3AQCB

M. luteus b-p 26 heterodimeric hexaprenyl diphosphate synthase in complex with magnesium and fpp analogue
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
321
structure length
321
Chain Sequence
SYKAFLNPYIIEVEKRLYECIQSDSETINKAAHHILSSGGKRVRPMFVLLSGFLNDTQKDDLIRTAVSLELVHMASLVHDDYIDNSDMRRGNTSVHIAFDKDTAIRTGHFLLARALQNIATINNSKFHQIFSKTILEVCFGEFDQMADRFNYPVSFTAYLRRINRKTAILIEASCHLGALSSQLDEQSTYHIKQFGHCIGMSYQIIDDILDYTSDEATLGKPVGSDIRNGHITYPLMAAIANLKEQDDDKLEAVVKHLTSTSDDEVYQYIVSQVKQYGIEPAELLSRKYGDKAKYHLSQLQDSNIKDYLEEIHEKMLKRVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Component A of hexaprenyl diphosphate synthase
publication title Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
pubmed doi rcsb
source organism Micrococcus luteus
total genus 126
structure length 321
sequence length 321
chains with identical sequence D
ec nomenclature ec 2.5.1.83: Hexaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific).
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3aqcB00
4EA1A 1PS1A 3ASXA 1YV5A 1KIYA 3LG5A 3VJDA 3NPKA 3KRCA 2Z50A 2QISA 4JXYA 4QXSF 3WCJA 4KUXA 5IMIA 4KQSA 3OACB 2AZJA 2Q58A 1V4JA 4FP4A 5C05A 5IK6A 4NFIF 2J1OA 3OYRA 4RXCA 1DGPA 5DGMF 3P8LA 3IBAA 4DEMF 2AZKA 3PYAA 4DZWA 3LLWA 3WJOA 3M9UA 3N5HF 2Z4ZA 2PS8A 1YYUA 3LZ9A 4JZBA 4NFKF 5DJRF 2F7MF 1WL3A 3DYFA 4LPGF 4LTVA 1VG7A 3B7LA 4P0WA 4KVIA 3N3DA 3NPRA 1N23A 5A0IA 2OA6A 4NFJF 4XQRF 3RMGA 4XQTF 3WCIA 5AFXA 3KRCB 4L2XF 4LZCA 3TFPA 4NKEA 3SDVA 3WEGA 1RQJA 3P41A 5IVGA 2AETA 2AELA 4UMJA 4F6XA 5B01A 2O1OA 2E90A 3KB9A 2ONHA 2F8CF 4RYPA 3WCHA 5IKAA 3WEKA 4LOBA 4DXJA 5ILJA 2PS6A 3SDQA 3VJ8A 4LUUA 3ZMBA 3NF2A 4P0VA 3W7FA 4QPFA 4E1EA 3KROA 3ZMCA 3DYGA 3QKCA 3LMDA 3ACYA 3N6KF 4GP2A 3KBKA 1YYTA 3ID0A 3N5JF 3VJBA 1WY0A 4LPHF 2ZEUA 3LOMA 4LZ0A 4KVWA 5I1UA 2Z7IA 2E93A 1YYSA 4JVJF 5ILYA 5DIQF 2H8OA 1RQIA 3SDUA 1UBWA 1ZW5A 3KRAA 3WCDA 5IK0A 4LTZA 3EGTA 2DH4A 4NG6A 3WCCA 3WCAA 1N20A 1WL0A 2ZCSA 2E8VA 2OPMA 3Q30A 1YYQA 3S9VA 3CKEA 3ICKA 2AZLA 5DHKA 2RAHA 5IMNA 2J1PA 3WSBA 4WK5A 4LA6A 4N1ZF 3LDWA 3N3LF 3KROB 4KQ5A 2ZY1A 2E92A 2E8WA 4LXWA 5EASA 2Z4WA 3NRIA 2ZEVA 3MAVA 2F92F 3WCGA 5EATA 1DI1A 5H9DA 3WCEA 4LFVF 3EZ3A 2Z52A 3OABA 1HX9A 2E94A 3G4DA 4OMHA 3VJAA 3ADZA 3P5PA 1YHKA 3AQCB 1V4IA 3KRAB 3VJ9A 4NKFA 3WCBA 5B02A 1HXAA 1YHLA 3N45F 5DJPF 1WL1A 3PKOA 4N9UA 3WCMA 4FJQA 3S4JA 3VJEA 3WCFA 5IL8A 5A0KA 1FPSA 3KRPA 3APZA 2OPNA 1N24A 5HN8A 3N1VF 4JXNA 4DWBA 2E95A 4MC8A 1RTRA 3ICMA 1V4EA 3M02A 1N21A 3ICZA 2ZCQA 2EWGA 4KPDA 4EA0A 3SDTA 2E8UA 3RBMA 3WJKA 3LEEA 2AEKA 3WEHA 3ACXA 3LJIA 3Q2ZA 5B0KA 3OABB 2F89F 5CG5A 3QQVA 3WC9A 3WEFA 2F9KF 1WMWA 1JFAA 2PS4A 4EA2A 4RXAA 4JZXA 5DGSF 3KRPB 1VG2A 3LK5A 4XQSF 2Z4YA 2Q80A 3N0GA 4H5DF 5DW7A 5AHUB 4KK2A 2Z78A 3ZL6A 4LZ3A 4E9UA 1KIZA 4RXDA 5JV1F 2ONGA 3RYWA 3MZVA 5ERMA 2P1CA 4LIXA 2F94F 3EFQA 4KWDA 2E4OA 2Q9YA 4MC0A 5ILKA 4LLTA 5KSXF 2F8ZF 3ACWA 3KRFA 3N0FA 5EROA 3SAEA 5A0JA 2I19A 1V4KA 3M00A 5ILZA 3BNYA 4NUAA 4LFGA 5IL3A 5JA0F 3P5RA 3PH7A 1UBVA 5ER8A 3DYHA 2FORA 3M0GA 5JV0F 3SDRA 5DJVF 1VG6A 4DWGA 5JUZF 3ZOUA 3TFVA 4LFEA 3RYEA 3IPIA 4GAXA 5IN8A 1N22A 5IKHA 1HXGA 1JFGA 3V1XA 5AYPA 5ILDA 4H5EF 5JV2F 1N1BA 4H5CF 3TS7A 4MC3A 3BNXA 2ZCOA 3TFNA 4Q23A 4GA3A 2VF6A 5ILHA 4E9ZA 2PS5A 3N1WF 5ILIA 1UBYA 3LGKA 3KRFB 3WCLA 4PVYF 3WE9A 5E8HA 5E8KA 5B0LA 3ICNA 4KVYA 3TC1A 2Z4XA 3AQBB 1WL2A 2PS7A 4OMGA 5CG6A 4KKMA 3M01A 5EAUA 3N49F 3WEIA 1UBXA 3AQ0A 4JYXA 1VG4A 3WEJA 3Q2QA 1HXCA 5IMPA 5DGNF 3AE0A 1EZFA 4HD1A 4OKZA 3CP6A 1HM7A 2E8XA 3WJNA 3VJCA 5AELA 1HM4A 4KQUA 4RXEA 2Q9ZA 1N1ZA 1V4HA 1YJ4A 3WSAA 4LLSA 3PDEA 3OACA 2Z7HA 5DHIA 5B0JA 3LSNA 4RNQA 4DHDA 4P0XA 2FTZA 3P8RA 1YQ7A 2Z4VA 5HN7A 2E91A 4K10A 1YHMA 3CC9A 5B00A 4GP1A 4DI5A 4PVXF 5HN9A 2OGDA 5B03A 4LA5A 2ZCRA 3V1VA 3UCAA 4F62A 2E8TA 4KFAA 5IM1A 3G4FA 1VG3A 3LVSA 3N46F 4KPJA 5B0MA 4F6VA 4ZQ8A 1WKZA 3PYBA 5ERNA 4OGUA 4OKMA 3ZCDA 5HNAA 3V66A 5IK9A 5DZ2A 2J5CA 3Q1OA 5B0IA 5E8LA 1YYRA 3LGZB 4KVDA
chains in the Genus database with same CATH superfamily
4EA1A 1PS1A 3ASXA 1YV5A 1KIYA 3LG5A 3VJDA 3NPKA 3KRCA 2Z50A 2QISA 4JXYA 4QXSF 3WCJA 4KUXA 5IMIA 4KQSA 3OACB 2AZJA 2Q58A 1V4JA 4FP4A 5C05A 5IK6A 4NFIF 2J1OA 3OYRA 4RXCA 1DGPA 5DGMF 3P8LA 3IBAA 4DEMF 2AZKA 3PYAA 4DZWA 3LLWA 3WJOA 3M9UA 3N5HF 2Z4ZA 2PS8A 1YYUA 3LZ9A 4JZBA 4NFKF 5DJRF 2F7MF 1WL3A 3DYFA 4LPGF 4LTVA 1VG7A 3B7LA 4P0WA 4KVIA 3N3DA 3NPRA 1N23A 5A0IA 2OA6A 4NFJF 4XQRF 3RMGA 4XQTF 3WCIA 5AFXA 3KRCB 4L2XF 4LZCA 3TFPA 4NKEA 3SDVA 3WEGA 1RQJA 3P41A 5IVGA 2AETA 2AELA 4UMJA 4F6XA 5B01A 2O1OA 2E90A 3KB9A 2ONHA 2F8CF 4RYPA 3WCHA 5IKAA 3WEKA 4LOBA 4DXJA 5ILJA 2PS6A 3SDQA 3VJ8A 4LUUA 3ZMBA 3NF2A 4P0VA 3W7FA 4QPFA 4E1EA 3KROA 3ZMCA 3DYGA 3QKCA 3LMDA 3ACYA 3N6KF 4GP2A 3KBKA 1YYTA 3ID0A 3N5JF 3VJBA 1WY0A 4LPHF 2ZEUA 3LOMA 4LZ0A 4KVWA 5I1UA 2Z7IA 2E93A 1YYSA 4JVJF 5ILYA 5DIQF 2H8OA 1RQIA 3SDUA 1UBWA 1ZW5A 3KRAA 3WCDA 5IK0A 4LTZA 3EGTA 2DH4A 4NG6A 3WCCA 3WCAA 1N20A 1WL0A 2ZCSA 2E8VA 2OPMA 3Q30A 1YYQA 3S9VA 3CKEA 3ICKA 2AZLA 5DHKA 2RAHA 5IMNA 2J1PA 3WSBA 4WK5A 4LA6A 4N1ZF 3LDWA 3N3LF 3KROB 4KQ5A 2ZY1A 2E92A 2E8WA 4LXWA 5EASA 2Z4WA 3NRIA 2ZEVA 3MAVA 2F92F 3WCGA 5EATA 1DI1A 5H9DA 3WCEA 4LFVF 3EZ3A 2Z52A 3OABA 1HX9A 2E94A 3G4DA 4OMHA 3VJAA 3ADZA 3P5PA 1YHKA 3AQCB 1V4IA 3KRAB 3VJ9A 4NKFA 3WCBA 5B02A 1HXAA 1YHLA 3N45F 5DJPF 1WL1A 3PKOA 4N9UA 3WCMA 4FJQA 3S4JA 3VJEA 3WCFA 5IL8A 5A0KA 1FPSA 3KRPA 3APZA 2OPNA 1N24A 5HN8A 3N1VF 4JXNA 4DWBA 2E95A 4MC8A 1RTRA 3ICMA 1V4EA 3M02A 1N21A 3ICZA 2ZCQA 2EWGA 4KPDA 4EA0A 3SDTA 2E8UA 3RBMA 3WJKA 3LEEA 2AEKA 3WEHA 3ACXA 3LJIA 3Q2ZA 5B0KA 3OABB 2F89F 5CG5A 3QQVA 3WC9A 3WEFA 2F9KF 1WMWA 1JFAA 2PS4A 4EA2A 4RXAA 4JZXA 5DGSF 3KRPB 1VG2A 3LK5A 4XQSF 2Z4YA 2Q80A 3N0GA 4H5DF 5DW7A 5AHUB 4KK2A 2Z78A 3ZL6A 4LZ3A 4E9UA 1KIZA 4RXDA 5JV1F 2ONGA 3RYWA 3MZVA 5ERMA 2P1CA 4LIXA 2F94F 3EFQA 4KWDA 2E4OA 2Q9YA 4MC0A 5ILKA 4LLTA 5KSXF 2F8ZF 3ACWA 3KRFA 3N0FA 5EROA 3SAEA 5A0JA 2I19A 1V4KA 3M00A 5ILZA 3BNYA 4NUAA 4LFGA 5IL3A 5JA0F 3P5RA 3PH7A 1UBVA 5ER8A 3DYHA 2FORA 3M0GA 5JV0F 3SDRA 5DJVF 1VG6A 4DWGA 5JUZF 3ZOUA 3TFVA 4LFEA 3RYEA 3IPIA 4GAXA 5IN8A 1N22A 5IKHA 1HXGA 1JFGA 3V1XA 5AYPA 5ILDA 4H5EF 5JV2F 1N1BA 4H5CF 3TS7A 4MC3A 3BNXA 2ZCOA 3TFNA 4Q23A 4GA3A 2VF6A 5ILHA 4E9ZA 2PS5A 3N1WF 5ILIA 1UBYA 3LGKA 3KRFB 3WCLA 4PVYF 3WE9A 5E8HA 5E8KA 5B0LA 3ICNA 4KVYA 3TC1A 2Z4XA 3AQBB 1WL2A 2PS7A 4OMGA 5CG6A 4KKMA 3M01A 5EAUA 3N49F 3WEIA 1UBXA 3AQ0A 4JYXA 1VG4A 3WEJA 3Q2QA 1HXCA 5IMPA 5DGNF 3AE0A 1EZFA 4HD1A 4OKZA 3CP6A 1HM7A 2E8XA 3WJNA 3VJCA 5AELA 1HM4A 4KQUA 4RXEA 2Q9ZA 1N1ZA 1V4HA 1YJ4A 3WSAA 4LLSA 3PDEA 3OACA 2Z7HA 5DHIA 5B0JA 3LSNA 4RNQA 4DHDA 4P0XA 2FTZA 3P8RA 1YQ7A 2Z4VA 5HN7A 2E91A 4K10A 1YHMA 3CC9A 5B00A 4GP1A 4DI5A 4PVXF 5HN9A 2OGDA 5B03A 4LA5A 2ZCRA 3V1VA 3UCAA 4F62A 2E8TA 4KFAA 5IM1A 3G4FA 1VG3A 3LVSA 3N46F 4KPJA 5B0MA 4F6VA 4ZQ8A 1WKZA 3PYBA 5ERNA 4OGUA 4OKMA 3ZCDA 5HNAA 3V66A 5IK9A 5DZ2A 2J5CA 3Q1OA 5B0IA 5E8LA 1YYRA 3LGZB 4KVDA
chains in the Genus database with same CATH topology
4EA1A 1PS1A 3ASXA 1YV5A 1KIYA 3LG5A 3VJDA 3NPKA 3KRCA 2Z50A 2QISA 4JXYA 4QXSF 3WCJA 4KUXA 5IMIA 4KQSA 3OACB 2AZJA 2Q58A 1V4JA 4FP4A 5C05A 5IK6A 4NFIF 2J1OA 3OYRA 4RXCA 1DGPA 5DGMF 3P8LA 3IBAA 4DEMF 2AZKA 3PYAA 4DZWA 3LLWA 3WJOA 3M9UA 3N5HF 2Z4ZA 2PS8A 1YYUA 3LZ9A 4JZBA 4NFKF 5DJRF 2F7MF 1WL3A 3DYFA 4LPGF 4LTVA 1VG7A 3B7LA 4P0WA 4KVIA 3N3DA 3NPRA 1N23A 5A0IA 2OA6A 4NFJF 4XQRF 3RMGA 4XQTF 3WCIA 5AFXA 3KRCB 4L2XF 4LZCA 3TFPA 4NKEA 3SDVA 3WEGA 1RQJA 3P41A 5IVGA 2AETA 2AELA 4UMJA 4F6XA 5B01A 2O1OA 2E90A 3KB9A 2ONHA 2F8CF 4RYPA 3WCHA 5IKAA 3WEKA 4LOBA 4DXJA 5ILJA 2PS6A 3SDQA 3VJ8A 4LUUA 3ZMBA 3NF2A 4P0VA 3W7FA 4QPFA 4E1EA 3KROA 3ZMCA 3DYGA 3QKCA 3LMDA 3ACYA 3N6KF 4GP2A 3KBKA 1YYTA 3ID0A 3N5JF 3VJBA 1WY0A 4LPHF 2ZEUA 3LOMA 4LZ0A 4KVWA 5I1UA 2Z7IA 2E93A 1YYSA 4JVJF 5ILYA 5DIQF 2H8OA 1RQIA 3SDUA 1UBWA 1ZW5A 3KRAA 3WCDA 5IK0A 4LTZA 3EGTA 2DH4A 4NG6A 3WCCA 3WCAA 1N20A 1WL0A 2ZCSA 2E8VA 2OPMA 3Q30A 1YYQA 3S9VA 3CKEA 3ICKA 2AZLA 5DHKA 2RAHA 5IMNA 2J1PA 3WSBA 4WK5A 4LA6A 4N1ZF 3LDWA 3N3LF 3KROB 4KQ5A 2ZY1A 2E92A 2E8WA 4LXWA 5EASA 2Z4WA 3NRIA 2ZEVA 3MAVA 2F92F 3WCGA 5EATA 1DI1A 5H9DA 3WCEA 4LFVF 3EZ3A 2Z52A 3OABA 1HX9A 2E94A 3G4DA 4OMHA 3VJAA 3ADZA 3P5PA 1YHKA 3AQCB 1V4IA 3KRAB 3VJ9A 4NKFA 3WCBA 5B02A 1HXAA 1YHLA 3N45F 5DJPF 1WL1A 3PKOA 4N9UA 3WCMA 4FJQA 3S4JA 3VJEA 3WCFA 5IL8A 5A0KA 1FPSA 3KRPA 3APZA 2OPNA 1N24A 5HN8A 3N1VF 4JXNA 4DWBA 2E95A 4MC8A 1RTRA 3ICMA 1V4EA 3M02A 1N21A 3ICZA 2ZCQA 2EWGA 4KPDA 4EA0A 3SDTA 2E8UA 3RBMA 3WJKA 3LEEA 2AEKA 3WEHA 3ACXA 3LJIA 3Q2ZA 5B0KA 3OABB 2F89F 5CG5A 3QQVA 3WC9A 3WEFA 2F9KF 1WMWA 1JFAA 2PS4A 4EA2A 4RXAA 4JZXA 5DGSF 3KRPB 1VG2A 3LK5A 4XQSF 2Z4YA 2Q80A 3N0GA 4H5DF 5DW7A 5AHUB 4KK2A 2Z78A 3ZL6A 4LZ3A 4E9UA 1KIZA 4RXDA 5JV1F 2ONGA 3RYWA 3MZVA 5ERMA 2P1CA 4LIXA 2F94F 3EFQA 4KWDA 2E4OA 2Q9YA 4MC0A 5ILKA 4LLTA 5KSXF 2F8ZF 3ACWA 3KRFA 3N0FA 5EROA 3SAEA 5A0JA 2I19A 1V4KA 3M00A 5ILZA 3BNYA 4NUAA 4LFGA 5IL3A 5JA0F 3P5RA 3PH7A 1UBVA 5ER8A 3DYHA 2FORA 3M0GA 5JV0F 3SDRA 5DJVF 1VG6A 4DWGA 5JUZF 3ZOUA 3TFVA 4LFEA 3RYEA 3IPIA 4GAXA 5IN8A 1N22A 5IKHA 1HXGA 1JFGA 3V1XA 5AYPA 5ILDA 4H5EF 5JV2F 1N1BA 4H5CF 3TS7A 4MC3A 3BNXA 2ZCOA 3TFNA 4Q23A 4GA3A 2VF6A 5ILHA 4E9ZA 2PS5A 3N1WF 5ILIA 1UBYA 3LGKA 3KRFB 3WCLA 4PVYF 3WE9A 5E8HA 5E8KA 5B0LA 3ICNA 4KVYA 3TC1A 2Z4XA 3AQBB 1WL2A 2PS7A 4OMGA 5CG6A 4KKMA 3M01A 5EAUA 3N49F 3WEIA 1UBXA 3AQ0A 4JYXA 1VG4A 3WEJA 3Q2QA 1HXCA 5IMPA 5DGNF 3AE0A 1EZFA 4HD1A 4OKZA 3CP6A 1HM7A 2E8XA 3WJNA 3VJCA 5AELA 1HM4A 4KQUA 4RXEA 2Q9ZA 1N1ZA 1V4HA 1YJ4A 3WSAA 4LLSA 3PDEA 3OACA 2Z7HA 5DHIA 5B0JA 3LSNA 4RNQA 4DHDA 4P0XA 2FTZA 3P8RA 1YQ7A 2Z4VA 5HN7A 2E91A 4K10A 1YHMA 3CC9A 5B00A 4GP1A 4DI5A 4PVXF 5HN9A 2OGDA 5B03A 4LA5A 2ZCRA 3V1VA 3UCAA 4F62A 2E8TA 4KFAA 5IM1A 3G4FA 1VG3A 3LVSA 3N46F 4KPJA 5B0MA 4F6VA 4ZQ8A 1WKZA 3PYBA 5ERNA 4OGUA 4OKMA 3ZCDA 5HNAA 3V66A 5IK9A 5DZ2A 2J5CA 3Q1OA 5B0IA 5E8LA 1YYRA 3LGZB 4KVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EA1 A;  1PS1 A;  3ASX A;  1YV5 A;  1KIY A;  3LG5 A;  3VJD A;  3NPK A;  3KRC A;  2Z50 A;  2QIS A;  4JXY A;  4QXS F;  3WCJ A;  4KUX A;  5IMI A;  4KQS A;  3OAC B;  2AZJ A;  2Q58 A;  1V4J A;  4FP4 A;  5C05 A;  5IK6 A;  4NFI F;  2J1O A;  3OYR A;  4RXC A;  1DGP A;  5DGM F;  3P8L A;  3IBA A;  4DEM F;  2AZK A;  3PYA A;  4DZW A;  3LLW A;  3WJO A;  3M9U A;  3N5H F;  2Z4Z A;  2PS8 A;  1YYU A;  3LZ9 A;  4JZB A;  4NFK F;  5DJR F;  2F7M F;  1WL3 A;  3DYF A;  4LPG F;  4LTV A;  1VG7 A;  3B7L A;  4P0W A;  4KVI A;  3N3D A;  3NPR A;  1N23 A;  5A0I A;  2OA6 A;  4NFJ F;  4XQR F;  3RMG A;  4XQT F;  3WCI A;  5AFX A;  3KRC B;  4L2X F;  4LZC A;  3TFP A;  4NKE A;  3SDV A;  3WEG A;  1RQJ A;  3P41 A;  5IVG A;  2AET A;  2AEL A;  4UMJ A;  4F6X A;  5B01 A;  2O1O A;  2E90 A;  3KB9 A;  2ONH A;  2F8C F;  4RYP A;  3WCH A;  5IKA A;  3WEK A;  4LOB A;  4DXJ A;  5ILJ A;  2PS6 A;  3SDQ A;  3VJ8 A;  4LUU A;  3ZMB A;  3NF2 A;  4P0V A;  3W7F A;  4QPF A;  4E1E A;  3KRO A;  3ZMC A;  3DYG A;  3QKC A;  3LMD A;  3ACY A;  3N6K F;  4GP2 A;  3KBK A;  1YYT A;  3ID0 A;  3N5J F;  3VJB A;  1WY0 A;  4LPH F;  2ZEU A;  3LOM A;  4LZ0 A;  4KVW A;  5I1U A;  2Z7I A;  2E93 A;  1YYS A;  4JVJ F;  5ILY A;  5DIQ F;  2H8O A;  1RQI A;  3SDU A;  1UBW A;  1ZW5 A;  3KRA A;  3WCD A;  5IK0 A;  4LTZ A;  3EGT A;  2DH4 A;  4NG6 A;  3WCC A;  3WCA A;  1N20 A;  1WL0 A;  2ZCS A;  2E8V A;  2OPM A;  3Q30 A;  1YYQ A;  3S9V A;  3CKE A;  3ICK A;  2AZL A;  5DHK A;  2RAH A;  5IMN A;  2J1P A;  3WSB A;  4WK5 A;  4LA6 A;  4N1Z F;  3LDW A;  3N3L F;  3KRO B;  4KQ5 A;  2ZY1 A;  2E92 A;  2E8W A;  4LXW A;  5EAS A;  2Z4W A;  3NRI A;  2ZEV A;  3MAV A;  2F92 F;  3WCG A;  5EAT A;  1DI1 A;  5H9D A;  3WCE A;  4LFV F;  3EZ3 A;  2Z52 A;  3OAB A;  1HX9 A;  2E94 A;  3G4D A;  4OMH A;  3VJA A;  3ADZ A;  3P5P A;  1YHK A;  3AQC B;  1V4I A;  3KRA B;  3VJ9 A;  4NKF A;  3WCB A;  5B02 A;  1HXA A;  1YHL A;  3N45 F;  5DJP F;  1WL1 A;  3PKO A;  4N9U A;  3WCM A;  4FJQ A;  3S4J A;  3VJE A;  3WCF A;  5IL8 A;  5A0K A;  1FPS A;  3KRP A;  3APZ A;  2OPN A;  1N24 A;  5HN8 A;  3N1V F;  4JXN A;  4DWB A;  2E95 A;  4MC8 A;  1RTR A;  3ICM A;  1V4E A;  3M02 A;  1N21 A;  3ICZ A;  2ZCQ A;  2EWG A;  4KPD A;  4EA0 A;  3SDT A;  2E8U A;  3RBM A;  3WJK A;  3LEE A;  2AEK A;  3WEH A;  3ACX A;  3LJI A;  3Q2Z A;  5B0K A;  3OAB B;  2F89 F;  5CG5 A;  3QQV A;  3WC9 A;  3WEF A;  2F9K F;  1WMW A;  1JFA A;  2PS4 A;  4EA2 A;  4RXA A;  4JZX A;  5DGS F;  3KRP B;  1VG2 A;  3LK5 A;  4XQS F;  2Z4Y A;  2Q80 A;  3N0G A;  4H5D F;  5DW7 A;  5AHU B;  4KK2 A;  2Z78 A;  3ZL6 A;  4LZ3 A;  4E9U A;  1KIZ A;  4RXD A;  5JV1 F;  2ONG A;  3RYW A;  3MZV A;  5ERM A;  2P1C A;  4LIX A;  2F94 F;  3EFQ A;  4KWD A;  2E4O A;  2Q9Y A;  4MC0 A;  5ILK A;  4LLT A;  5KSX F;  2F8Z F;  3ACW A;  3KRF A;  3N0F A;  5ERO A;  3SAE A;  5A0J A;  2I19 A;  1V4K A;  3M00 A;  5ILZ A;  3BNY A;  4NUA A;  4LFG A;  5IL3 A;  5JA0 F;  3P5R A;  3PH7 A;  1UBV A;  5ER8 A;  3DYH A;  2FOR A;  3M0G A;  5JV0 F;  3SDR A;  5DJV F;  1VG6 A;  4DWG A;  5JUZ F;  3ZOU A;  3TFV A;  4LFE A;  3RYE A;  3IPI A;  4GAX A;  5IN8 A;  1N22 A;  5IKH A;  1HXG A;  1JFG A;  3V1X A;  5AYP A;  5ILD A;  4H5E F;  5JV2 F;  1N1B A;  4H5C F;  3TS7 A;  4MC3 A;  3BNX A;  2ZCO A;  3TFN A;  4Q23 A;  4GA3 A;  2VF6 A;  5ILH A;  4E9Z A;  2PS5 A;  3N1W F;  5ILI A;  1UBY A;  3LGK A;  3KRF B;  3WCL A;  4PVY F;  3WE9 A;  5E8H A;  5E8K A;  5B0L A;  3ICN A;  4KVY A;  3TC1 A;  2Z4X A;  3AQB B;  1WL2 A;  2PS7 A;  4OMG A;  5CG6 A;  4KKM A;  3M01 A;  5EAU A;  3N49 F;  3WEI A;  1UBX A;  3AQ0 A;  4JYX A;  1VG4 A;  3WEJ A;  3Q2Q A;  1HXC A;  5IMP A;  5DGN F;  3AE0 A;  1EZF A;  4HD1 A;  4OKZ A;  3CP6 A;  1HM7 A;  2E8X A;  3WJN A;  3VJC A;  5AEL A;  1HM4 A;  4KQU A;  4RXE A;  2Q9Z A;  1N1Z A;  1V4H A;  1YJ4 A;  3WSA A;  4LLS A;  3PDE A;  3OAC A;  2Z7H A;  5DHI A;  5B0J A;  3LSN A;  4RNQ A;  4DHD A;  4P0X A;  2FTZ A;  3P8R A;  1YQ7 A;  2Z4V A;  5HN7 A;  2E91 A;  4K10 A;  1YHM A;  3CC9 A;  5B00 A;  4GP1 A;  4DI5 A;  4PVX F;  5HN9 A;  2OGD A;  5B03 A;  4LA5 A;  2ZCR A;  3V1V A;  3UCA A;  4F62 A;  2E8T A;  4KFA A;  5IM1 A;  3G4F A;  1VG3 A;  3LVS A;  3N46 F;  4KPJ A;  5B0M A;  4F6V A;  4ZQ8 A;  1WKZ A;  3PYB A;  5ERN A;  4OGU A;  4OKM A;  3ZCD A;  5HNA A;  3V66 A;  5IK9 A;  5DZ2 A;  2J5C A;  3Q1O A;  5B0I A;  5E8L A;  1YYR A;  3LGZ B;  4KVD A; 
#chains in the Genus database with same CATH topology
 4EA1 A;  1PS1 A;  3ASX A;  1YV5 A;  1KIY A;  3LG5 A;  3VJD A;  3NPK A;  3KRC A;  2Z50 A;  2QIS A;  4JXY A;  4QXS F;  3WCJ A;  4KUX A;  5IMI A;  4KQS A;  3OAC B;  2AZJ A;  2Q58 A;  1V4J A;  4FP4 A;  5C05 A;  5IK6 A;  4NFI F;  2J1O A;  3OYR A;  4RXC A;  1DGP A;  5DGM F;  3P8L A;  3IBA A;  4DEM F;  2AZK A;  3PYA A;  4DZW A;  3LLW A;  3WJO A;  3M9U A;  3N5H F;  2Z4Z A;  2PS8 A;  1YYU A;  3LZ9 A;  4JZB A;  4NFK F;  5DJR F;  2F7M F;  1WL3 A;  3DYF A;  4LPG F;  4LTV A;  1VG7 A;  3B7L A;  4P0W A;  4KVI A;  3N3D A;  3NPR A;  1N23 A;  5A0I A;  2OA6 A;  4NFJ F;  4XQR F;  3RMG A;  4XQT F;  3WCI A;  5AFX A;  3KRC B;  4L2X F;  4LZC A;  3TFP A;  4NKE A;  3SDV A;  3WEG A;  1RQJ A;  3P41 A;  5IVG A;  2AET A;  2AEL A;  4UMJ A;  4F6X A;  5B01 A;  2O1O A;  2E90 A;  3KB9 A;  2ONH A;  2F8C F;  4RYP A;  3WCH A;  5IKA A;  3WEK A;  4LOB A;  4DXJ A;  5ILJ A;  2PS6 A;  3SDQ A;  3VJ8 A;  4LUU A;  3ZMB A;  3NF2 A;  4P0V A;  3W7F A;  4QPF A;  4E1E A;  3KRO A;  3ZMC A;  3DYG A;  3QKC A;  3LMD A;  3ACY A;  3N6K F;  4GP2 A;  3KBK A;  1YYT A;  3ID0 A;  3N5J F;  3VJB A;  1WY0 A;  4LPH F;  2ZEU A;  3LOM A;  4LZ0 A;  4KVW A;  5I1U A;  2Z7I A;  2E93 A;  1YYS A;  4JVJ F;  5ILY A;  5DIQ F;  2H8O A;  1RQI A;  3SDU A;  1UBW A;  1ZW5 A;  3KRA A;  3WCD A;  5IK0 A;  4LTZ A;  3EGT A;  2DH4 A;  4NG6 A;  3WCC A;  3WCA A;  1N20 A;  1WL0 A;  2ZCS A;  2E8V A;  2OPM A;  3Q30 A;  1YYQ A;  3S9V A;  3CKE A;  3ICK A;  2AZL A;  5DHK A;  2RAH A;  5IMN A;  2J1P A;  3WSB A;  4WK5 A;  4LA6 A;  4N1Z F;  3LDW A;  3N3L F;  3KRO B;  4KQ5 A;  2ZY1 A;  2E92 A;  2E8W A;  4LXW A;  5EAS A;  2Z4W A;  3NRI A;  2ZEV A;  3MAV A;  2F92 F;  3WCG A;  5EAT A;  1DI1 A;  5H9D A;  3WCE A;  4LFV F;  3EZ3 A;  2Z52 A;  3OAB A;  1HX9 A;  2E94 A;  3G4D A;  4OMH A;  3VJA A;  3ADZ A;  3P5P A;  1YHK A;  3AQC B;  1V4I A;  3KRA B;  3VJ9 A;  4NKF A;  3WCB A;  5B02 A;  1HXA A;  1YHL A;  3N45 F;  5DJP F;  1WL1 A;  3PKO A;  4N9U A;  3WCM A;  4FJQ A;  3S4J A;  3VJE A;  3WCF A;  5IL8 A;  5A0K A;  1FPS A;  3KRP A;  3APZ A;  2OPN A;  1N24 A;  5HN8 A;  3N1V F;  4JXN A;  4DWB A;  2E95 A;  4MC8 A;  1RTR A;  3ICM A;  1V4E A;  3M02 A;  1N21 A;  3ICZ A;  2ZCQ A;  2EWG A;  4KPD A;  4EA0 A;  3SDT A;  2E8U A;  3RBM A;  3WJK A;  3LEE A;  2AEK A;  3WEH A;  3ACX A;  3LJI A;  3Q2Z A;  5B0K A;  3OAB B;  2F89 F;  5CG5 A;  3QQV A;  3WC9 A;  3WEF A;  2F9K F;  1WMW A;  1JFA A;  2PS4 A;  4EA2 A;  4RXA A;  4JZX A;  5DGS F;  3KRP B;  1VG2 A;  3LK5 A;  4XQS F;  2Z4Y A;  2Q80 A;  3N0G A;  4H5D F;  5DW7 A;  5AHU B;  4KK2 A;  2Z78 A;  3ZL6 A;  4LZ3 A;  4E9U A;  1KIZ A;  4RXD A;  5JV1 F;  2ONG A;  3RYW A;  3MZV A;  5ERM A;  2P1C A;  4LIX A;  2F94 F;  3EFQ A;  4KWD A;  2E4O A;  2Q9Y A;  4MC0 A;  5ILK A;  4LLT A;  5KSX F;  2F8Z F;  3ACW A;  3KRF A;  3N0F A;  5ERO A;  3SAE A;  5A0J A;  2I19 A;  1V4K A;  3M00 A;  5ILZ A;  3BNY A;  4NUA A;  4LFG A;  5IL3 A;  5JA0 F;  3P5R A;  3PH7 A;  1UBV A;  5ER8 A;  3DYH A;  2FOR A;  3M0G A;  5JV0 F;  3SDR A;  5DJV F;  1VG6 A;  4DWG A;  5JUZ F;  3ZOU A;  3TFV A;  4LFE A;  3RYE A;  3IPI A;  4GAX A;  5IN8 A;  1N22 A;  5IKH A;  1HXG A;  1JFG A;  3V1X A;  5AYP A;  5ILD A;  4H5E F;  5JV2 F;  1N1B A;  4H5C F;  3TS7 A;  4MC3 A;  3BNX A;  2ZCO A;  3TFN A;  4Q23 A;  4GA3 A;  2VF6 A;  5ILH A;  4E9Z A;  2PS5 A;  3N1W F;  5ILI A;  1UBY A;  3LGK A;  3KRF B;  3WCL A;  4PVY F;  3WE9 A;  5E8H A;  5E8K A;  5B0L A;  3ICN A;  4KVY A;  3TC1 A;  2Z4X A;  3AQB B;  1WL2 A;  2PS7 A;  4OMG A;  5CG6 A;  4KKM A;  3M01 A;  5EAU A;  3N49 F;  3WEI A;  1UBX A;  3AQ0 A;  4JYX A;  1VG4 A;  3WEJ A;  3Q2Q A;  1HXC A;  5IMP A;  5DGN F;  3AE0 A;  1EZF A;  4HD1 A;  4OKZ A;  3CP6 A;  1HM7 A;  2E8X A;  3WJN A;  3VJC A;  5AEL A;  1HM4 A;  4KQU A;  4RXE A;  2Q9Z A;  1N1Z A;  1V4H A;  1YJ4 A;  3WSA A;  4LLS A;  3PDE A;  3OAC A;  2Z7H A;  5DHI A;  5B0J A;  3LSN A;  4RNQ A;  4DHD A;  4P0X A;  2FTZ A;  3P8R A;  1YQ7 A;  2Z4V A;  5HN7 A;  2E91 A;  4K10 A;  1YHM A;  3CC9 A;  5B00 A;  4GP1 A;  4DI5 A;  4PVX F;  5HN9 A;  2OGD A;  5B03 A;  4LA5 A;  2ZCR A;  3V1V A;  3UCA A;  4F62 A;  2E8T A;  4KFA A;  5IM1 A;  3G4F A;  1VG3 A;  3LVS A;  3N46 F;  4KPJ A;  5B0M A;  4F6V A;  4ZQ8 A;  1WKZ A;  3PYB A;  5ERN A;  4OGU A;  4OKM A;  3ZCD A;  5HNA A;  3V66 A;  5IK9 A;  5DZ2 A;  2J5C A;  3Q1O A;  5B0I A;  5E8L A;  1YYR A;  3LGZ B;  4KVD A; 
#chains in the Genus database with same CATH homology
 4EA1 A;  1PS1 A;  3ASX A;  1YV5 A;  1KIY A;  3LG5 A;  3VJD A;  3NPK A;  3KRC A;  2Z50 A;  2QIS A;  4JXY A;  4QXS F;  3WCJ A;  4KUX A;  5IMI A;  4KQS A;  3OAC B;  2AZJ A;  2Q58 A;  1V4J A;  4FP4 A;  5C05 A;  5IK6 A;  4NFI F;  2J1O A;  3OYR A;  4RXC A;  1DGP A;  5DGM F;  3P8L A;  3IBA A;  4DEM F;  2AZK A;  3PYA A;  4DZW A;  3LLW A;  3WJO A;  3M9U A;  3N5H F;  2Z4Z A;  2PS8 A;  1YYU A;  3LZ9 A;  4JZB A;  4NFK F;  5DJR F;  2F7M F;  1WL3 A;  3DYF A;  4LPG F;  4LTV A;  1VG7 A;  3B7L A;  4P0W A;  4KVI A;  3N3D A;  3NPR A;  1N23 A;  5A0I A;  2OA6 A;  4NFJ F;  4XQR F;  3RMG A;  4XQT F;  3WCI A;  5AFX A;  3KRC B;  4L2X F;  4LZC A;  3TFP A;  4NKE A;  3SDV A;  3WEG A;  1RQJ A;  3P41 A;  5IVG A;  2AET A;  2AEL A;  4UMJ A;  4F6X A;  5B01 A;  2O1O A;  2E90 A;  3KB9 A;  2ONH A;  2F8C F;  4RYP A;  3WCH A;  5IKA A;  3WEK A;  4LOB A;  4DXJ A;  5ILJ A;  2PS6 A;  3SDQ A;  3VJ8 A;  4LUU A;  3ZMB A;  3NF2 A;  4P0V A;  3W7F A;  4QPF A;  4E1E A;  3KRO A;  3ZMC A;  3DYG A;  3QKC A;  3LMD A;  3ACY A;  3N6K F;  4GP2 A;  3KBK A;  1YYT A;  3ID0 A;  3N5J F;  3VJB A;  1WY0 A;  4LPH F;  2ZEU A;  3LOM A;  4LZ0 A;  4KVW A;  5I1U A;  2Z7I A;  2E93 A;  1YYS A;  4JVJ F;  5ILY A;  5DIQ F;  2H8O A;  1RQI A;  3SDU A;  1UBW A;  1ZW5 A;  3KRA A;  3WCD A;  5IK0 A;  4LTZ A;  3EGT A;  2DH4 A;  4NG6 A;  3WCC A;  3WCA A;  1N20 A;  1WL0 A;  2ZCS A;  2E8V A;  2OPM A;  3Q30 A;  1YYQ A;  3S9V A;  3CKE A;  3ICK A;  2AZL A;  5DHK A;  2RAH A;  5IMN A;  2J1P A;  3WSB A;  4WK5 A;  4LA6 A;  4N1Z F;  3LDW A;  3N3L F;  3KRO B;  4KQ5 A;  2ZY1 A;  2E92 A;  2E8W A;  4LXW A;  5EAS A;  2Z4W A;  3NRI A;  2ZEV A;  3MAV A;  2F92 F;  3WCG A;  5EAT A;  1DI1 A;  5H9D A;  3WCE A;  4LFV F;  3EZ3 A;  2Z52 A;  3OAB A;  1HX9 A;  2E94 A;  3G4D A;  4OMH A;  3VJA A;  3ADZ A;  3P5P A;  1YHK A;  3AQC B;  1V4I A;  3KRA B;  3VJ9 A;  4NKF A;  3WCB A;  5B02 A;  1HXA A;  1YHL A;  3N45 F;  5DJP F;  1WL1 A;  3PKO A;  4N9U A;  3WCM A;  4FJQ A;  3S4J A;  3VJE A;  3WCF A;  5IL8 A;  5A0K A;  1FPS A;  3KRP A;  3APZ A;  2OPN A;  1N24 A;  5HN8 A;  3N1V F;  4JXN A;  4DWB A;  2E95 A;  4MC8 A;  1RTR A;  3ICM A;  1V4E A;  3M02 A;  1N21 A;  3ICZ A;  2ZCQ A;  2EWG A;  4KPD A;  4EA0 A;  3SDT A;  2E8U A;  3RBM A;  3WJK A;  3LEE A;  2AEK A;  3WEH A;  3ACX A;  3LJI A;  3Q2Z A;  5B0K A;  3OAB B;  2F89 F;  5CG5 A;  3QQV A;  3WC9 A;  3WEF A;  2F9K F;  1WMW A;  1JFA A;  2PS4 A;  4EA2 A;  4RXA A;  4JZX A;  5DGS F;  3KRP B;  1VG2 A;  3LK5 A;  4XQS F;  2Z4Y A;  2Q80 A;  3N0G A;  4H5D F;  5DW7 A;  5AHU B;  4KK2 A;  2Z78 A;  3ZL6 A;  4LZ3 A;  4E9U A;  1KIZ A;  4RXD A;  5JV1 F;  2ONG A;  3RYW A;  3MZV A;  5ERM A;  2P1C A;  4LIX A;  2F94 F;  3EFQ A;  4KWD A;  2E4O A;  2Q9Y A;  4MC0 A;  5ILK A;  4LLT A;  5KSX F;  2F8Z F;  3ACW A;  3KRF A;  3N0F A;  5ERO A;  3SAE A;  5A0J A;  2I19 A;  1V4K A;  3M00 A;  5ILZ A;  3BNY A;  4NUA A;  4LFG A;  5IL3 A;  5JA0 F;  3P5R A;  3PH7 A;  1UBV A;  5ER8 A;  3DYH A;  2FOR A;  3M0G A;  5JV0 F;  3SDR A;  5DJV F;  1VG6 A;  4DWG A;  5JUZ F;  3ZOU A;  3TFV A;  4LFE A;  3RYE A;  3IPI A;  4GAX A;  5IN8 A;  1N22 A;  5IKH A;  1HXG A;  1JFG A;  3V1X A;  5AYP A;  5ILD A;  4H5E F;  5JV2 F;  1N1B A;  4H5C F;  3TS7 A;  4MC3 A;  3BNX A;  2ZCO A;  3TFN A;  4Q23 A;  4GA3 A;  2VF6 A;  5ILH A;  4E9Z A;  2PS5 A;  3N1W F;  5ILI A;  1UBY A;  3LGK A;  3KRF B;  3WCL A;  4PVY F;  3WE9 A;  5E8H A;  5E8K A;  5B0L A;  3ICN A;  4KVY A;  3TC1 A;  2Z4X A;  3AQB B;  1WL2 A;  2PS7 A;  4OMG A;  5CG6 A;  4KKM A;  3M01 A;  5EAU A;  3N49 F;  3WEI A;  1UBX A;  3AQ0 A;  4JYX A;  1VG4 A;  3WEJ A;  3Q2Q A;  1HXC A;  5IMP A;  5DGN F;  3AE0 A;  1EZF A;  4HD1 A;  4OKZ A;  3CP6 A;  1HM7 A;  2E8X A;  3WJN A;  3VJC A;  5AEL A;  1HM4 A;  4KQU A;  4RXE A;  2Q9Z A;  1N1Z A;  1V4H A;  1YJ4 A;  3WSA A;  4LLS A;  3PDE A;  3OAC A;  2Z7H A;  5DHI A;  5B0J A;  3LSN A;  4RNQ A;  4DHD A;  4P0X A;  2FTZ A;  3P8R A;  1YQ7 A;  2Z4V A;  5HN7 A;  2E91 A;  4K10 A;  1YHM A;  3CC9 A;  5B00 A;  4GP1 A;  4DI5 A;  4PVX F;  5HN9 A;  2OGD A;  5B03 A;  4LA5 A;  2ZCR A;  3V1V A;  3UCA A;  4F62 A;  2E8T A;  4KFA A;  5IM1 A;  3G4F A;  1VG3 A;  3LVS A;  3N46 F;  4KPJ A;  5B0M A;  4F6V A;  4ZQ8 A;  1WKZ A;  3PYB A;  5ERN A;  4OGU A;  4OKM A;  3ZCD A;  5HNA A;  3V66 A;  5IK9 A;  5DZ2 A;  2J5C A;  3Q1O A;  5B0I A;  5E8L A;  1YYR A;  3LGZ B;  4KVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...