3AQCB

M. luteus b-p 26 heterodimeric hexaprenyl diphosphate synthase in complex with magnesium and fpp analogue
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
321
structure length
321
Chain Sequence
SYKAFLNPYIIEVEKRLYECIQSDSETINKAAHHILSSGGKRVRPMFVLLSGFLNDTQKDDLIRTAVSLELVHMASLVHDDYIDNSDMRRGNTSVHIAFDKDTAIRTGHFLLARALQNIATINNSKFHQIFSKTILEVCFGEFDQMADRFNYPVSFTAYLRRINRKTAILIEASCHLGALSSQLDEQSTYHIKQFGHCIGMSYQIIDDILDYTSDEATLGKPVGSDIRNGHITYPLMAAIANLKEQDDDKLEAVVKHLTSTSDDEVYQYIVSQVKQYGIEPAELLSRKYGDKAKYHLSQLQDSNIKDYLEEIHEKMLKRVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Component A of hexaprenyl diphosphate synthase
publication title Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
pubmed doi rcsb
source organism Micrococcus luteus
molecule tags Transferase
total genus 126
structure length 321
sequence length 321
chains with identical sequence D
ec nomenclature ec 2.5.1.83: Hexaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific).
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3aqcB00
1JFAA 5IMIA 2PS6A 1YYTA 4WK5A 4LFGA 4LA5A 1WMWA 4XQRF 5JV2F 3RMGA 4LLTA 5IN8A 3VJEA 3ASXA 4RXAA 3PH7A 3ZOUA 1HM4A 1KIZA 2ZEUA 1N23A 4DWGA 4KPJA 2E93A 3ID0A 4GP1A 3WEKA 3IPIA 4P0VA 5B0LA 2ZCOA 4LXWA 1HXGA 3OABB 2EWGA 4PVYF 5A0KA 3ICZA 3P8RA 4L2XF 3AQBB 3LZ9A 4GA3A 4NFJF 3N3DA 5IK0A 2AZLA 3CKEA 3VJCA 5JA0F 3VJAA 4RXDA 4N9UA 5ERNA 2ONHA 1UBXA 2F92F 4QPFA 3PDEA 2OA6A 5HN8A 2Z78A 1RQIA 5B02A 3WCJA 1PS1A 3KRAA 4H5CF 3WCLA 5E8KA 2AETA 4LOBA 1HXAA 5DGSF 1FPSA 1YQ7A 4F62A 2RAHA 4DI5A 3P41A 5IK6A 5IK9A 3LEEA 3M0GA 5B0JA 3VJ8A 4NKFA 1HM7A 2AZJA 5ILIA 4E1EA 3M02A 3ACWA 3LOMA 3ICNA 3KRPB 5B03A 5EAUA 5IM1A 2ZCSA 3KRFB 3PYAA 3OYRA 3N1WF 4DEMF 3EFQA 4HD1A 2AZKA 5E8LA 3Q1OA 2Z7IA 3Q30A 1WY0A 5EASA 3N46F 5CG6A 3M01A 2J1PA 3W7FA 3WC9A 3M9UA 3WCHA 4EA1A 5I1UA 2ONGA 4KUXA 3N3LF 2F94F 3WEHA 3WCMA 2ZY1A 3WEFA 3ACXA 4DWBA 4GP2A 1VG6A 3N0FA 5ILKA 5ILYA 5EROA 4LFVF 2E8XA 5B0MA 2F8ZF 1UBYA 3N49F 4MC0A 3ICKA 4KVYA 3BNYA 4KK2A 4LPGF 3WCIA 5ILZA 4JZXA 4LUUA 4OGUA 4KVWA 2E8UA 1ZW5A 1WL1A 3BNXA 2ZCRA 4OKZA 2Z4WA 4OMHA 5DGNF 2Q80A 5HN7A 1VG7A 1EZFA 1YHMA 1N22A 2OPNA 2OPMA 3MZVA 5AYPA 4E9ZA 2E94A 3UCAA 3KB9A 3WEGA 3ZMCA 3WCAA 2Z4YA 1V4KA 2VF6A 3LGZB 4FJQA 4RNQA 3V66A 3V1XA 4NFIF 5EATA 2PS7A 2Z4VA 4N1ZF 3N0GA 2Q58A 2P1CA 4Q23A 3ADZA 3N6KF 5HN9A 5IL8A 3KRCA 4KWDA 3S9VA 3LLWA 1N21A 3SDUA 3EGTA 4QXSF 2Z4XA 2Z4ZA 3PKOA 4RXEA 5B00A 3NRIA 3Q2ZA 3LDWA 5HNAA 1N1BA 4P0WA 2E8VA 3VJBA 3G4DA 2PS8A 5DJVF 4DHDA 2PS5A 3P5RA 3WCFA 4H5EF 4KVIA 4NG6A 5CG5A 3KBKA 5AELA 2Z7HA 1YV5A 4EA0A 4LZCA 3LGKA 2E8TA 1HX9A 4EA2A 3TFPA 2J1OA 3M00A 4LZ0A 1YHKA 3SDRA 4LTZA 5IMPA 2OGDA 2E8WA 5DIQF 1YYUA 3KROB 3N5JF 3WE9A 1UBVA 3WCCA 1V4JA 4JZBA 5C05A 3OACA 2AELA 4JVJF 4H5DF 5H9DA 3NPKA 1N20A 3AE0A 3EZ3A 3WCDA 1N24A 4KQSA 3NPRA 1YYRA 1HXCA 1UBWA 4XQSF 2F8CF 2Z52A 3QKCA 4KKMA 3B7LA 5E8HA 5DZ2A 5JV1F 1DGPA 3AQCB 5A0IA 4LFEA 4RYPA 1DI1A 3V1VA 5JUZF 3Q2QA 3N1VF 3WEIA 3IBAA 2H8OA 5IVGA 5DJPF 3PYBA 5KSXF 1VG2A 1WL2A 4UMJA 1WL0A 5ILJA 3SAEA 3DYGA 4LPHF 4MC3A 3WCGA 5B01A 1KIYA 3LVSA 4LLSA 2E95A 3CP6A 3LJIA 2I19A 5IKHA 3WJKA 2O1OA 3S4JA 5IMNA 3RBMA 5JV0F 3SDTA 3WJOA 1N1ZA 4PVXF 4OMGA 5B0IA 3LK5A 1YHLA 1JFGA 1WL3A 5DJRF 1WKZA 1VG3A 4FP4A 3KRCB 4LZ3A 2FTZA 2FORA 5B0KA 1RTRA 3SDQA 4JXYA 5ILDA 3DYFA 3ZCDA 4KFAA 4NFKF 4KQ5A 3KRAB 4LTVA 4OKMA 2E90A 3OABA 3RYWA 3TFVA 5AHUB 4DXJA 5IL3A 3MAVA 3ICMA 1V4IA 2E91A 3TS7A 3WSBA 4NUAA 2J5CA 2Q9YA 4RXCA 3LSNA 2ZCQA 2Z50A 3ZMBA 5ILHA 4MC8A 5AFXA 4P0XA 2ZEVA 3ACYA 3ZL6A 3WCBA 4JXNA 3QQVA 5DHIA 2Q9ZA 1YJ4A 3WSAA 4KQUA 3WEJA 3WJNA 2F89F 2DH4A 2QISA 4F6VA 5DGMF 3OACB 4ZQ8A 5IKAA 2F9KF 2E4OA 4KVDA 1RQJA 3NF2A 1YYSA 5DHKA 3G4FA 1YYQA 3RYEA 3APZA 4GAXA 5ERMA 4KPDA 1VG4A 5DW7A 4F6XA 2E92A 3KROA 3N45F 4E9UA 3KRPA 2F7MF 3AQ0A 2PS4A 2AEKA 3KRFA 4LA6A 3VJDA 3SDVA 3DYHA 5ER8A 3VJ9A 1V4EA 4DZWA 3TFNA 5A0JA 3N5HF 3LMDA 4NKEA 4JYXA 3TC1A 3WCEA 3P5PA 3P8LA 4LIXA 4XQTF 1V4HA 3CC9A 4K10A 3LG5A
chains in the Genus database with same CATH superfamily
1JFAA 5IMIA 2PS6A 1YYTA 4WK5A 4LFGA 4LA5A 1WMWA 4XQRF 5JV2F 3RMGA 4LLTA 5IN8A 3VJEA 3ASXA 4RXAA 3PH7A 3ZOUA 1HM4A 1KIZA 2ZEUA 1N23A 4DWGA 4KPJA 2E93A 3ID0A 4GP1A 3WEKA 3IPIA 4P0VA 5B0LA 2ZCOA 4LXWA 1HXGA 3OABB 2EWGA 4PVYF 5A0KA 3ICZA 3P8RA 4L2XF 3AQBB 3LZ9A 4GA3A 4NFJF 3N3DA 5IK0A 2AZLA 3CKEA 3VJCA 5JA0F 3VJAA 4RXDA 4N9UA 5ERNA 2ONHA 1UBXA 2F92F 4QPFA 3PDEA 2OA6A 5HN8A 2Z78A 1RQIA 5B02A 3WCJA 1PS1A 3KRAA 4H5CF 3WCLA 5E8KA 2AETA 4LOBA 1HXAA 5DGSF 1FPSA 1YQ7A 4F62A 2RAHA 4DI5A 3P41A 5IK6A 5IK9A 3LEEA 3M0GA 5B0JA 3VJ8A 4NKFA 1HM7A 2AZJA 5ILIA 4E1EA 3M02A 3ACWA 3LOMA 3ICNA 3KRPB 5B03A 5EAUA 5IM1A 2ZCSA 3KRFB 3PYAA 3OYRA 3N1WF 4DEMF 3EFQA 4HD1A 2AZKA 5E8LA 3Q1OA 2Z7IA 3Q30A 1WY0A 5EASA 3N46F 5CG6A 3M01A 2J1PA 3W7FA 3WC9A 3M9UA 3WCHA 4EA1A 5I1UA 2ONGA 4KUXA 3N3LF 2F94F 3WEHA 3WCMA 2ZY1A 3WEFA 3ACXA 4DWBA 4GP2A 1VG6A 3N0FA 5ILKA 5ILYA 5EROA 4LFVF 2E8XA 5B0MA 2F8ZF 1UBYA 3N49F 4MC0A 3ICKA 4KVYA 3BNYA 4KK2A 4LPGF 3WCIA 5ILZA 4JZXA 4LUUA 4OGUA 4KVWA 2E8UA 1ZW5A 1WL1A 3BNXA 2ZCRA 4OKZA 2Z4WA 4OMHA 5DGNF 2Q80A 5HN7A 1VG7A 1EZFA 1YHMA 1N22A 2OPNA 2OPMA 3MZVA 5AYPA 4E9ZA 2E94A 3UCAA 3KB9A 3WEGA 3ZMCA 3WCAA 2Z4YA 1V4KA 2VF6A 3LGZB 4FJQA 4RNQA 3V66A 3V1XA 4NFIF 5EATA 2PS7A 2Z4VA 4N1ZF 3N0GA 2Q58A 2P1CA 4Q23A 3ADZA 3N6KF 5HN9A 5IL8A 3KRCA 4KWDA 3S9VA 3LLWA 1N21A 3SDUA 3EGTA 4QXSF 2Z4XA 2Z4ZA 3PKOA 4RXEA 5B00A 3NRIA 3Q2ZA 3LDWA 5HNAA 1N1BA 4P0WA 2E8VA 3VJBA 3G4DA 2PS8A 5DJVF 4DHDA 2PS5A 3P5RA 3WCFA 4H5EF 4KVIA 4NG6A 5CG5A 3KBKA 5AELA 2Z7HA 1YV5A 4EA0A 4LZCA 3LGKA 2E8TA 1HX9A 4EA2A 3TFPA 2J1OA 3M00A 4LZ0A 1YHKA 3SDRA 4LTZA 5IMPA 2OGDA 2E8WA 5DIQF 1YYUA 3KROB 3N5JF 3WE9A 1UBVA 3WCCA 1V4JA 4JZBA 5C05A 3OACA 2AELA 4JVJF 4H5DF 5H9DA 3NPKA 1N20A 3AE0A 3EZ3A 3WCDA 1N24A 4KQSA 3NPRA 1YYRA 1HXCA 1UBWA 4XQSF 2F8CF 2Z52A 3QKCA 4KKMA 3B7LA 5E8HA 5DZ2A 5JV1F 1DGPA 3AQCB 5A0IA 4LFEA 4RYPA 1DI1A 3V1VA 5JUZF 3Q2QA 3N1VF 3WEIA 3IBAA 2H8OA 5IVGA 5DJPF 3PYBA 5KSXF 1VG2A 1WL2A 4UMJA 1WL0A 5ILJA 3SAEA 3DYGA 4LPHF 4MC3A 3WCGA 5B01A 1KIYA 3LVSA 4LLSA 2E95A 3CP6A 3LJIA 2I19A 5IKHA 3WJKA 2O1OA 3S4JA 5IMNA 3RBMA 5JV0F 3SDTA 3WJOA 1N1ZA 4PVXF 4OMGA 5B0IA 3LK5A 1YHLA 1JFGA 1WL3A 5DJRF 1WKZA 1VG3A 4FP4A 3KRCB 4LZ3A 2FTZA 2FORA 5B0KA 1RTRA 3SDQA 4JXYA 5ILDA 3DYFA 3ZCDA 4KFAA 4NFKF 4KQ5A 3KRAB 4LTVA 4OKMA 2E90A 3OABA 3RYWA 3TFVA 5AHUB 4DXJA 5IL3A 3MAVA 3ICMA 1V4IA 2E91A 3TS7A 3WSBA 4NUAA 2J5CA 2Q9YA 4RXCA 3LSNA 2ZCQA 2Z50A 3ZMBA 5ILHA 4MC8A 5AFXA 4P0XA 2ZEVA 3ACYA 3ZL6A 3WCBA 4JXNA 3QQVA 5DHIA 2Q9ZA 1YJ4A 3WSAA 4KQUA 3WEJA 3WJNA 2F89F 2DH4A 2QISA 4F6VA 5DGMF 3OACB 4ZQ8A 5IKAA 2F9KF 2E4OA 4KVDA 1RQJA 3NF2A 1YYSA 5DHKA 3G4FA 1YYQA 3RYEA 3APZA 4GAXA 5ERMA 4KPDA 1VG4A 5DW7A 4F6XA 2E92A 3KROA 3N45F 4E9UA 3KRPA 2F7MF 3AQ0A 2PS4A 2AEKA 3KRFA 4LA6A 3VJDA 3SDVA 3DYHA 5ER8A 3VJ9A 1V4EA 4DZWA 3TFNA 5A0JA 3N5HF 3LMDA 4NKEA 4JYXA 3TC1A 3WCEA 3P5PA 3P8LA 4LIXA 4XQTF 1V4HA 3CC9A 4K10A 3LG5A
chains in the Genus database with same CATH topology
1JFAA 5IMIA 2PS6A 1YYTA 4WK5A 4LFGA 4LA5A 1WMWA 4XQRF 5JV2F 3RMGA 4LLTA 5IN8A 3VJEA 3ASXA 4RXAA 3PH7A 3ZOUA 1HM4A 1KIZA 2ZEUA 1N23A 4DWGA 4KPJA 2E93A 3ID0A 4GP1A 3WEKA 3IPIA 4P0VA 5B0LA 2ZCOA 4LXWA 1HXGA 3OABB 2EWGA 4PVYF 5A0KA 3ICZA 3P8RA 4L2XF 3AQBB 3LZ9A 4GA3A 4NFJF 3N3DA 5IK0A 2AZLA 3CKEA 3VJCA 5JA0F 3VJAA 4RXDA 4N9UA 5ERNA 2ONHA 1UBXA 2F92F 4QPFA 3PDEA 2OA6A 5HN8A 2Z78A 1RQIA 5B02A 3WCJA 1PS1A 3KRAA 4H5CF 3WCLA 5E8KA 2AETA 4LOBA 1HXAA 5DGSF 1FPSA 1YQ7A 4F62A 2RAHA 4DI5A 3P41A 5IK6A 5IK9A 3LEEA 3M0GA 5B0JA 3VJ8A 4NKFA 1HM7A 2AZJA 5ILIA 4E1EA 3M02A 3ACWA 3LOMA 3ICNA 3KRPB 5B03A 5EAUA 5IM1A 2ZCSA 3KRFB 3PYAA 3OYRA 3N1WF 4DEMF 3EFQA 4HD1A 2AZKA 5E8LA 3Q1OA 2Z7IA 3Q30A 1WY0A 5EASA 3N46F 5CG6A 3M01A 2J1PA 3W7FA 3WC9A 3M9UA 3WCHA 4EA1A 5I1UA 2ONGA 4KUXA 3N3LF 2F94F 3WEHA 3WCMA 2ZY1A 3WEFA 3ACXA 4DWBA 4GP2A 1VG6A 3N0FA 5ILKA 5ILYA 5EROA 4LFVF 2E8XA 5B0MA 2F8ZF 1UBYA 3N49F 4MC0A 3ICKA 4KVYA 3BNYA 4KK2A 4LPGF 3WCIA 5ILZA 4JZXA 4LUUA 4OGUA 4KVWA 2E8UA 1ZW5A 1WL1A 3BNXA 2ZCRA 4OKZA 2Z4WA 4OMHA 5DGNF 2Q80A 5HN7A 1VG7A 1EZFA 1YHMA 1N22A 2OPNA 2OPMA 3MZVA 5AYPA 4E9ZA 2E94A 3UCAA 3KB9A 3WEGA 3ZMCA 3WCAA 2Z4YA 1V4KA 2VF6A 3LGZB 4FJQA 4RNQA 3V66A 3V1XA 4NFIF 5EATA 2PS7A 2Z4VA 4N1ZF 3N0GA 2Q58A 2P1CA 4Q23A 3ADZA 3N6KF 5HN9A 5IL8A 3KRCA 4KWDA 3S9VA 3LLWA 1N21A 3SDUA 3EGTA 4QXSF 2Z4XA 2Z4ZA 3PKOA 4RXEA 5B00A 3NRIA 3Q2ZA 3LDWA 5HNAA 1N1BA 4P0WA 2E8VA 3VJBA 3G4DA 2PS8A 5DJVF 4DHDA 2PS5A 3P5RA 3WCFA 4H5EF 4KVIA 4NG6A 5CG5A 3KBKA 5AELA 2Z7HA 1YV5A 4EA0A 4LZCA 3LGKA 2E8TA 1HX9A 4EA2A 3TFPA 2J1OA 3M00A 4LZ0A 1YHKA 3SDRA 4LTZA 5IMPA 2OGDA 2E8WA 5DIQF 1YYUA 3KROB 3N5JF 3WE9A 1UBVA 3WCCA 1V4JA 4JZBA 5C05A 3OACA 2AELA 4JVJF 4H5DF 5H9DA 3NPKA 1N20A 3AE0A 3EZ3A 3WCDA 1N24A 4KQSA 3NPRA 1YYRA 1HXCA 1UBWA 4XQSF 2F8CF 2Z52A 3QKCA 4KKMA 3B7LA 5E8HA 5DZ2A 5JV1F 1DGPA 3AQCB 5A0IA 4LFEA 4RYPA 1DI1A 3V1VA 5JUZF 3Q2QA 3N1VF 3WEIA 3IBAA 2H8OA 5IVGA 5DJPF 3PYBA 5KSXF 1VG2A 1WL2A 4UMJA 1WL0A 5ILJA 3SAEA 3DYGA 4LPHF 4MC3A 3WCGA 5B01A 1KIYA 3LVSA 4LLSA 2E95A 3CP6A 3LJIA 2I19A 5IKHA 3WJKA 2O1OA 3S4JA 5IMNA 3RBMA 5JV0F 3SDTA 3WJOA 1N1ZA 4PVXF 4OMGA 5B0IA 3LK5A 1YHLA 1JFGA 1WL3A 5DJRF 1WKZA 1VG3A 4FP4A 3KRCB 4LZ3A 2FTZA 2FORA 5B0KA 1RTRA 3SDQA 4JXYA 5ILDA 3DYFA 3ZCDA 4KFAA 4NFKF 4KQ5A 3KRAB 4LTVA 4OKMA 2E90A 3OABA 3RYWA 3TFVA 5AHUB 4DXJA 5IL3A 3MAVA 3ICMA 1V4IA 2E91A 3TS7A 3WSBA 4NUAA 2J5CA 2Q9YA 4RXCA 3LSNA 2ZCQA 2Z50A 3ZMBA 5ILHA 4MC8A 5AFXA 4P0XA 2ZEVA 3ACYA 3ZL6A 3WCBA 4JXNA 3QQVA 5DHIA 2Q9ZA 1YJ4A 3WSAA 4KQUA 3WEJA 3WJNA 2F89F 2DH4A 2QISA 4F6VA 5DGMF 3OACB 4ZQ8A 5IKAA 2F9KF 2E4OA 4KVDA 1RQJA 3NF2A 1YYSA 5DHKA 3G4FA 1YYQA 3RYEA 3APZA 4GAXA 5ERMA 4KPDA 1VG4A 5DW7A 4F6XA 2E92A 3KROA 3N45F 4E9UA 3KRPA 2F7MF 3AQ0A 2PS4A 2AEKA 3KRFA 4LA6A 3VJDA 3SDVA 3DYHA 5ER8A 3VJ9A 1V4EA 4DZWA 3TFNA 5A0JA 3N5HF 3LMDA 4NKEA 4JYXA 3TC1A 3WCEA 3P5PA 3P8LA 4LIXA 4XQTF 1V4HA 3CC9A 4K10A 3LG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFA A;  5IMI A;  2PS6 A;  1YYT A;  4WK5 A;  4LFG A;  4LA5 A;  1WMW A;  4XQR F;  5JV2 F;  3RMG A;  4LLT A;  5IN8 A;  3VJE A;  3ASX A;  4RXA A;  3PH7 A;  3ZOU A;  1HM4 A;  1KIZ A;  2ZEU A;  1N23 A;  4DWG A;  4KPJ A;  2E93 A;  3ID0 A;  4GP1 A;  3WEK A;  3IPI A;  4P0V A;  5B0L A;  2ZCO A;  4LXW A;  1HXG A;  3OAB B;  2EWG A;  4PVY F;  5A0K A;  3ICZ A;  3P8R A;  4L2X F;  3AQB B;  3LZ9 A;  4GA3 A;  4NFJ F;  3N3D A;  5IK0 A;  2AZL A;  3CKE A;  3VJC A;  5JA0 F;  3VJA A;  4RXD A;  4N9U A;  5ERN A;  2ONH A;  1UBX A;  2F92 F;  4QPF A;  3PDE A;  2OA6 A;  5HN8 A;  2Z78 A;  1RQI A;  5B02 A;  3WCJ A;  1PS1 A;  3KRA A;  4H5C F;  3WCL A;  5E8K A;  2AET A;  4LOB A;  1HXA A;  5DGS F;  1FPS A;  1YQ7 A;  4F62 A;  2RAH A;  4DI5 A;  3P41 A;  5IK6 A;  5IK9 A;  3LEE A;  3M0G A;  5B0J A;  3VJ8 A;  4NKF A;  1HM7 A;  2AZJ A;  5ILI A;  4E1E A;  3M02 A;  3ACW A;  3LOM A;  3ICN A;  3KRP B;  5B03 A;  5EAU A;  5IM1 A;  2ZCS A;  3KRF B;  3PYA A;  3OYR A;  3N1W F;  4DEM F;  3EFQ A;  4HD1 A;  2AZK A;  5E8L A;  3Q1O A;  2Z7I A;  3Q30 A;  1WY0 A;  5EAS A;  3N46 F;  5CG6 A;  3M01 A;  2J1P A;  3W7F A;  3WC9 A;  3M9U A;  3WCH A;  4EA1 A;  5I1U A;  2ONG A;  4KUX A;  3N3L F;  2F94 F;  3WEH A;  3WCM A;  2ZY1 A;  3WEF A;  3ACX A;  4DWB A;  4GP2 A;  1VG6 A;  3N0F A;  5ILK A;  5ILY A;  5ERO A;  4LFV F;  2E8X A;  5B0M A;  2F8Z F;  1UBY A;  3N49 F;  4MC0 A;  3ICK A;  4KVY A;  3BNY A;  4KK2 A;  4LPG F;  3WCI A;  5ILZ A;  4JZX A;  4LUU A;  4OGU A;  4KVW A;  2E8U A;  1ZW5 A;  1WL1 A;  3BNX A;  2ZCR A;  4OKZ A;  2Z4W A;  4OMH A;  5DGN F;  2Q80 A;  5HN7 A;  1VG7 A;  1EZF A;  1YHM A;  1N22 A;  2OPN A;  2OPM A;  3MZV A;  5AYP A;  4E9Z A;  2E94 A;  3UCA A;  3KB9 A;  3WEG A;  3ZMC A;  3WCA A;  2Z4Y A;  1V4K A;  2VF6 A;  3LGZ B;  4FJQ A;  4RNQ A;  3V66 A;  3V1X A;  4NFI F;  5EAT A;  2PS7 A;  2Z4V A;  4N1Z F;  3N0G A;  2Q58 A;  2P1C A;  4Q23 A;  3ADZ A;  3N6K F;  5HN9 A;  5IL8 A;  3KRC A;  4KWD A;  3S9V A;  3LLW A;  1N21 A;  3SDU A;  3EGT A;  4QXS F;  2Z4X A;  2Z4Z A;  3PKO A;  4RXE A;  5B00 A;  3NRI A;  3Q2Z A;  3LDW A;  5HNA A;  1N1B A;  4P0W A;  2E8V A;  3VJB A;  3G4D A;  2PS8 A;  5DJV F;  4DHD A;  2PS5 A;  3P5R A;  3WCF A;  4H5E F;  4KVI A;  4NG6 A;  5CG5 A;  3KBK A;  5AEL A;  2Z7H A;  1YV5 A;  4EA0 A;  4LZC A;  3LGK A;  2E8T A;  1HX9 A;  4EA2 A;  3TFP A;  2J1O A;  3M00 A;  4LZ0 A;  1YHK A;  3SDR A;  4LTZ A;  5IMP A;  2OGD A;  2E8W A;  5DIQ F;  1YYU A;  3KRO B;  3N5J F;  3WE9 A;  1UBV A;  3WCC A;  1V4J A;  4JZB A;  5C05 A;  3OAC A;  2AEL A;  4JVJ F;  4H5D F;  5H9D A;  3NPK A;  1N20 A;  3AE0 A;  3EZ3 A;  3WCD A;  1N24 A;  4KQS A;  3NPR A;  1YYR A;  1HXC A;  1UBW A;  4XQS F;  2F8C F;  2Z52 A;  3QKC A;  4KKM A;  3B7L A;  5E8H A;  5DZ2 A;  5JV1 F;  1DGP A;  3AQC B;  5A0I A;  4LFE A;  4RYP A;  1DI1 A;  3V1V A;  5JUZ F;  3Q2Q A;  3N1V F;  3WEI A;  3IBA A;  2H8O A;  5IVG A;  5DJP F;  3PYB A;  5KSX F;  1VG2 A;  1WL2 A;  4UMJ A;  1WL0 A;  5ILJ A;  3SAE A;  3DYG A;  4LPH F;  4MC3 A;  3WCG A;  5B01 A;  1KIY A;  3LVS A;  4LLS A;  2E95 A;  3CP6 A;  3LJI A;  2I19 A;  5IKH A;  3WJK A;  2O1O A;  3S4J A;  5IMN A;  3RBM A;  5JV0 F;  3SDT A;  3WJO A;  1N1Z A;  4PVX F;  4OMG A;  5B0I A;  3LK5 A;  1YHL A;  1JFG A;  1WL3 A;  5DJR F;  1WKZ A;  1VG3 A;  4FP4 A;  3KRC B;  4LZ3 A;  2FTZ A;  2FOR A;  5B0K A;  1RTR A;  3SDQ A;  4JXY A;  5ILD A;  3DYF A;  3ZCD A;  4KFA A;  4NFK F;  4KQ5 A;  3KRA B;  4LTV A;  4OKM A;  2E90 A;  3OAB A;  3RYW A;  3TFV A;  5AHU B;  4DXJ A;  5IL3 A;  3MAV A;  3ICM A;  1V4I A;  2E91 A;  3TS7 A;  3WSB A;  4NUA A;  2J5C A;  2Q9Y A;  4RXC A;  3LSN A;  2ZCQ A;  2Z50 A;  3ZMB A;  5ILH A;  4MC8 A;  5AFX A;  4P0X A;  2ZEV A;  3ACY A;  3ZL6 A;  3WCB A;  4JXN A;  3QQV A;  5DHI A;  2Q9Z A;  1YJ4 A;  3WSA A;  4KQU A;  3WEJ A;  3WJN A;  2F89 F;  2DH4 A;  2QIS A;  4F6V A;  5DGM F;  3OAC B;  4ZQ8 A;  5IKA A;  2F9K F;  2E4O A;  4KVD A;  1RQJ A;  3NF2 A;  1YYS A;  5DHK A;  3G4F A;  1YYQ A;  3RYE A;  3APZ A;  4GAX A;  5ERM A;  4KPD A;  1VG4 A;  5DW7 A;  4F6X A;  2E92 A;  3KRO A;  3N45 F;  4E9U A;  3KRP A;  2F7M F;  3AQ0 A;  2PS4 A;  2AEK A;  3KRF A;  4LA6 A;  3VJD A;  3SDV A;  3DYH A;  5ER8 A;  3VJ9 A;  1V4E A;  4DZW A;  3TFN A;  5A0J A;  3N5H F;  3LMD A;  4NKE A;  4JYX A;  3TC1 A;  3WCE A;  3P5P A;  3P8L A;  4LIX A;  4XQT F;  1V4H A;  3CC9 A;  4K10 A;  3LG5 A; 
#chains in the Genus database with same CATH topology
 1JFA A;  5IMI A;  2PS6 A;  1YYT A;  4WK5 A;  4LFG A;  4LA5 A;  1WMW A;  4XQR F;  5JV2 F;  3RMG A;  4LLT A;  5IN8 A;  3VJE A;  3ASX A;  4RXA A;  3PH7 A;  3ZOU A;  1HM4 A;  1KIZ A;  2ZEU A;  1N23 A;  4DWG A;  4KPJ A;  2E93 A;  3ID0 A;  4GP1 A;  3WEK A;  3IPI A;  4P0V A;  5B0L A;  2ZCO A;  4LXW A;  1HXG A;  3OAB B;  2EWG A;  4PVY F;  5A0K A;  3ICZ A;  3P8R A;  4L2X F;  3AQB B;  3LZ9 A;  4GA3 A;  4NFJ F;  3N3D A;  5IK0 A;  2AZL A;  3CKE A;  3VJC A;  5JA0 F;  3VJA A;  4RXD A;  4N9U A;  5ERN A;  2ONH A;  1UBX A;  2F92 F;  4QPF A;  3PDE A;  2OA6 A;  5HN8 A;  2Z78 A;  1RQI A;  5B02 A;  3WCJ A;  1PS1 A;  3KRA A;  4H5C F;  3WCL A;  5E8K A;  2AET A;  4LOB A;  1HXA A;  5DGS F;  1FPS A;  1YQ7 A;  4F62 A;  2RAH A;  4DI5 A;  3P41 A;  5IK6 A;  5IK9 A;  3LEE A;  3M0G A;  5B0J A;  3VJ8 A;  4NKF A;  1HM7 A;  2AZJ A;  5ILI A;  4E1E A;  3M02 A;  3ACW A;  3LOM A;  3ICN A;  3KRP B;  5B03 A;  5EAU A;  5IM1 A;  2ZCS A;  3KRF B;  3PYA A;  3OYR A;  3N1W F;  4DEM F;  3EFQ A;  4HD1 A;  2AZK A;  5E8L A;  3Q1O A;  2Z7I A;  3Q30 A;  1WY0 A;  5EAS A;  3N46 F;  5CG6 A;  3M01 A;  2J1P A;  3W7F A;  3WC9 A;  3M9U A;  3WCH A;  4EA1 A;  5I1U A;  2ONG A;  4KUX A;  3N3L F;  2F94 F;  3WEH A;  3WCM A;  2ZY1 A;  3WEF A;  3ACX A;  4DWB A;  4GP2 A;  1VG6 A;  3N0F A;  5ILK A;  5ILY A;  5ERO A;  4LFV F;  2E8X A;  5B0M A;  2F8Z F;  1UBY A;  3N49 F;  4MC0 A;  3ICK A;  4KVY A;  3BNY A;  4KK2 A;  4LPG F;  3WCI A;  5ILZ A;  4JZX A;  4LUU A;  4OGU A;  4KVW A;  2E8U A;  1ZW5 A;  1WL1 A;  3BNX A;  2ZCR A;  4OKZ A;  2Z4W A;  4OMH A;  5DGN F;  2Q80 A;  5HN7 A;  1VG7 A;  1EZF A;  1YHM A;  1N22 A;  2OPN A;  2OPM A;  3MZV A;  5AYP A;  4E9Z A;  2E94 A;  3UCA A;  3KB9 A;  3WEG A;  3ZMC A;  3WCA A;  2Z4Y A;  1V4K A;  2VF6 A;  3LGZ B;  4FJQ A;  4RNQ A;  3V66 A;  3V1X A;  4NFI F;  5EAT A;  2PS7 A;  2Z4V A;  4N1Z F;  3N0G A;  2Q58 A;  2P1C A;  4Q23 A;  3ADZ A;  3N6K F;  5HN9 A;  5IL8 A;  3KRC A;  4KWD A;  3S9V A;  3LLW A;  1N21 A;  3SDU A;  3EGT A;  4QXS F;  2Z4X A;  2Z4Z A;  3PKO A;  4RXE A;  5B00 A;  3NRI A;  3Q2Z A;  3LDW A;  5HNA A;  1N1B A;  4P0W A;  2E8V A;  3VJB A;  3G4D A;  2PS8 A;  5DJV F;  4DHD A;  2PS5 A;  3P5R A;  3WCF A;  4H5E F;  4KVI A;  4NG6 A;  5CG5 A;  3KBK A;  5AEL A;  2Z7H A;  1YV5 A;  4EA0 A;  4LZC A;  3LGK A;  2E8T A;  1HX9 A;  4EA2 A;  3TFP A;  2J1O A;  3M00 A;  4LZ0 A;  1YHK A;  3SDR A;  4LTZ A;  5IMP A;  2OGD A;  2E8W A;  5DIQ F;  1YYU A;  3KRO B;  3N5J F;  3WE9 A;  1UBV A;  3WCC A;  1V4J A;  4JZB A;  5C05 A;  3OAC A;  2AEL A;  4JVJ F;  4H5D F;  5H9D A;  3NPK A;  1N20 A;  3AE0 A;  3EZ3 A;  3WCD A;  1N24 A;  4KQS A;  3NPR A;  1YYR A;  1HXC A;  1UBW A;  4XQS F;  2F8C F;  2Z52 A;  3QKC A;  4KKM A;  3B7L A;  5E8H A;  5DZ2 A;  5JV1 F;  1DGP A;  3AQC B;  5A0I A;  4LFE A;  4RYP A;  1DI1 A;  3V1V A;  5JUZ F;  3Q2Q A;  3N1V F;  3WEI A;  3IBA A;  2H8O A;  5IVG A;  5DJP F;  3PYB A;  5KSX F;  1VG2 A;  1WL2 A;  4UMJ A;  1WL0 A;  5ILJ A;  3SAE A;  3DYG A;  4LPH F;  4MC3 A;  3WCG A;  5B01 A;  1KIY A;  3LVS A;  4LLS A;  2E95 A;  3CP6 A;  3LJI A;  2I19 A;  5IKH A;  3WJK A;  2O1O A;  3S4J A;  5IMN A;  3RBM A;  5JV0 F;  3SDT A;  3WJO A;  1N1Z A;  4PVX F;  4OMG A;  5B0I A;  3LK5 A;  1YHL A;  1JFG A;  1WL3 A;  5DJR F;  1WKZ A;  1VG3 A;  4FP4 A;  3KRC B;  4LZ3 A;  2FTZ A;  2FOR A;  5B0K A;  1RTR A;  3SDQ A;  4JXY A;  5ILD A;  3DYF A;  3ZCD A;  4KFA A;  4NFK F;  4KQ5 A;  3KRA B;  4LTV A;  4OKM A;  2E90 A;  3OAB A;  3RYW A;  3TFV A;  5AHU B;  4DXJ A;  5IL3 A;  3MAV A;  3ICM A;  1V4I A;  2E91 A;  3TS7 A;  3WSB A;  4NUA A;  2J5C A;  2Q9Y A;  4RXC A;  3LSN A;  2ZCQ A;  2Z50 A;  3ZMB A;  5ILH A;  4MC8 A;  5AFX A;  4P0X A;  2ZEV A;  3ACY A;  3ZL6 A;  3WCB A;  4JXN A;  3QQV A;  5DHI A;  2Q9Z A;  1YJ4 A;  3WSA A;  4KQU A;  3WEJ A;  3WJN A;  2F89 F;  2DH4 A;  2QIS A;  4F6V A;  5DGM F;  3OAC B;  4ZQ8 A;  5IKA A;  2F9K F;  2E4O A;  4KVD A;  1RQJ A;  3NF2 A;  1YYS A;  5DHK A;  3G4F A;  1YYQ A;  3RYE A;  3APZ A;  4GAX A;  5ERM A;  4KPD A;  1VG4 A;  5DW7 A;  4F6X A;  2E92 A;  3KRO A;  3N45 F;  4E9U A;  3KRP A;  2F7M F;  3AQ0 A;  2PS4 A;  2AEK A;  3KRF A;  4LA6 A;  3VJD A;  3SDV A;  3DYH A;  5ER8 A;  3VJ9 A;  1V4E A;  4DZW A;  3TFN A;  5A0J A;  3N5H F;  3LMD A;  4NKE A;  4JYX A;  3TC1 A;  3WCE A;  3P5P A;  3P8L A;  4LIX A;  4XQT F;  1V4H A;  3CC9 A;  4K10 A;  3LG5 A; 
#chains in the Genus database with same CATH homology
 1JFA A;  5IMI A;  2PS6 A;  1YYT A;  4WK5 A;  4LFG A;  4LA5 A;  1WMW A;  4XQR F;  5JV2 F;  3RMG A;  4LLT A;  5IN8 A;  3VJE A;  3ASX A;  4RXA A;  3PH7 A;  3ZOU A;  1HM4 A;  1KIZ A;  2ZEU A;  1N23 A;  4DWG A;  4KPJ A;  2E93 A;  3ID0 A;  4GP1 A;  3WEK A;  3IPI A;  4P0V A;  5B0L A;  2ZCO A;  4LXW A;  1HXG A;  3OAB B;  2EWG A;  4PVY F;  5A0K A;  3ICZ A;  3P8R A;  4L2X F;  3AQB B;  3LZ9 A;  4GA3 A;  4NFJ F;  3N3D A;  5IK0 A;  2AZL A;  3CKE A;  3VJC A;  5JA0 F;  3VJA A;  4RXD A;  4N9U A;  5ERN A;  2ONH A;  1UBX A;  2F92 F;  4QPF A;  3PDE A;  2OA6 A;  5HN8 A;  2Z78 A;  1RQI A;  5B02 A;  3WCJ A;  1PS1 A;  3KRA A;  4H5C F;  3WCL A;  5E8K A;  2AET A;  4LOB A;  1HXA A;  5DGS F;  1FPS A;  1YQ7 A;  4F62 A;  2RAH A;  4DI5 A;  3P41 A;  5IK6 A;  5IK9 A;  3LEE A;  3M0G A;  5B0J A;  3VJ8 A;  4NKF A;  1HM7 A;  2AZJ A;  5ILI A;  4E1E A;  3M02 A;  3ACW A;  3LOM A;  3ICN A;  3KRP B;  5B03 A;  5EAU A;  5IM1 A;  2ZCS A;  3KRF B;  3PYA A;  3OYR A;  3N1W F;  4DEM F;  3EFQ A;  4HD1 A;  2AZK A;  5E8L A;  3Q1O A;  2Z7I A;  3Q30 A;  1WY0 A;  5EAS A;  3N46 F;  5CG6 A;  3M01 A;  2J1P A;  3W7F A;  3WC9 A;  3M9U A;  3WCH A;  4EA1 A;  5I1U A;  2ONG A;  4KUX A;  3N3L F;  2F94 F;  3WEH A;  3WCM A;  2ZY1 A;  3WEF A;  3ACX A;  4DWB A;  4GP2 A;  1VG6 A;  3N0F A;  5ILK A;  5ILY A;  5ERO A;  4LFV F;  2E8X A;  5B0M A;  2F8Z F;  1UBY A;  3N49 F;  4MC0 A;  3ICK A;  4KVY A;  3BNY A;  4KK2 A;  4LPG F;  3WCI A;  5ILZ A;  4JZX A;  4LUU A;  4OGU A;  4KVW A;  2E8U A;  1ZW5 A;  1WL1 A;  3BNX A;  2ZCR A;  4OKZ A;  2Z4W A;  4OMH A;  5DGN F;  2Q80 A;  5HN7 A;  1VG7 A;  1EZF A;  1YHM A;  1N22 A;  2OPN A;  2OPM A;  3MZV A;  5AYP A;  4E9Z A;  2E94 A;  3UCA A;  3KB9 A;  3WEG A;  3ZMC A;  3WCA A;  2Z4Y A;  1V4K A;  2VF6 A;  3LGZ B;  4FJQ A;  4RNQ A;  3V66 A;  3V1X A;  4NFI F;  5EAT A;  2PS7 A;  2Z4V A;  4N1Z F;  3N0G A;  2Q58 A;  2P1C A;  4Q23 A;  3ADZ A;  3N6K F;  5HN9 A;  5IL8 A;  3KRC A;  4KWD A;  3S9V A;  3LLW A;  1N21 A;  3SDU A;  3EGT A;  4QXS F;  2Z4X A;  2Z4Z A;  3PKO A;  4RXE A;  5B00 A;  3NRI A;  3Q2Z A;  3LDW A;  5HNA A;  1N1B A;  4P0W A;  2E8V A;  3VJB A;  3G4D A;  2PS8 A;  5DJV F;  4DHD A;  2PS5 A;  3P5R A;  3WCF A;  4H5E F;  4KVI A;  4NG6 A;  5CG5 A;  3KBK A;  5AEL A;  2Z7H A;  1YV5 A;  4EA0 A;  4LZC A;  3LGK A;  2E8T A;  1HX9 A;  4EA2 A;  3TFP A;  2J1O A;  3M00 A;  4LZ0 A;  1YHK A;  3SDR A;  4LTZ A;  5IMP A;  2OGD A;  2E8W A;  5DIQ F;  1YYU A;  3KRO B;  3N5J F;  3WE9 A;  1UBV A;  3WCC A;  1V4J A;  4JZB A;  5C05 A;  3OAC A;  2AEL A;  4JVJ F;  4H5D F;  5H9D A;  3NPK A;  1N20 A;  3AE0 A;  3EZ3 A;  3WCD A;  1N24 A;  4KQS A;  3NPR A;  1YYR A;  1HXC A;  1UBW A;  4XQS F;  2F8C F;  2Z52 A;  3QKC A;  4KKM A;  3B7L A;  5E8H A;  5DZ2 A;  5JV1 F;  1DGP A;  3AQC B;  5A0I A;  4LFE A;  4RYP A;  1DI1 A;  3V1V A;  5JUZ F;  3Q2Q A;  3N1V F;  3WEI A;  3IBA A;  2H8O A;  5IVG A;  5DJP F;  3PYB A;  5KSX F;  1VG2 A;  1WL2 A;  4UMJ A;  1WL0 A;  5ILJ A;  3SAE A;  3DYG A;  4LPH F;  4MC3 A;  3WCG A;  5B01 A;  1KIY A;  3LVS A;  4LLS A;  2E95 A;  3CP6 A;  3LJI A;  2I19 A;  5IKH A;  3WJK A;  2O1O A;  3S4J A;  5IMN A;  3RBM A;  5JV0 F;  3SDT A;  3WJO A;  1N1Z A;  4PVX F;  4OMG A;  5B0I A;  3LK5 A;  1YHL A;  1JFG A;  1WL3 A;  5DJR F;  1WKZ A;  1VG3 A;  4FP4 A;  3KRC B;  4LZ3 A;  2FTZ A;  2FOR A;  5B0K A;  1RTR A;  3SDQ A;  4JXY A;  5ILD A;  3DYF A;  3ZCD A;  4KFA A;  4NFK F;  4KQ5 A;  3KRA B;  4LTV A;  4OKM A;  2E90 A;  3OAB A;  3RYW A;  3TFV A;  5AHU B;  4DXJ A;  5IL3 A;  3MAV A;  3ICM A;  1V4I A;  2E91 A;  3TS7 A;  3WSB A;  4NUA A;  2J5C A;  2Q9Y A;  4RXC A;  3LSN A;  2ZCQ A;  2Z50 A;  3ZMB A;  5ILH A;  4MC8 A;  5AFX A;  4P0X A;  2ZEV A;  3ACY A;  3ZL6 A;  3WCB A;  4JXN A;  3QQV A;  5DHI A;  2Q9Z A;  1YJ4 A;  3WSA A;  4KQU A;  3WEJ A;  3WJN A;  2F89 F;  2DH4 A;  2QIS A;  4F6V A;  5DGM F;  3OAC B;  4ZQ8 A;  5IKA A;  2F9K F;  2E4O A;  4KVD A;  1RQJ A;  3NF2 A;  1YYS A;  5DHK A;  3G4F A;  1YYQ A;  3RYE A;  3APZ A;  4GAX A;  5ERM A;  4KPD A;  1VG4 A;  5DW7 A;  4F6X A;  2E92 A;  3KRO A;  3N45 F;  4E9U A;  3KRP A;  2F7M F;  3AQ0 A;  2PS4 A;  2AEK A;  3KRF A;  4LA6 A;  3VJD A;  3SDV A;  3DYH A;  5ER8 A;  3VJ9 A;  1V4E A;  4DZW A;  3TFN A;  5A0J A;  3N5H F;  3LMD A;  4NKE A;  4JYX A;  3TC1 A;  3WCE A;  3P5P A;  3P8L A;  4LIX A;  4XQT F;  1V4H A;  3CC9 A;  4K10 A;  3LG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...