Y A;  4GP2 A;  3N5H F;  2PS8 A;  4KVD A;  2AEK A;  2ZCR A;  3WCE A;  5JV2 F;  1UBX A;  2ZCS A;  3ID0 A;  3WEG A;  1UBV A;  3Q2Q A;  3WE9 A;  3M9U A;  3ZOU A;  1VG7 A;  4KQS A;  2OPN A;  3VJ9 A;  3ICK A;  3PKO A;  4DHD A;  5B01 A;  3NRI A;  5DJR F;  4LA5 A;  5DZ2 A;  4DWG A;  2Q9Z A;  4OMG A;  1YHM A;  5IL8 A;  1UBW A;  2P1C A;  5JV0 F;  2Z4W A;  4MC0 A;  5ILY A;  4NFJ F;  5HN9 A;  3LSN A;  3RBM A;  1JFA A;  1V4K A;  3TS7 A;  2E92 A;  2OGD A;  4NFI F;  4Q23 A;  2PS7 A;  4KQ5 A;  4P0X A;  5IVG A;  2E93 A;  3LMD A;  3CC9 A;  3TC1 A;  5ERO A;  2AEL A;  2F92 F;  2Z4Z A;  3LDW A;  5IK6 A;  3Q2Z A;  4LFE A;  3WCD A;  5HN7 A;  4LZ3 A;  1YYQ A;  3N45 F;  5IMN A;  3WEK A;  3P5R A;  2AZL A;  1V4J A;  3WCC A;  1YHK A;  2AZJ A;  3N46 F;  5DGS F;  3Q1O A;  4F6X A;  5ILI A;  3BNY A;  3ICN A;  4E1E A;  3N3D A;  4LTV A;  2AZK A;  5ILZ A;  4UMJ A;  2F8Z F;  3KRC B;  3ACX A;  5H9D A;  1WKZ A;  3W7F A;  4JZB A;  2Z78 A;  2I19 A;  5A0K A;  1WL0 A;  2E94 A;  1N23 A;  3IPI A;  3VJD A;  2J1P A;  3KRP B;  5B0K A;  3PYA A;  2E8U A;  4OKZ A;  4LTZ A;  3WSB A;  4OMH A;  4N9U A;  3M00 A;  3MZV A;  1VG4 A;  2H8O A;  3N1V F;  4JXN A;  2Z50 A;  2AET A;  5E8K A;  1ZW5 A;  3KB9 A;  5ERM A;  3TFP A;  1YHL A;  3DYG A;  2PS4 A;  4NKF A;  1N20 A;  4JXY A;  2E90 A;  2OA6 A;  3WCM A;  3AQC B;  3KRF B;  4KK2 A;  1RQI A;  4RXE A;  1RQJ A;  3KRA B;  1V4I A;  3LVS A;  2E8T A;  4QPF A;  3V66 A;  1V4H A;  1V4E A;  5EAU A;  3OAC B;  2J5C A;  2E8X A;  2Z4V A;  3M01 A;  3AQ0 A;  2Z4Y A;  3OYR A;  3TFN A;  5KSX F;  2Z7I A;  3ASX A;  5B00 A;  4P0W A;  3N1W F;  5DJV F;  4EA1 A;  4GA3 A;  2E8W A;  3LK5 A;  4E9Z A;  2VF6 A;  3WSA A;  3CKE A;  3PYB A;  5ILJ A;  5B02 A;  3LEE A;  3N0G A;  3ZL6 A;  5CG5 A;  1DGP A;  4OKM A;  3N0F A;  5IKH A;  4N1Z F;  2ONH A;  4FP4 A;  5B0J A;  5E8H A;  2O1O A;  2ZEU A;  2PS5 A;  5CG6 A;  4H5C F;  4NUA A;  3S4J A;  5C05 A;  4NKE A;  3WJN A;  4H5E F;  2OPM A;  3BNX A;  4JZX A;  3WCA A;  3AQB B;  4P0V A;  4FJQ A;  1YQ7 A;  4QXS F;  3S9V A;  1WL1 A;  4RXD A;  3UCA A;  3VJB A;  3KRC A;  4KFA A;  3WEH A;  1N1B A;  1HM4 A;  2RAH A;  2FOR A;  3WCH A;  4MC8 A;  3VJ8 A;  2Z4X A;  4NFK F;  3KRP A;  4DWB A;  2ZY1 A;  3V1V A;  5A0I A;  4LXW A;  4F6V A;  3MAV A;  5AHU B;  5ILH A;  4PVY F;  5JV1 F;  3G4F A;  5A0J A;  2F8C F;  3OAB A;  1YYT A;  3EZ3 A;  3LLW A;  4LZ0 A;  1EZF A;  3ACY A;  3QKC A;  2ZCO A;  5ERN A;  1HXA A;  3N49 F;  3KRO B;  5B0L A;  3WEJ A;  5DGM F;  2Q58 A;  5DGN F;  2Z7H A;  3LZ9 A;  5HN8 A;  1WL2 A;  4KVW A;  5EAT A;  4RXA A;  1YV5 A;  4F62 A;  4KWD A;  3KRF A;  3WJO A;  3APZ A;  3CP6 A;  3KRA A;  2DH4 A;  1VG3 A;  4H5D F;  1N21 A;  3OAC A;  4XQT F;  5DHI A;  2ZCQ A;  3SAE A;  1HXG A;  1HM7 A;  1WL3 A;  1WMW A;  3WCJ A;  3NF2 A;  4LA6 A;  3SDT A;  4LFV F;  4DZW A;  5B0M A;  3RYW A;  4JVJ F;  3M02 A;  4JYX A;  4LFG A;  1KIZ A;  3WEF A;  3ZMC A;  4LLS A;  1YYS A;  2E8V A;  2E4O A;  3P5P A;  2F94 F;  2E95 A;  4GP1 A;  2F89 F;  4KUX A;  4PVX F;  5ILD A;  5ER8 A;  4XQR F;  3Q30 A;  3B7L A;  3KBK A;  5AEL A;  4K10 A;  5AFX A;  3TFV A;  1DI1 A;  5IMP A;  2EWG A;  5IM1 A; 
#chains in the Genus database with same CATH homology
 1JFG A;  1YYR A;  3WJK A;  3ZCD A;  1HX9 A;  2Z52 A;  3V1X A;  3ICM A;  4EA0 A;  5IK0 A;  4E9U A;  1N1Z A;  4KVI A;  1VG6 A;  4KPD A;  1KIY A;  5EAS A;  4RYP A;  5AYP A;  3WCB A;  3ACW A;  5IMI A;  3P8L A;  3IBA A;  3VJE A;  3WCF A;  2PS6 A;  3WEI A;  4ZQ8 A;  4LLT A;  4L2X F;  3P41 A;  4NG6 A;  4LOB A;  5JA0 F;  3M0G A;  3QQV A;  3NPK A;  5IK9 A;  1N22 A;  3ICZ A;  3RYE A;  4HD1 A;  3LG5 A;  3DYF A;  4LUU A;  5IL3 A;  3WCL A;  5B0I A;  3KRO A;  4LZC A;  3ADZ A;  3LJI A;  1VG2 A;  4KKM A;  1N24 A;  2QIS A;  2J1O A;  4OGU A;  5I1U A;  1RTR A;  4XQS F;  5DHK A;  4KVY A;  3LOM A;  3VJC A;  3SDR A;  2ZEV A;  3AE0 A;  4DEM F;  4RNQ A;  3G4D A;  3NPR A;  3RMG A;  2F9K F;  2ONG A;  4MC3 A;  3N5J F;  3PDE A;  3WCI A;  4KPJ A;  3P8R A;  3LGZ B;  3DYH A;  4RXC A;  3EGT A;  3LGK A;  4LIX A;  5ILK A;  1YYU A;  2F7M F;  3ZMB A;  5E8L A;  3N3L F;  4LPH F;  1WY0 A;  3SDQ A;  4KQU A;  5DW7 A;  4DI5 A;  5HNA A;  4WK5 A;  4DXJ A;  4LPG F;  3EFQ A;  3OAB B;  3SDU A;  1YJ4 A;  5IN8 A;  3SDV A;  1FPS A;  2FTZ A;  3N6K F;  4EA2 A;  3PH7 A;  2E91 A;  2Q80 A;  3WC9 A;  1UBY A;  1PS1 A;  5DIQ F;  3WCG A;  5DJP F;  5B03 A;  5JUZ F;  3VJA A;  4GAX A;  1HXC A;  5IKA A;  2Q9Y A;  4GP2 A;  3N5H F;  2PS8 A;  4KVD A;  2AEK A;  2ZCR A;  3WCE A;  5JV2 F;  1UBX A;  2ZCS A;  3ID0 A;  3WEG A;  1UBV A;  3Q2Q A;  3WE9 A;  3M9U A;  3ZOU A;  1VG7 A;  4KQS A;  2OPN A;  3VJ9 A;  3ICK A;  3PKO A;  4DHD A;  5B01 A;  3NRI A;  5DJR F;  4LA5 A;  5DZ2 A;  4DWG A;  2Q9Z A;  4OMG A;  1YHM A;  5IL8 A;  1UBW A;  2P1C A;  5JV0 F;  2Z4W A;  4MC0 A;  5ILY A;  4NFJ F;  5HN9 A;  3LSN A;  3RBM A;  1JFA A;  1V4K A;  3TS7 A;  2E92 A;  2OGD A;  4NFI F;  4Q23 A;  2PS7 A;  4KQ5 A;  4P0X A;  5IVG A;  2E93 A;  3LMD A;  3CC9 A;  3TC1 A;  5ERO A;  2AEL A;  2F92 F;  2Z4Z A;  3LDW A;  5IK6 A;  3Q2Z A;  4LFE A;  3WCD A;  5HN7 A;  4LZ3 A;  1YYQ A;  3N45 F;  5IMN A;  3WEK A;  3P5R A;  2AZL A;  1V4J A;  3WCC A;  1YHK A;  2AZJ A;  3N46 F;  5DGS F;  3Q1O A;  4F6X A;  5ILI A;  3BNY A;  3ICN A;  4E1E A;  3N3D A;  4LTV A;  2AZK A;  5ILZ A;  4UMJ A;  2F8Z F;  3KRC B;  3ACX A;  5H9D A;  1WKZ A;  3W7F A;  4JZB A;  2Z78 A;  2I19 A;  5A0K A;  1WL0 A;  2E94 A;  1N23 A;  3IPI A;  3VJD A;  2J1P A;  3KRP B;  5B0K A;  3PYA A;  2E8U A;  4OKZ A;  4LTZ A;  3WSB A;  4OMH A;  4N9U A;  3M00 A;  3MZV A;  1VG4 A;  2H8O A;  3N1V F;  4JXN A;  2Z50 A;  2AET A;  5E8K A;  1ZW5 A;  3KB9 A;  5ERM A;  3TFP A;  1YHL A;  3DYG A;  2PS4 A;  4NKF A;  1N20 A;  4JXY A;  2E90 A;  2OA6 A;  3WCM A;  3AQC B;  3KRF B;  4KK2 A;  1RQI A;  4RXE A;  1RQJ A;  3KRA B;  1V4I A;  3LVS A;  2E8T A;  4QPF A;  3V66 A;  1V4H A;  1V4E A;  5EAU A;  3OAC B;  2J5C A;  2E8X A;  2Z4V A;  3M01 A;  3AQ0 A;  2Z4Y A;  3OYR A;  3TFN A;  5KSX F;  2Z7I A;  3ASX A;  5B00 A;  4P0W A;  3N1W F;  5DJV F;  4EA1 A;  4GA3 A;  2E8W A;  3LK5 A;  4E9Z A;  2VF6 A;  3WSA A;  3CKE A;  3PYB A;  5ILJ A;  5B02 A;  3LEE A;  3N0G A;  3ZL6 A;  5CG5 A;  1DGP A;  4OKM A;  3N0F A;  5IKH A;  4N1Z F;  2ONH A;  4FP4 A;  5B0J A;  5E8H A;  2O1O A;  2ZEU A;  2PS5 A;  5CG6 A;  4H5C F;  4NUA A;  3S4J A;  5C05 A;  4NKE A;  3WJN A;  4H5E F;  2OPM A;  3BNX A;  4JZX A;  3WCA A;  3AQB B;  4P0V A;  4FJQ A;  1YQ7 A;  4QXS F;  3S9V A;  1WL1 A;  4RXD A;  3UCA A;  3VJB A;  3KRC A;  4KFA A;  3WEH A;  1N1B A;  1HM4 A;  2RAH A;  2FOR A;  3WCH A;  4MC8 A;  3VJ8 A;  2Z4X A;  4NFK F;  3KRP A;  4DWB A;  2ZY1 A;  3V1V A;  5A0I A;  4LXW A;  4F6V A;  3MAV A;  5AHU B;  5ILH A;  4PVY F;  5JV1 F;  3G4F A;  5A0J A;  2F8C F;  3OAB A;  1YYT A;  3EZ3 A;  3LLW A;  4LZ0 A;  1EZF A;  3ACY A;  3QKC A;  2ZCO A;  5ERN A;  1HXA A;  3N49 F;  3KRO B;  5B0L A;  3WEJ A;  5DGM F;  2Q58 A;  5DGN F;  2Z7H A;  3LZ9 A;  5HN8 A;  1WL2 A;  4KVW A;  5EAT A;  4RXA A;  1YV5 A;  4F62 A;  4KWD A;  3KRF A;  3WJO A;  3APZ A;  3CP6 A;  3KRA A;  2DH4 A;  1VG3 A;  4H5D F;  1N21 A;  3OAC A;  4XQT F;  5DHI A;  2ZCQ A;  3SAE A;  1HXG A;  1HM7 A;  1WL3 A;  1WMW A;  3WCJ A;  3NF2 A;  4LA6 A;  3SDT A;  4LFV F;  4DZW A;  5B0M A;  3RYW A;  4JVJ F;  3M02 A;  4JYX A;  4LFG A;  1KIZ A;  3WEF A;  3ZMC A;  4LLS A;  1YYS A;  2E8V A;  2E4O A;  3P5P A;  2F94 F;  2E95 A;  4GP1 A;  2F89 F;  4KUX A;  4PVX F;  5ILD A;  5ER8 A;  4XQR F;  3Q30 A;  3B7L A;  3KBK A;  5AEL A;  4K10 A;  5AFX A;  3TFV A;  1DI1 A;  5IMP A;  2EWG A;  5IM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...