3ACXA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bph-673
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Mechanism of action and inhibition of dehydrosqualene synthase
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 117
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3acxA00
3B7LA 5E8KA 3DYHA 3N6KF 2AEKA 2Z50A 3MZVA 3VJBA 4KQ5A 5ILHA 3WC9A 4DWBA 4E9UA 1WL1A 4GA3A 3OYRA 2PS6A 3W7FA 4KQUA 2ZEVA 4LTVA 4OMGA 3WCHA 3EGTA 4KK2A 2OA6A 5IMPA 4JXNA 3G4DA 5ERMA 5IKHA 3KRCB 4RYPA 3NF2A 2E93A 3WSBA 1VG2A 4QXSF 3WEJA 1YYTA 5B0IA 5A0KA 3KRPA 4KPDA 4JYXA 1YYQA 3N1VF 4XQRF 3SDQA 4NFJF 4PVXF 2Q9ZA 3ID0A 5KSXF 5HN9A 3S9VA 3P41A 4NKFA 5DGNF 4XQSF 2Q80A 3WCIA 4DZWA 3P8RA 4DHDA 1V4HA 3CKEA 2F92F 4XQTF 3ZMCA 2Z7HA 4KFAA 3ZMBA 5ER8A 3LJIA 5ILKA 5E8HA 4KVYA 4MC0A 3ACYA 3N45F 2AZLA 3KBKA 5B03A 4DWGA 2PS8A 3ASXA 3N49F 5IK6A 1N1BA 2E95A 3WCFA 4RXAA 3S4JA 1YYRA 3N0GA 3TC1A 2F8CF 1DI1A 5HN8A 4KPJA 3KRCA 4P0VA 5ILZA 3NPRA 2O1OA 2OGDA 4NFIF 3WCLA 1YHLA 3TFPA 3PDEA 5IMNA 3QKCA 3AE0A 3OACB 4NKEA 3ZOUA 3M0GA 4EA2A 2I19A 4RXCA 2E8WA 5B02A 1YHKA 5IL8A 2Z4ZA 3VJCA 2RAHA 4H5DF 4LPHF 4LTZA 4P0WA 1WY0A 4DXJA 1HM4A 3EZ3A 4EA1A 3SDVA 3OABA 1V4JA 3P5RA 1YV5A 1VG6A 2F94F 3SDTA 1VG3A 2J5CA 3APZA 3CP6A 3WCEA 3UCAA 1UBYA 3PH7A 3P8LA 3M00A 3KRFB 2PS7A 4KUXA 5B0LA 3V66A 3PYAA 3ZL6A 1DGPA 2Q58A 3WCDA 2Z52A 5IK0A 2VF6A 5DGSF 3Q2ZA 4F6VA 5EROA 4E1EA 3KRAB 3SDRA 5ILYA 3BNYA 3VJEA 3N3DA 2P1CA 3LGKA 5B00A 2DH4A 3ACWA 4JZXA 3N1WF 1N22A 4P0XA 1EZFA 5JV0F 1WMWA 2E90A 3KROB 1RQJA 3EFQA 3LK5A 1UBVA 3WCGA 5AHUB 5DHIA 4OKZA 4K10A 3AQBB 4H5EF 4HD1A 3N3LF 3M01A 3BNXA 5DHKA 4LFGA 1WL3A 4NUAA 5AELA 1PS1A 3WCBA 3RYEA 2ZCOA 4OKMA 4WK5A 5IN8A 3Q1OA 4L2XF 5JA0F 3LVSA 3LSNA 1VG4A 3WEGA 2ZEUA 2J1OA 5DGMF 5ILIA 5IL3A 1UBXA 2PS4A 2Z78A 4LXWA 3ACXA 3PKOA 5ILJA 5E8LA 1HXGA 3ADZA 3G4FA 1HM7A 4E9ZA 1V4KA 3QQVA 3TS7A 3P5PA 3WEKA 4NG6A 2E94A 1N24A 2Z4YA 4DI5A 5DJRF 4KKMA 5HNAA 3KRAA 1WL2A 3RBMA 3SDUA 4LPGF 2E8UA 4MC3A 1WL0A 3PYBA 4NFKF 3KRPB 4RNQA 1N23A 1KIZA 3M02A 4EA0A 2OPNA 3ICKA 2Z7IA 1UBWA 2F89F 2ZY1A 4PVYF 3LDWA 2AZKA 3WJNA 5H9DA 3WJOA 3KROA 2PS5A 4RXEA 3WEHA 1ZW5A 1FPSA 5JV1F 4JVJF 5EAUA 4F62A 4LFVF 4RXDA 3N5JF 5DIQF 1N21A 3NRIA 3MAVA 1V4IA 3N0FA 3LEEA 5AFXA 5CG5A 4LA5A 3AQ0A 2ONGA 4OMHA 2E4OA 4LLSA 3RYWA 3SAEA 4LIXA 1HXAA 3AQCB 4JXYA 2FTZA 3ZCDA 2F7MF 3IPIA 2Z4WA 2AETA 5ERNA 4GP1A 5IMIA 1N1ZA 2OPMA 2E8VA 5DJVF 3WCMA 5EASA 4F6XA 5ILDA 3RMGA 1HXCA 4LZ0A 3M9UA 2ZCSA 4ZQ8A 3OACA 5A0JA 1JFAA 3IBAA 4FJQA 4MC8A 1YHMA 4DEMF 3DYGA 2ONHA 1RQIA 3WEIA 2E8XA 4LA6A 4LLTA 3WCCA 5A0IA 1V4EA 3KB9A 3ICMA 1YJ4A 4GAXA 2EWGA 1YYUA 3ICZA 2Z4XA 4UMJA 3Q2QA 2E92A 4OGUA 4N1ZF 2QISA 4LUUA 5HN7A 5B0KA 3LLWA 4FP4A 3OABB 5IVGA 2ZCQA 5B01A 4LZCA 2ZCRA 4QPFA 5DW7A 4N9UA 3V1VA 3NPKA 4LOBA 2FORA 5CG6A 4KWDA 2F9KF 3VJ9A 5IK9A 3KRFA 2F8ZF 2H8OA 1YQ7A 3TFNA 5DJPF 5JUZF 4H5CF 3N46F 5I1UA 4LZ3A 1VG7A 3LMDA 4KVDA 3Q30A 3VJ8A 3LZ9A 5B0MA 2AELA 1HX9A 4LFEA 1WKZA 1KIYA 1JFGA 4GP2A 3V1XA 2Q9YA 3LGZB 3WCJA 3VJDA 3N5HF 3DYFA 2J1PA 4Q23A 4JZBA 5EATA 5JV2F 1N20A 3WE9A 3VJAA 4KVIA 2E91A 5DZ2A 3WEFA 3TFVA 2AZJA 3CC9A 1YYSA 3ICNA 3LG5A 1RTRA 4KVWA 3WCAA 5AYPA 3LOMA 3WJKA 5C05A 2Z4VA 5B0JA 4KQSA 3WSAA 2E8TA 5IKAA 5IM1A
chains in the Genus database with same CATH superfamily
3B7LA 5E8KA 3DYHA 3N6KF 2AEKA 2Z50A 3MZVA 3VJBA 4KQ5A 5ILHA 3WC9A 4DWBA 4E9UA 1WL1A 4GA3A 3OYRA 2PS6A 3W7FA 4KQUA 2ZEVA 4LTVA 4OMGA 3WCHA 3EGTA 4KK2A 2OA6A 5IMPA 4JXNA 3G4DA 5ERMA 5IKHA 3KRCB 4RYPA 3NF2A 2E93A 3WSBA 1VG2A 4QXSF 3WEJA 1YYTA 5B0IA 5A0KA 3KRPA 4KPDA 4JYXA 1YYQA 3N1VF 4XQRF 3SDQA 4NFJF 4PVXF 2Q9ZA 3ID0A 5KSXF 5HN9A 3S9VA 3P41A 4NKFA 5DGNF 4XQSF 2Q80A 3WCIA 4DZWA 3P8RA 4DHDA 1V4HA 3CKEA 2F92F 4XQTF 3ZMCA 2Z7HA 4KFAA 3ZMBA 5ER8A 3LJIA 5ILKA 5E8HA 4KVYA 4MC0A 3ACYA 3N45F 2AZLA 3KBKA 5B03A 4DWGA 2PS8A 3ASXA 3N49F 5IK6A 1N1BA 2E95A 3WCFA 4RXAA 3S4JA 1YYRA 3N0GA 3TC1A 2F8CF 1DI1A 5HN8A 4KPJA 3KRCA 4P0VA 5ILZA 3NPRA 2O1OA 2OGDA 4NFIF 3WCLA 1YHLA 3TFPA 3PDEA 5IMNA 3QKCA 3AE0A 3OACB 4NKEA 3ZOUA 3M0GA 4EA2A 2I19A 4RXCA 2E8WA 5B02A 1YHKA 5IL8A 2Z4ZA 3VJCA 2RAHA 4H5DF 4LPHF 4LTZA 4P0WA 1WY0A 4DXJA 1HM4A 3EZ3A 4EA1A 3SDVA 3OABA 1V4JA 3P5RA 1YV5A 1VG6A 2F94F 3SDTA 1VG3A 2J5CA 3APZA 3CP6A 3WCEA 3UCAA 1UBYA 3PH7A 3P8LA 3M00A 3KRFB 2PS7A 4KUXA 5B0LA 3V66A 3PYAA 3ZL6A 1DGPA 2Q58A 3WCDA 2Z52A 5IK0A 2VF6A 5DGSF 3Q2ZA 4F6VA 5EROA 4E1EA 3KRAB 3SDRA 5ILYA 3BNYA 3VJEA 3N3DA 2P1CA 3LGKA 5B00A 2DH4A 3ACWA 4JZXA 3N1WF 1N22A 4P0XA 1EZFA 5JV0F 1WMWA 2E90A 3KROB 1RQJA 3EFQA 3LK5A 1UBVA 3WCGA 5AHUB 5DHIA 4OKZA 4K10A 3AQBB 4H5EF 4HD1A 3N3LF 3M01A 3BNXA 5DHKA 4LFGA 1WL3A 4NUAA 5AELA 1PS1A 3WCBA 3RYEA 2ZCOA 4OKMA 4WK5A 5IN8A 3Q1OA 4L2XF 5JA0F 3LVSA 3LSNA 1VG4A 3WEGA 2ZEUA 2J1OA 5DGMF 5ILIA 5IL3A 1UBXA 2PS4A 2Z78A 4LXWA 3ACXA 3PKOA 5ILJA 5E8LA 1HXGA 3ADZA 3G4FA 1HM7A 4E9ZA 1V4KA 3QQVA 3TS7A 3P5PA 3WEKA 4NG6A 2E94A 1N24A 2Z4YA 4DI5A 5DJRF 4KKMA 5HNAA 3KRAA 1WL2A 3RBMA 3SDUA 4LPGF 2E8UA 4MC3A 1WL0A 3PYBA 4NFKF 3KRPB 4RNQA 1N23A 1KIZA 3M02A 4EA0A 2OPNA 3ICKA 2Z7IA 1UBWA 2F89F 2ZY1A 4PVYF 3LDWA 2AZKA 3WJNA 5H9DA 3WJOA 3KROA 2PS5A 4RXEA 3WEHA 1ZW5A 1FPSA 5JV1F 4JVJF 5EAUA 4F62A 4LFVF 4RXDA 3N5JF 5DIQF 1N21A 3NRIA 3MAVA 1V4IA 3N0FA 3LEEA 5AFXA 5CG5A 4LA5A 3AQ0A 2ONGA 4OMHA 2E4OA 4LLSA 3RYWA 3SAEA 4LIXA 1HXAA 3AQCB 4JXYA 2FTZA 3ZCDA 2F7MF 3IPIA 2Z4WA 2AETA 5ERNA 4GP1A 5IMIA 1N1ZA 2OPMA 2E8VA 5DJVF 3WCMA 5EASA 4F6XA 5ILDA 3RMGA 1HXCA 4LZ0A 3M9UA 2ZCSA 4ZQ8A 3OACA 5A0JA 1JFAA 3IBAA 4FJQA 4MC8A 1YHMA 4DEMF 3DYGA 2ONHA 1RQIA 3WEIA 2E8XA 4LA6A 4LLTA 3WCCA 5A0IA 1V4EA 3KB9A 3ICMA 1YJ4A 4GAXA 2EWGA 1YYUA 3ICZA 2Z4XA 4UMJA 3Q2QA 2E92A 4OGUA 4N1ZF 2QISA 4LUUA 5HN7A 5B0KA 3LLWA 4FP4A 3OABB 5IVGA 2ZCQA 5B01A 4LZCA 2ZCRA 4QPFA 5DW7A 4N9UA 3V1VA 3NPKA 4LOBA 2FORA 5CG6A 4KWDA 2F9KF 3VJ9A 5IK9A 3KRFA 2F8ZF 2H8OA 1YQ7A 3TFNA 5DJPF 5JUZF 4H5CF 3N46F 5I1UA 4LZ3A 1VG7A 3LMDA 4KVDA 3Q30A 3VJ8A 3LZ9A 5B0MA 2AELA 1HX9A 4LFEA 1WKZA 1KIYA 1JFGA 4GP2A 3V1XA 2Q9YA 3LGZB 3WCJA 3VJDA 3N5HF 3DYFA 2J1PA 4Q23A 4JZBA 5EATA 5JV2F 1N20A 3WE9A 3VJAA 4KVIA 2E91A 5DZ2A 3WEFA 3TFVA 2AZJA 3CC9A 1YYSA 3ICNA 3LG5A 1RTRA 4KVWA 3WCAA 5AYPA 3LOMA 3WJKA 5C05A 2Z4VA 5B0JA 4KQSA 3WSAA 2E8TA 5IKAA 5IM1A
chains in the Genus database with same CATH topology
3B7LA 5E8KA 3DYHA 3N6KF 2AEKA 2Z50A 3MZVA 3VJBA 4KQ5A 5ILHA 3WC9A 4DWBA 4E9UA 1WL1A 4GA3A 3OYRA 2PS6A 3W7FA 4KQUA 2ZEVA 4LTVA 4OMGA 3WCHA 3EGTA 4KK2A 2OA6A 5IMPA 4JXNA 3G4DA 5ERMA 5IKHA 3KRCB 4RYPA 3NF2A 2E93A 3WSBA 1VG2A 4QXSF 3WEJA 1YYTA 5B0IA 5A0KA 3KRPA 4KPDA 4JYXA 1YYQA 3N1VF 4XQRF 3SDQA 4NFJF 4PVXF 2Q9ZA 3ID0A 5KSXF 5HN9A 3S9VA 3P41A 4NKFA 5DGNF 4XQSF 2Q80A 3WCIA 4DZWA 3P8RA 4DHDA 1V4HA 3CKEA 2F92F 4XQTF 3ZMCA 2Z7HA 4KFAA 3ZMBA 5ER8A 3LJIA 5ILKA 5E8HA 4KVYA 4MC0A 3ACYA 3N45F 2AZLA 3KBKA 5B03A 4DWGA 2PS8A 3ASXA 3N49F 5IK6A 1N1BA 2E95A 3WCFA 4RXAA 3S4JA 1YYRA 3N0GA 3TC1A 2F8CF 1DI1A 5HN8A 4KPJA 3KRCA 4P0VA 5ILZA 3NPRA 2O1OA 2OGDA 4NFIF 3WCLA 1YHLA 3TFPA 3PDEA 5IMNA 3QKCA 3AE0A 3OACB 4NKEA 3ZOUA 3M0GA 4EA2A 2I19A 4RXCA 2E8WA 5B02A 1YHKA 5IL8A 2Z4ZA 3VJCA 2RAHA 4H5DF 4LPHF 4LTZA 4P0WA 1WY0A 4DXJA 1HM4A 3EZ3A 4EA1A 3SDVA 3OABA 1V4JA 3P5RA 1YV5A 1VG6A 2F94F 3SDTA 1VG3A 2J5CA 3APZA 3CP6A 3WCEA 3UCAA 1UBYA 3PH7A 3P8LA 3M00A 3KRFB 2PS7A 4KUXA 5B0LA 3V66A 3PYAA 3ZL6A 1DGPA 2Q58A 3WCDA 2Z52A 5IK0A 2VF6A 5DGSF 3Q2ZA 4F6VA 5EROA 4E1EA 3KRAB 3SDRA 5ILYA 3BNYA 3VJEA 3N3DA 2P1CA 3LGKA 5B00A 2DH4A 3ACWA 4JZXA 3N1WF 1N22A 4P0XA 1EZFA 5JV0F 1WMWA 2E90A 3KROB 1RQJA 3EFQA 3LK5A 1UBVA 3WCGA 5AHUB 5DHIA 4OKZA 4K10A 3AQBB 4H5EF 4HD1A 3N3LF 3M01A 3BNXA 5DHKA 4LFGA 1WL3A 4NUAA 5AELA 1PS1A 3WCBA 3RYEA 2ZCOA 4OKMA 4WK5A 5IN8A 3Q1OA 4L2XF 5JA0F 3LVSA 3LSNA 1VG4A 3WEGA 2ZEUA 2J1OA 5DGMF 5ILIA 5IL3A 1UBXA 2PS4A 2Z78A 4LXWA 3ACXA 3PKOA 5ILJA 5E8LA 1HXGA 3ADZA 3G4FA 1HM7A 4E9ZA 1V4KA 3QQVA 3TS7A 3P5PA 3WEKA 4NG6A 2E94A 1N24A 2Z4YA 4DI5A 5DJRF 4KKMA 5HNAA 3KRAA 1WL2A 3RBMA 3SDUA 4LPGF 2E8UA 4MC3A 1WL0A 3PYBA 4NFKF 3KRPB 4RNQA 1N23A 1KIZA 3M02A 4EA0A 2OPNA 3ICKA 2Z7IA 1UBWA 2F89F 2ZY1A 4PVYF 3LDWA 2AZKA 3WJNA 5H9DA 3WJOA 3KROA 2PS5A 4RXEA 3WEHA 1ZW5A 1FPSA 5JV1F 4JVJF 5EAUA 4F62A 4LFVF 4RXDA 3N5JF 5DIQF 1N21A 3NRIA 3MAVA 1V4IA 3N0FA 3LEEA 5AFXA 5CG5A 4LA5A 3AQ0A 2ONGA 4OMHA 2E4OA 4LLSA 3RYWA 3SAEA 4LIXA 1HXAA 3AQCB 4JXYA 2FTZA 3ZCDA 2F7MF 3IPIA 2Z4WA 2AETA 5ERNA 4GP1A 5IMIA 1N1ZA 2OPMA 2E8VA 5DJVF 3WCMA 5EASA 4F6XA 5ILDA 3RMGA 1HXCA 4LZ0A 3M9UA 2ZCSA 4ZQ8A 3OACA 5A0JA 1JFAA 3IBAA 4FJQA 4MC8A 1YHMA 4DEMF 3DYGA 2ONHA 1RQIA 3WEIA 2E8XA 4LA6A 4LLTA 3WCCA 5A0IA 1V4EA 3KB9A 3ICMA 1YJ4A 4GAXA 2EWGA 1YYUA 3ICZA 2Z4XA 4UMJA 3Q2QA 2E92A 4OGUA 4N1ZF 2QISA 4LUUA 5HN7A 5B0KA 3LLWA 4FP4A 3OABB 5IVGA 2ZCQA 5B01A 4LZCA 2ZCRA 4QPFA 5DW7A 4N9UA 3V1VA 3NPKA 4LOBA 2FORA 5CG6A 4KWDA 2F9KF 3VJ9A 5IK9A 3KRFA 2F8ZF 2H8OA 1YQ7A 3TFNA 5DJPF 5JUZF 4H5CF 3N46F 5I1UA 4LZ3A 1VG7A 3LMDA 4KVDA 3Q30A 3VJ8A 3LZ9A 5B0MA 2AELA 1HX9A 4LFEA 1WKZA 1KIYA 1JFGA 4GP2A 3V1XA 2Q9YA 3LGZB 3WCJA 3VJDA 3N5HF 3DYFA 2J1PA 4Q23A 4JZBA 5EATA 5JV2F 1N20A 3WE9A 3VJAA 4KVIA 2E91A 5DZ2A 3WEFA 3TFVA 2AZJA 3CC9A 1YYSA 3ICNA 3LG5A 1RTRA 4KVWA 3WCAA 5AYPA 3LOMA 3WJKA 5C05A 2Z4VA 5B0JA 4KQSA 3WSAA 2E8TA 5IKAA 5IM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7L A;  5E8K A;  3DYH A;  3N6K F;  2AEK A;  2Z50 A;  3MZV A;  3VJB A;  4KQ5 A;  5ILH A;  3WC9 A;  4DWB A;  4E9U A;  1WL1 A;  4GA3 A;  3OYR A;  2PS6 A;  3W7F A;  4KQU A;  2ZEV A;  4LTV A;  4OMG A;  3WCH A;  3EGT A;  4KK2 A;  2OA6 A;  5IMP A;  4JXN A;  3G4D A;  5ERM A;  5IKH A;  3KRC B;  4RYP A;  3NF2 A;  2E93 A;  3WSB A;  1VG2 A;  4QXS F;  3WEJ A;  1YYT A;  5B0I A;  5A0K A;  3KRP A;  4KPD A;  4JYX A;  1YYQ A;  3N1V F;  4XQR F;  3SDQ A;  4NFJ F;  4PVX F;  2Q9Z A;  3ID0 A;  5KSX F;  5HN9 A;  3S9V A;  3P41 A;  4NKF A;  5DGN F;  4XQS F;  2Q80 A;  3WCI A;  4DZW A;  3P8R A;  4DHD A;  1V4H A;  3CKE A;  2F92 F;  4XQT F;  3ZMC A;  2Z7H A;  4KFA A;  3ZMB A;  5ER8 A;  3LJI A;  5ILK A;  5E8H A;  4KVY A;  4MC0 A;  3ACY A;  3N45 F;  2AZL A;  3KBK A;  5B03 A;  4DWG A;  2PS8 A;  3ASX A;  3N49 F;  5IK6 A;  1N1B A;  2E95 A;  3WCF A;  4RXA A;  3S4J A;  1YYR A;  3N0G A;  3TC1 A;  2F8C F;  1DI1 A;  5HN8 A;  4KPJ A;  3KRC A;  4P0V A;  5ILZ A;  3NPR A;  2O1O A;  2OGD A;  4NFI F;  3WCL A;  1YHL A;  3TFP A;  3PDE A;  5IMN A;  3QKC A;  3AE0 A;  3OAC B;  4NKE A;  3ZOU A;  3M0G A;  4EA2 A;  2I19 A;  4RXC A;  2E8W A;  5B02 A;  1YHK A;  5IL8 A;  2Z4Z A;  3VJC A;  2RAH A;  4H5D F;  4LPH F;  4LTZ A;  4P0W A;  1WY0 A;  4DXJ A;  1HM4 A;  3EZ3 A;  4EA1 A;  3SDV A;  3OAB A;  1V4J A;  3P5R A;  1YV5 A;  1VG6 A;  2F94 F;  3SDT A;  1VG3 A;  2J5C A;  3APZ A;  3CP6 A;  3WCE A;  3UCA A;  1UBY A;  3PH7 A;  3P8L A;  3M00 A;  3KRF B;  2PS7 A;  4KUX A;  5B0L A;  3V66 A;  3PYA A;  3ZL6 A;  1DGP A;  2Q58 A;  3WCD A;  2Z52 A;  5IK0 A;  2VF6 A;  5DGS F;  3Q2Z A;  4F6V A;  5ERO A;  4E1E A;  3KRA B;  3SDR A;  5ILY A;  3BNY A;  3VJE A;  3N3D A;  2P1C A;  3LGK A;  5B00 A;  2DH4 A;  3ACW A;  4JZX A;  3N1W F;  1N22 A;  4P0X A;  1EZF A;  5JV0 F;  1WMW A;  2E90 A;  3KRO B;  1RQJ A;  3EFQ A;  3LK5 A;  1UBV A;  3WCG A;  5AHU B;  5DHI A;  4OKZ A;  4K10 A;  3AQB B;  4H5E F;  4HD1 A;  3N3L F;  3M01 A;  3BNX A;  5DHK A;  4LFG A;  1WL3 A;  4NUA A;  5AEL A;  1PS1 A;  3WCB A;  3RYE A;  2ZCO A;  4OKM A;  4WK5 A;  5IN8 A;  3Q1O A;  4L2X F;  5JA0 F;  3LVS A;  3LSN A;  1VG4 A;  3WEG A;  2ZEU A;  2J1O A;  5DGM F;  5ILI A;  5IL3 A;  1UBX A;  2PS4 A;  2Z78 A;  4LXW A;  3ACX A;  3PKO A;  5ILJ A;  5E8L A;  1HXG A;  3ADZ A;  3G4F A;  1HM7 A;  4E9Z A;  1V4K A;  3QQV A;  3TS7 A;  3P5P A;  3WEK A;  4NG6 A;  2E94 A;  1N24 A;  2Z4Y A;  4DI5 A;  5DJR F;  4KKM A;  5HNA A;  3KRA A;  1WL2 A;  3RBM A;  3SDU A;  4LPG F;  2E8U A;  4MC3 A;  1WL0 A;  3PYB A;  4NFK F;  3KRP B;  4RNQ A;  1N23 A;  1KIZ A;  3M02 A;  4EA0 A;  2OPN A;  3ICK A;  2Z7I A;  1UBW A;  2F89 F;  2ZY1 A;  4PVY F;  3LDW A;  2AZK A;  3WJN A;  5H9D A;  3WJO A;  3KRO A;  2PS5 A;  4RXE A;  3WEH A;  1ZW5 A;  1FPS A;  5JV1 F;  4JVJ F;  5EAU A;  4F62 A;  4LFV F;  4RXD A;  3N5J F;  5DIQ F;  1N21 A;  3NRI A;  3MAV A;  1V4I A;  3N0F A;  3LEE A;  5AFX A;  5CG5 A;  4LA5 A;  3AQ0 A;  2ONG A;  4OMH A;  2E4O A;  4LLS A;  3RYW A;  3SAE A;  4LIX A;  1HXA A;  3AQC B;  4JXY A;  2FTZ A;  3ZCD A;  2F7M F;  3IPI A;  2Z4W A;  2AET A;  5ERN A;  4GP1 A;  5IMI A;  1N1Z A;  2OPM A;  2E8V A;  5DJV F;  3WCM A;  5EAS A;  4F6X A;  5ILD A;  3RMG A;  1HXC A;  4LZ0 A;  3M9U A;  2ZCS A;  4ZQ8 A;  3OAC A;  5A0J A;  1JFA A;  3IBA A;  4FJQ A;  4MC8 A;  1YHM A;  4DEM F;  3DYG A;  2ONH A;  1RQI A;  3WEI A;  2E8X A;  4LA6 A;  4LLT A;  3WCC A;  5A0I A;  1V4E A;  3KB9 A;  3ICM A;  1YJ4 A;  4GAX A;  2EWG A;  1YYU A;  3ICZ A;  2Z4X A;  4UMJ A;  3Q2Q A;  2E92 A;  4OGU A;  4N1Z F;  2QIS A;  4LUU A;  5HN7 A;  5B0K A;  3LLW A;  4FP4 A;  3OAB B;  5IVG A;  2ZCQ A;  5B01 A;  4LZC A;  2ZCR A;  4QPF A;  5DW7 A;  4N9U A;  3V1V A;  3NPK A;  4LOB A;  2FOR A;  5CG6 A;  4KWD A;  2F9K F;  3VJ9 A;  5IK9 A;  3KRF A;  2F8Z F;  2H8O A;  1YQ7 A;  3TFN A;  5DJP F;  5JUZ F;  4H5C F;  3N46 F;  5I1U A;  4LZ3 A;  1VG7 A;  3LMD A;  4KVD A;  3Q30 A;  3VJ8 A;  3LZ9 A;  5B0M A;  2AEL A;  1HX9 A;  4LFE A;  1WKZ A;  1KIY A;  1JFG A;  4GP2 A;  3V1X A;  2Q9Y A;  3LGZ B;  3WCJ A;  3VJD A;  3N5H F;  3DYF A;  2J1P A;  4Q23 A;  4JZB A;  5EAT A;  5JV2 F;  1N20 A;  3WE9 A;  3VJA A;  4KVI A;  2E91 A;  5DZ2 A;  3WEF A;  3TFV A;  2AZJ A;  3CC9 A;  1YYS A;  3ICN A;  3LG5 A;  1RTR A;  4KVW A;  3WCA A;  5AYP A;  3LOM A;  3WJK A;  5C05 A;  2Z4V A;  5B0J A;  4KQS A;  3WSA A;  2E8T A;  5IKA A;  5IM1 A; 
#chains in the Genus database with same CATH topology
 3B7L A;  5E8K A;  3DYH A;  3N6K F;  2AEK A;  2Z50 A;  3MZV A;  3VJB A;  4KQ5 A;  5ILH A;  3WC9 A;  4DWB A;  4E9U A;  1WL1 A;  4GA3 A;  3OYR A;  2PS6 A;  3W7F A;  4KQU A;  2ZEV A;  4LTV A;  4OMG A;  3WCH A;  3EGT A;  4KK2 A;  2OA6 A;  5IMP A;  4JXN A;  3G4D A;  5ERM A;  5IKH A;  3KRC B;  4RYP A;  3NF2 A;  2E93 A;  3WSB A;  1VG2 A;  4QXS F;  3WEJ A;  1YYT A;  5B0I A;  5A0K A;  3KRP A;  4KPD A;  4JYX A;  1YYQ A;  3N1V F;  4XQR F;  3SDQ A;  4NFJ F;  4PVX F;  2Q9Z A;  3ID0 A;  5KSX F;  5HN9 A;  3S9V A;  3P41 A;  4NKF A;  5DGN F;  4XQS F;  2Q80 A;  3WCI A;  4DZW A;  3P8R A;  4DHD A;  1V4H A;  3CKE A;  2F92 F;  4XQT F;  3ZMC A;  2Z7H A;  4KFA A;  3ZMB A;  5ER8 A;  3LJI A;  5ILK A;  5E8H A;  4KVY A;  4MC0 A;  3ACY A;  3N45 F;  2AZL A;  3KBK A;  5B03 A;  4DWG A;  2PS8 A;  3ASX A;  3N49 F;  5IK6 A;  1N1B A;  2E95 A;  3WCF A;  4RXA A;  3S4J A;  1YYR A;  3N0G A;  3TC1 A;  2F8C F;  1DI1 A;  5HN8 A;  4KPJ A;  3KRC A;  4P0V A;  5ILZ A;  3NPR A;  2O1O A;  2OGD A;  4NFI F;  3WCL A;  1YHL A;  3TFP A;  3PDE A;  5IMN A;  3QKC A;  3AE0 A;  3OAC B;  4NKE A;  3ZOU A;  3M0G A;  4EA2 A;  2I19 A;  4RXC A;  2E8W A;  5B02 A;  1YHK A;  5IL8 A;  2Z4Z A;  3VJC A;  2RAH A;  4H5D F;  4LPH F;  4LTZ A;  4P0W A;  1WY0 A;  4DXJ A;  1HM4 A;  3EZ3 A;  4EA1 A;  3SDV A;  3OAB A;  1V4J A;  3P5R A;  1YV5 A;  1VG6 A;  2F94 F;  3SDT A;  1VG3 A;  2J5C A;  3APZ A;  3CP6 A;  3WCE A;  3UCA A;  1UBY A;  3PH7 A;  3P8L A;  3M00 A;  3KRF B;  2PS7 A;  4KUX A;  5B0L A;  3V66 A;  3PYA A;  3ZL6 A;  1DGP A;  2Q58 A;  3WCD A;  2Z52 A;  5IK0 A;  2VF6 A;  5DGS F;  3Q2Z A;  4F6V A;  5ERO A;  4E1E A;  3KRA B;  3SDR A;  5ILY A;  3BNY A;  3VJE A;  3N3D A;  2P1C A;  3LGK A;  5B00 A;  2DH4 A;  3ACW A;  4JZX A;  3N1W F;  1N22 A;  4P0X A;  1EZF A;  5JV0 F;  1WMW A;  2E90 A;  3KRO B;  1RQJ A;  3EFQ A;  3LK5 A;  1UBV A;  3WCG A;  5AHU B;  5DHI A;  4OKZ A;  4K10 A;  3AQB B;  4H5E F;  4HD1 A;  3N3L F;  3M01 A;  3BNX A;  5DHK A;  4LFG A;  1WL3 A;  4NUA A;  5AEL A;  1PS1 A;  3WCB A;  3RYE A;  2ZCO A;  4OKM A;  4WK5 A;  5IN8 A;  3Q1O A;  4L2X F;  5JA0 F;  3LVS A;  3LSN A;  1VG4 A;  3WEG A;  2ZEU A;  2J1O A;  5DGM F;  5ILI A;  5IL3 A;  1UBX A;  2PS4 A;  2Z78 A;  4LXW A;  3ACX A;  3PKO A;  5ILJ A;  5E8L A;  1HXG A;  3ADZ A;  3G4F A;  1HM7 A;  4E9Z A;  1V4K A;  3QQV A;  3TS7 A;  3P5P A;  3WEK A;  4NG6 A;  2E94 A;  1N24 A;  2Z4Y A;  4DI5 A;  5DJR F;  4KKM A;  5HNA A;  3KRA A;  1WL2 A;  3RBM A;  3SDU A;  4LPG F;  2E8U A;  4MC3 A;  1WL0 A;  3PYB A;  4NFK F;  3KRP B;  4RNQ A;  1N23 A;  1KIZ A;  3M02 A;  4EA0 A;  2OPN A;  3ICK A;  2Z7I A;  1UBW A;  2F89 F;  2ZY1 A;  4PVY F;  3LDW A;  2AZK A;  3WJN A;  5H9D A;  3WJO A;  3KRO A;  2PS5 A;  4RXE A;  3WEH A;  1ZW5 A;  1FPS A;  5JV1 F;  4JVJ F;  5EAU A;  4F62 A;  4LFV F;  4RXD A;  3N5J F;  5DIQ F;  1N21 A;  3NRI A;  3MAV A;  1V4I A;  3N0F A;  3LEE A;  5AFX A;  5CG5 A;  4LA5 A;  3AQ0 A;  2ONG A;  4OMH A;  2E4O A;  4LLS A;  3RYW A;  3SAE A;  4LIX A;  1HXA A;  3AQC B;  4JXY A;  2FTZ A;  3ZCD A;  2F7M F;  3IPI A;  2Z4W A;  2AET A;  5ERN A;  4GP1 A;  5IMI A;  1N1Z A;  2OPM A;  2E8V A;  5DJV F;  3WCM A;  5EAS A;  4F6X A;  5ILD A;  3RMG A;  1HXC A;  4LZ0 A;  3M9U A;  2ZCS A;  4ZQ8 A;  3OAC A;  5A0J A;  1JFA A;  3IBA A;  4FJQ A;  4MC8 A;  1YHM A;  4DEM F;  3DYG A;  2ONH A;  1RQI A;  3WEI A;  2E8X A;  4LA6 A;  4LLT A;  3WCC A;  5A0I A;  1V4E A;  3KB9 A;  3ICM A;  1YJ4 A;  4GAX A;  2EWG A;  1YYU A;  3ICZ A;  2Z4X A;  4UMJ A;  3Q2Q A;  2E92 A;  4OGU A;  4N1Z F;  2QIS A;  4LUU A;  5HN7 A;  5B0K A;  3LLW A;  4FP4 A;  3OAB B;  5IVG A;  2ZCQ A;  5B01 A;  4LZC A;  2ZCR A;  4QPF A;  5DW7 A;  4N9U A;  3V1V A;  3NPK A;  4LOB A;  2FOR A;  5CG6 A;  4KWD A;  2F9K F;  3VJ9 A;  5IK9 A;  3KRF A;  2F8Z F;  2H8O A;  1YQ7 A;  3TFN A;  5DJP F;  5JUZ F;  4H5C F;  3N46 F;  5I1U A;  4LZ3 A;  1VG7 A;  3LMD A;  4KVD A;  3Q30 A;  3VJ8 A;  3LZ9 A;  5B0M A;  2AEL A;  1HX9 A;  4LFE A;  1WKZ A;  1KIY A;  1JFG A;  4GP2 A;  3V1X A;  2Q9Y A;  3LGZ B;  3WCJ A;  3VJD A;  3N5H F;  3DYF A;  2J1P A;  4Q23 A;  4JZB A;  5EAT A;  5JV2 F;  1N20 A;  3WE9 A;  3VJA A;  4KVI A;  2E91 A;  5DZ2 A;  3WEF A;  3TFV A;  2AZJ A;  3CC9 A;  1YYS A;  3ICN A;  3LG5 A;  1RTR A;  4KVW A;  3WCA A;  5AYP A;  3LOM A;  3WJK A;  5C05 A;  2Z4V A;  5B0J A;  4KQS A;  3WSA A;  2E8T A;  5IKA A;  5IM1 A; 
#chains in the Genus database with same CATH homology
 3B7L A;  5E8K A;  3DYH A;  3N6K F;  2AEK A;  2Z50 A;  3MZV A;  3VJB A;  4KQ5 A;  5ILH A;  3WC9 A;  4DWB A;  4E9U A;  1WL1 A;  4GA3 A;  3OYR A;  2PS6 A;  3W7F A;  4KQU A;  2ZEV A;  4LTV A;  4OMG A;  3WCH A;  3EGT A;  4KK2 A;  2OA6 A;  5IMP A;  4JXN A;  3G4D A;  5ERM A;  5IKH A;  3KRC B;  4RYP A;  3NF2 A;  2E93 A;  3WSB A;  1VG2 A;  4QXS F;  3WEJ A;  1YYT A;  5B0I A;  5A0K A;  3KRP A;  4KPD A;  4JYX A;  1YYQ A;  3N1V F;  4XQR F;  3SDQ A;  4NFJ F;  4PVX F;  2Q9Z A;  3ID0 A;  5KSX F;  5HN9 A;  3S9V A;  3P41 A;  4NKF A;  5DGN F;  4XQS F;  2Q80 A;  3WCI A;  4DZW A;  3P8R A;  4DHD A;  1V4H A;  3CKE A;  2F92 F;  4XQT F;  3ZMC A;  2Z7H A;  4KFA A;  3ZMB A;  5ER8 A;  3LJI A;  5ILK A;  5E8H A;  4KVY A;  4MC0 A;  3ACY A;  3N45 F;  2AZL A;  3KBK A;  5B03 A;  4DWG A;  2PS8 A;  3ASX A;  3N49 F;  5IK6 A;  1N1B A;  2E95 A;  3WCF A;  4RXA A;  3S4J A;  1YYR A;  3N0G A;  3TC1 A;  2F8C F;  1DI1 A;  5HN8 A;  4KPJ A;  3KRC A;  4P0V A;  5ILZ A;  3NPR A;  2O1O A;  2OGD A;  4NFI F;  3WCL A;  1YHL A;  3TFP A;  3PDE A;  5IMN A;  3QKC A;  3AE0 A;  3OAC B;  4NKE A;  3ZOU A;  3M0G A;  4EA2 A;  2I19 A;  4RXC A;  2E8W A;  5B02 A;  1YHK A;  5IL8 A;  2Z4Z A;  3VJC A;  2RAH A;  4H5D F;  4LPH F;  4LTZ A;  4P0W A;  1WY0 A;  4DXJ A;  1HM4 A;  3EZ3 A;  4EA1 A;  3SDV A;  3OAB A;  1V4J A;  3P5R A;  1YV5 A;  1VG6 A;  2F94 F;  3SDT A;  1VG3 A;  2J5C A;  3APZ A;  3CP6 A;  3WCE A;  3UCA A;  1UBY A;  3PH7 A;  3P8L A;  3M00 A;  3KRF B;  2PS7 A;  4KUX A;  5B0L A;  3V66 A;  3PYA A;  3ZL6 A;  1DGP A;  2Q58 A;  3WCD A;  2Z52 A;  5IK0 A;  2VF6 A;  5DGS F;  3Q2Z A;  4F6V A;  5ERO A;  4E1E A;  3KRA B;  3SDR A;  5ILY A;  3BNY A;  3VJE A;  3N3D A;  2P1C A;  3LGK A;  5B00 A;  2DH4 A;  3ACW A;  4JZX A;  3N1W F;  1N22 A;  4P0X A;  1EZF A;  5JV0 F;  1WMW A;  2E90 A;  3KRO B;  1RQJ A;  3EFQ A;  3LK5 A;  1UBV A;  3WCG A;  5AHU B;  5DHI A;  4OKZ A;  4K10 A;  3AQB B;  4H5E F;  4HD1 A;  3N3L F;  3M01 A;  3BNX A;  5DHK A;  4LFG A;  1WL3 A;  4NUA A;  5AEL A;  1PS1 A;  3WCB A;  3RYE A;  2ZCO A;  4OKM A;  4WK5 A;  5IN8 A;  3Q1O A;  4L2X F;  5JA0 F;  3LVS A;  3LSN A;  1VG4 A;  3WEG A;  2ZEU A;  2J1O A;  5DGM F;  5ILI A;  5IL3 A;  1UBX A;  2PS4 A;  2Z78 A;  4LXW A;  3ACX A;  3PKO A;  5ILJ A;  5E8L A;  1HXG A;  3ADZ A;  3G4F A;  1HM7 A;  4E9Z A;  1V4K A;  3QQV A;  3TS7 A;  3P5P A;  3WEK A;  4NG6 A;  2E94 A;  1N24 A;  2Z4Y A;  4DI5 A;  5DJR F;  4KKM A;  5HNA A;  3KRA A;  1WL2 A;  3RBM A;  3SDU A;  4LPG F;  2E8U A;  4MC3 A;  1WL0 A;  3PYB A;  4NFK F;  3KRP B;  4RNQ A;  1N23 A;  1KIZ A;  3M02 A;  4EA0 A;  2OPN A;  3ICK A;  2Z7I A;  1UBW A;  2F89 F;  2ZY1 A;  4PVY F;  3LDW A;  2AZK A;  3WJN A;  5H9D A;  3WJO A;  3KRO A;  2PS5 A;  4RXE A;  3WEH A;  1ZW5 A;  1FPS A;  5JV1 F;  4JVJ F;  5EAU A;  4F62 A;  4LFV F;  4RXD A;  3N5J F;  5DIQ F;  1N21 A;  3NRI A;  3MAV A;  1V4I A;  3N0F A;  3LEE A;  5AFX A;  5CG5 A;  4LA5 A;  3AQ0 A;  2ONG A;  4OMH A;  2E4O A;  4LLS A;  3RYW A;  3SAE A;  4LIX A;  1HXA A;  3AQC B;  4JXY A;  2FTZ A;  3ZCD A;  2F7M F;  3IPI A;  2Z4W A;  2AET A;  5ERN A;  4GP1 A;  5IMI A;  1N1Z A;  2OPM A;  2E8V A;  5DJV F;  3WCM A;  5EAS A;  4F6X A;  5ILD A;  3RMG A;  1HXC A;  4LZ0 A;  3M9U A;  2ZCS A;  4ZQ8 A;  3OAC A;  5A0J A;  1JFA A;  3IBA A;  4FJQ A;  4MC8 A;  1YHM A;  4DEM F;  3DYG A;  2ONH A;  1RQI A;  3WEI A;  2E8X A;  4LA6 A;  4LLT A;  3WCC A;  5A0I A;  1V4E A;  3KB9 A;  3ICM A;  1YJ4 A;  4GAX A;  2EWG A;  1YYU A;  3ICZ A;  2Z4X A;  4UMJ A;  3Q2Q A;  2E92 A;  4OGU A;  4N1Z F;  2QIS A;  4LUU A;  5HN7 A;  5B0K A;  3LLW A;  4FP4 A;  3OAB B;  5IVG A;  2ZCQ A;  5B01 A;  4LZC A;  2ZCR A;  4QPF A;  5DW7 A;  4N9U A;  3V1V A;  3NPK A;  4LOB A;  2FOR A;  5CG6 A;  4KWD A;  2F9K F;  3VJ9 A;  5IK9 A;  3KRF A;  2F8Z F;  2H8O A;  1YQ7 A;  3TFN A;  5DJP F;  5JUZ F;  4H5C F;  3N46 F;  5I1U A;  4LZ3 A;  1VG7 A;  3LMD A;  4KVD A;  3Q30 A;  3VJ8 A;  3LZ9 A;  5B0M A;  2AEL A;  1HX9 A;  4LFE A;  1WKZ A;  1KIY A;  1JFG A;  4GP2 A;  3V1X A;  2Q9Y A;  3LGZ B;  3WCJ A;  3VJD A;  3N5H F;  3DYF A;  2J1P A;  4Q23 A;  4JZB A;  5EAT A;  5JV2 F;  1N20 A;  3WE9 A;  3VJA A;  4KVI A;  2E91 A;  5DZ2 A;  3WEF A;  3TFV A;  2AZJ A;  3CC9 A;  1YYS A;  3ICN A;  3LG5 A;  1RTR A;  4KVW A;  3WCA A;  5AYP A;  3LOM A;  3WJK A;  5C05 A;  2Z4V A;  5B0J A;  4KQS A;  3WSA A;  2E8T A;  5IKA A;  5IM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...