3AQCB

M. luteus b-p 26 heterodimeric hexaprenyl diphosphate synthase in complex with magnesium and fpp analogue
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
321
structure length
321
Chain Sequence
SYKAFLNPYIIEVEKRLYECIQSDSETINKAAHHILSSGGKRVRPMFVLLSGFLNDTQKDDLIRTAVSLELVHMASLVHDDYIDNSDMRRGNTSVHIAFDKDTAIRTGHFLLARALQNIATINNSKFHQIFSKTILEVCFGEFDQMADRFNYPVSFTAYLRRINRKTAILIEASCHLGALSSQLDEQSTYHIKQFGHCIGMSYQIIDDILDYTSDEATLGKPVGSDIRNGHITYPLMAAIANLKEQDDDKLEAVVKHLTSTSDDEVYQYIVSQVKQYGIEPAELLSRKYGDKAKYHLSQLQDSNIKDYLEEIHEKMLKRVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Component A of hexaprenyl diphosphate synthase
publication title Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
pubmed doi rcsb
source organism Micrococcus luteus
molecule tags Transferase
total genus 126
structure length 321
sequence length 321
chains with identical sequence D
ec nomenclature ec 2.5.1.83: Hexaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific).
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3aqcB00
3CC9A 3N1VF 2E8TA 3OACA 3LVSA 1WL1A 3Q30A 1YV5A 3NPKA 3LOMA 3ASXA 5B00A 3ID0A 4LTZA 3Q2QA 5IK6A 1V4KA 5I1UA 2FORA 3VJ8A 1YYUA 5B01A 2E94A 4MC3A 3AE0A 3VJDA 2AZJA 2ZEUA 2F92F 3ZL6A 3WEIA 2H8OA 3BNYA 2AELA 2J1OA 3PDEA 3NPRA 2PS7A 5IL8A 4H5EF 3WCMA 3W7FA 1V4EA 3LGZB 3WEKA 3ZMBA 3LDWA 4Q23A 3WCEA 3PH7A 3RBMA 4EA0A 3VJ9A 4DWGA 5ILYA 3SDVA 5JA0F 4LPGF 5IL3A 2ONGA 2E8XA 3EZ3A 2FTZA 3WCBA 4RXDA 5B02A 1KIZA 5IMPA 1WL2A 5DGSF 4KQSA 2E91A 3P8LA 4OMHA 4E1EA 3AQCB 4F6XA 4QPFA 4NKEA 4ZQ8A 5AYPA 3VJCA 5JV1F 4GAXA 3M02A 4LFVF 4GA3A 2Z7IA 5IK9A 4NFKF 2Z4VA 4PVYF 5ILJA 5DW7A 4RXCA 4KQ5A 3IBAA 2J1PA 1ZW5A 4E9ZA 1RQJA 1VG6A 3SDRA 3KRCB 5A0KA 3ZMCA 4N9UA 2OA6A 4LPHF 3N1WF 5ILHA 4KKMA 2P1CA 2Z52A 3NF2A 4RXAA 1YYRA 4LUUA 5ERNA 1UBWA 5CG6A 3WSBA 4LLTA 5AFXA 1HM7A 4LXWA 2E8UA 3RYWA 3SDTA 5CG5A 4XQSF 4WK5A 1V4JA 5DGMF 3B7LA 3WCHA 3N3LF 3M9UA 3OABA 3WJKA 5ILKA 1VG7A 1YYSA 3NRIA 1HXGA 3TC1A 3PYBA 3S9VA 2Z4WA 5DHKA 4NFJF 3QKCA 1YYQA 5EATA 4P0WA 4F6VA 4NKFA 3WC9A 4JYXA 3LLWA 1N24A 3KRAB 4JXNA 2PS8A 3KRCA 3RMGA 2AZKA 2E8VA 3N45F 5DZ2A 4KVWA 3AQ0A 5B0LA 3WJNA 1FPSA 3WSAA 5B0JA 2Z78A 4LZ3A 3IPIA 1VG3A 3WEFA 5ERMA 4LZ0A 2DH4A 2OPMA 2E92A 2Z7HA 1YHLA 3KB9A 4DI5A 2VF6A 3ZCDA 3N49F 3V1VA 4LFEA 2PS6A 4H5CF 4LFGA 3WCCA 3ICMA 5IKAA 4EA1A 5DJRF 5C05A 3ACYA 4KUXA 2ZCRA 1WL0A 1HX9A 2Z4XA 3BNXA 3UCAA 3LG5A 3KRAA 3LK5A 3OYRA 1VG2A 3WCFA 5B03A 4NG6A 2ZCSA 1N23A 5AELA 2ZCOA 3M0GA 5B0IA 3V66A 4DZWA 3M01A 5IN8A 1JFGA 3WCAA 1VG4A 5AHUB 3ACXA 2Z4ZA 5B0MA 5E8LA 5IMNA 4LTVA 3OABB 1YQ7A 4XQTF 5IM1A 3LJIA 2OPNA 1YHKA 4KPJA 1V4HA 1WMWA 4UMJA 5E8HA 1WL3A 5DJVF 3N0GA 3P5RA 4NFIF 4MC0A 3DYGA 4RXEA 2ZY1A 1N20A 4LOBA 4DEMF 4LLSA 3P8RA 2Q80A 2E95A 2PS4A 4RYPA 1UBVA 2F8ZF 3WCJA 4JZXA 4LA6A 3MZVA 5A0JA 3N5JF 4E9UA 3N3DA 1JFAA 1KIYA 4DWBA 5DJPF 5EROA 4K10A 5HN8A 4OKZA 4LZCA 3LSNA 1UBYA 3N0FA 5ILIA 4HD1A 4F62A 5EASA 3WJOA 3KBKA 4P0VA 1DI1A 2ZEVA 2Z4YA 3SDQA 5H9DA 4KQUA 3PYAA 2F94F 2F89F 5ER8A 4H5DF 2AZLA 4FJQA 5JV2F 2OGDA 4KVIA 3WCGA 5HN9A 3WEHA 5E8KA 3ZOUA 5IK0A 3TFVA 2E93A 1EZFA 2ZCQA 4JXYA 3WCIA 1UBXA 5JV0F 2PS5A 3DYHA 5ILZA 4JZBA 3CP6A 3VJEA 1PS1A 3Q2ZA 3G4DA 3TFNA 1RQIA 4KK2A 5KSXF 3AQBB 4DHDA 2EWGA 3VJAA 4L2XF 5HN7A 3KRPB 3ACWA 2F9KF 3EGTA 2F7MF 2J5CA 3LZ9A 5IVGA 3WEGA 4EA2A 5B0KA 4P0XA 3G4FA 4KPDA 3KRFB 2E8WA 4OGUA 1N22A 1HXCA 2I19A 4RNQA 1YJ4A 4PVXF 1V4IA 3DYFA 5IMIA 1YYTA 2Q9ZA 2ONHA 3P41A 1RTRA 3EFQA 3N5HF 4KVYA 1N1BA 3LGKA 3ICZA 3M00A 3TS7A 3MAVA 3WCDA 5JUZF 4LA5A 4OKMA 5ILDA 3LEEA 1DGPA 2F8CF 1N21A 5EAUA 4GP1A 2QISA 5A0IA 3KROB 3KRPA 2E4OA 3N46F 1HM4A 4XQRF 1WKZA 4KFAA 3OACB 3APZA 3N6KF 3S4JA 2O1OA 3CKEA 3KRFA 3P5PA 3LMDA 5DHIA 2Z50A 3WCLA 1N1ZA 3VJBA 2RAHA 4OMGA 4GP2A 3TFPA 1WY0A 3PKOA 1HXAA 4FP4A 4N1ZF 2AEKA 5IKHA 3SAEA 2Q58A 3SDUA 2Q9YA 3V1XA 4KWDA 3QQVA 4DXJA 3WE9A 4JVJF 4QXSF 5DIQF 2AETA 4LIXA 4KVDA 3ICNA 4MC8A 3ADZA 3RYEA 5DGNF 3WEJA 4NUAA 3KROA 5HNAA 1YHMA 3ICKA 3Q1OA 2E90A
chains in the Genus database with same CATH superfamily
3CC9A 3N1VF 2E8TA 3OACA 3LVSA 1WL1A 3Q30A 1YV5A 3NPKA 3LOMA 3ASXA 5B00A 3ID0A 4LTZA 3Q2QA 5IK6A 1V4KA 5I1UA 2FORA 3VJ8A 1YYUA 5B01A 2E94A 4MC3A 3AE0A 3VJDA 2AZJA 2ZEUA 2F92F 3ZL6A 3WEIA 2H8OA 3BNYA 2AELA 2J1OA 3PDEA 3NPRA 2PS7A 5IL8A 4H5EF 3WCMA 3W7FA 1V4EA 3LGZB 3WEKA 3ZMBA 3LDWA 4Q23A 3WCEA 3PH7A 3RBMA 4EA0A 3VJ9A 4DWGA 5ILYA 3SDVA 5JA0F 4LPGF 5IL3A 2ONGA 2E8XA 3EZ3A 2FTZA 3WCBA 4RXDA 5B02A 1KIZA 5IMPA 1WL2A 5DGSF 4KQSA 2E91A 3P8LA 4OMHA 4E1EA 3AQCB 4F6XA 4QPFA 4NKEA 4ZQ8A 5AYPA 3VJCA 5JV1F 4GAXA 3M02A 4LFVF 4GA3A 2Z7IA 5IK9A 4NFKF 2Z4VA 4PVYF 5ILJA 5DW7A 4RXCA 4KQ5A 3IBAA 2J1PA 1ZW5A 4E9ZA 1RQJA 1VG6A 3SDRA 3KRCB 5A0KA 3ZMCA 4N9UA 2OA6A 4LPHF 3N1WF 5ILHA 4KKMA 2P1CA 2Z52A 3NF2A 4RXAA 1YYRA 4LUUA 5ERNA 1UBWA 5CG6A 3WSBA 4LLTA 5AFXA 1HM7A 4LXWA 2E8UA 3RYWA 3SDTA 5CG5A 4XQSF 4WK5A 1V4JA 5DGMF 3B7LA 3WCHA 3N3LF 3M9UA 3OABA 3WJKA 5ILKA 1VG7A 1YYSA 3NRIA 1HXGA 3TC1A 3PYBA 3S9VA 2Z4WA 5DHKA 4NFJF 3QKCA 1YYQA 5EATA 4P0WA 4F6VA 4NKFA 3WC9A 4JYXA 3LLWA 1N24A 3KRAB 4JXNA 2PS8A 3KRCA 3RMGA 2AZKA 2E8VA 3N45F 5DZ2A 4KVWA 3AQ0A 5B0LA 3WJNA 1FPSA 3WSAA 5B0JA 2Z78A 4LZ3A 3IPIA 1VG3A 3WEFA 5ERMA 4LZ0A 2DH4A 2OPMA 2E92A 2Z7HA 1YHLA 3KB9A 4DI5A 2VF6A 3ZCDA 3N49F 3V1VA 4LFEA 2PS6A 4H5CF 4LFGA 3WCCA 3ICMA 5IKAA 4EA1A 5DJRF 5C05A 3ACYA 4KUXA 2ZCRA 1WL0A 1HX9A 2Z4XA 3BNXA 3UCAA 3LG5A 3KRAA 3LK5A 3OYRA 1VG2A 3WCFA 5B03A 4NG6A 2ZCSA 1N23A 5AELA 2ZCOA 3M0GA 5B0IA 3V66A 4DZWA 3M01A 5IN8A 1JFGA 3WCAA 1VG4A 5AHUB 3ACXA 2Z4ZA 5B0MA 5E8LA 5IMNA 4LTVA 3OABB 1YQ7A 4XQTF 5IM1A 3LJIA 2OPNA 1YHKA 4KPJA 1V4HA 1WMWA 4UMJA 5E8HA 1WL3A 5DJVF 3N0GA 3P5RA 4NFIF 4MC0A 3DYGA 4RXEA 2ZY1A 1N20A 4LOBA 4DEMF 4LLSA 3P8RA 2Q80A 2E95A 2PS4A 4RYPA 1UBVA 2F8ZF 3WCJA 4JZXA 4LA6A 3MZVA 5A0JA 3N5JF 4E9UA 3N3DA 1JFAA 1KIYA 4DWBA 5DJPF 5EROA 4K10A 5HN8A 4OKZA 4LZCA 3LSNA 1UBYA 3N0FA 5ILIA 4HD1A 4F62A 5EASA 3WJOA 3KBKA 4P0VA 1DI1A 2ZEVA 2Z4YA 3SDQA 5H9DA 4KQUA 3PYAA 2F94F 2F89F 5ER8A 4H5DF 2AZLA 4FJQA 5JV2F 2OGDA 4KVIA 3WCGA 5HN9A 3WEHA 5E8KA 3ZOUA 5IK0A 3TFVA 2E93A 1EZFA 2ZCQA 4JXYA 3WCIA 1UBXA 5JV0F 2PS5A 3DYHA 5ILZA 4JZBA 3CP6A 3VJEA 1PS1A 3Q2ZA 3G4DA 3TFNA 1RQIA 4KK2A 5KSXF 3AQBB 4DHDA 2EWGA 3VJAA 4L2XF 5HN7A 3KRPB 3ACWA 2F9KF 3EGTA 2F7MF 2J5CA 3LZ9A 5IVGA 3WEGA 4EA2A 5B0KA 4P0XA 3G4FA 4KPDA 3KRFB 2E8WA 4OGUA 1N22A 1HXCA 2I19A 4RNQA 1YJ4A 4PVXF 1V4IA 3DYFA 5IMIA 1YYTA 2Q9ZA 2ONHA 3P41A 1RTRA 3EFQA 3N5HF 4KVYA 1N1BA 3LGKA 3ICZA 3M00A 3TS7A 3MAVA 3WCDA 5JUZF 4LA5A 4OKMA 5ILDA 3LEEA 1DGPA 2F8CF 1N21A 5EAUA 4GP1A 2QISA 5A0IA 3KROB 3KRPA 2E4OA 3N46F 1HM4A 4XQRF 1WKZA 4KFAA 3OACB 3APZA 3N6KF 3S4JA 2O1OA 3CKEA 3KRFA 3P5PA 3LMDA 5DHIA 2Z50A 3WCLA 1N1ZA 3VJBA 2RAHA 4OMGA 4GP2A 3TFPA 1WY0A 3PKOA 1HXAA 4FP4A 4N1ZF 2AEKA 5IKHA 3SAEA 2Q58A 3SDUA 2Q9YA 3V1XA 4KWDA 3QQVA 4DXJA 3WE9A 4JVJF 4QXSF 5DIQF 2AETA 4LIXA 4KVDA 3ICNA 4MC8A 3ADZA 3RYEA 5DGNF 3WEJA 4NUAA 3KROA 5HNAA 1YHMA 3ICKA 3Q1OA 2E90A
chains in the Genus database with same CATH topology
3CC9A 3N1VF 2E8TA 3OACA 3LVSA 1WL1A 3Q30A 1YV5A 3NPKA 3LOMA 3ASXA 5B00A 3ID0A 4LTZA 3Q2QA 5IK6A 1V4KA 5I1UA 2FORA 3VJ8A 1YYUA 5B01A 2E94A 4MC3A 3AE0A 3VJDA 2AZJA 2ZEUA 2F92F 3ZL6A 3WEIA 2H8OA 3BNYA 2AELA 2J1OA 3PDEA 3NPRA 2PS7A 5IL8A 4H5EF 3WCMA 3W7FA 1V4EA 3LGZB 3WEKA 3ZMBA 3LDWA 4Q23A 3WCEA 3PH7A 3RBMA 4EA0A 3VJ9A 4DWGA 5ILYA 3SDVA 5JA0F 4LPGF 5IL3A 2ONGA 2E8XA 3EZ3A 2FTZA 3WCBA 4RXDA 5B02A 1KIZA 5IMPA 1WL2A 5DGSF 4KQSA 2E91A 3P8LA 4OMHA 4E1EA 3AQCB 4F6XA 4QPFA 4NKEA 4ZQ8A 5AYPA 3VJCA 5JV1F 4GAXA 3M02A 4LFVF 4GA3A 2Z7IA 5IK9A 4NFKF 2Z4VA 4PVYF 5ILJA 5DW7A 4RXCA 4KQ5A 3IBAA 2J1PA 1ZW5A 4E9ZA 1RQJA 1VG6A 3SDRA 3KRCB 5A0KA 3ZMCA 4N9UA 2OA6A 4LPHF 3N1WF 5ILHA 4KKMA 2P1CA 2Z52A 3NF2A 4RXAA 1YYRA 4LUUA 5ERNA 1UBWA 5CG6A 3WSBA 4LLTA 5AFXA 1HM7A 4LXWA 2E8UA 3RYWA 3SDTA 5CG5A 4XQSF 4WK5A 1V4JA 5DGMF 3B7LA 3WCHA 3N3LF 3M9UA 3OABA 3WJKA 5ILKA 1VG7A 1YYSA 3NRIA 1HXGA 3TC1A 3PYBA 3S9VA 2Z4WA 5DHKA 4NFJF 3QKCA 1YYQA 5EATA 4P0WA 4F6VA 4NKFA 3WC9A 4JYXA 3LLWA 1N24A 3KRAB 4JXNA 2PS8A 3KRCA 3RMGA 2AZKA 2E8VA 3N45F 5DZ2A 4KVWA 3AQ0A 5B0LA 3WJNA 1FPSA 3WSAA 5B0JA 2Z78A 4LZ3A 3IPIA 1VG3A 3WEFA 5ERMA 4LZ0A 2DH4A 2OPMA 2E92A 2Z7HA 1YHLA 3KB9A 4DI5A 2VF6A 3ZCDA 3N49F 3V1VA 4LFEA 2PS6A 4H5CF 4LFGA 3WCCA 3ICMA 5IKAA 4EA1A 5DJRF 5C05A 3ACYA 4KUXA 2ZCRA 1WL0A 1HX9A 2Z4XA 3BNXA 3UCAA 3LG5A 3KRAA 3LK5A 3OYRA 1VG2A 3WCFA 5B03A 4NG6A 2ZCSA 1N23A 5AELA 2ZCOA 3M0GA 5B0IA 3V66A 4DZWA 3M01A 5IN8A 1JFGA 3WCAA 1VG4A 5AHUB 3ACXA 2Z4ZA 5B0MA 5E8LA 5IMNA 4LTVA 3OABB 1YQ7A 4XQTF 5IM1A 3LJIA 2OPNA 1YHKA 4KPJA 1V4HA 1WMWA 4UMJA 5E8HA 1WL3A 5DJVF 3N0GA 3P5RA 4NFIF 4MC0A 3DYGA 4RXEA 2ZY1A 1N20A 4LOBA 4DEMF 4LLSA 3P8RA 2Q80A 2E95A 2PS4A 4RYPA 1UBVA 2F8ZF 3WCJA 4JZXA 4LA6A 3MZVA 5A0JA 3N5JF 4E9UA 3N3DA 1JFAA 1KIYA 4DWBA 5DJPF 5EROA 4K10A 5HN8A 4OKZA 4LZCA 3LSNA 1UBYA 3N0FA 5ILIA 4HD1A 4F62A 5EASA 3WJOA 3KBKA 4P0VA 1DI1A 2ZEVA 2Z4YA 3SDQA 5H9DA 4KQUA 3PYAA 2F94F 2F89F 5ER8A 4H5DF 2AZLA 4FJQA 5JV2F 2OGDA 4KVIA 3WCGA 5HN9A 3WEHA 5E8KA 3ZOUA 5IK0A 3TFVA 2E93A 1EZFA 2ZCQA 4JXYA 3WCIA 1UBXA 5JV0F 2PS5A 3DYHA 5ILZA 4JZBA 3CP6A 3VJEA 1PS1A 3Q2ZA 3G4DA 3TFNA 1RQIA 4KK2A 5KSXF 3AQBB 4DHDA 2EWGA 3VJAA 4L2XF 5HN7A 3KRPB 3ACWA 2F9KF 3EGTA 2F7MF 2J5CA 3LZ9A 5IVGA 3WEGA 4EA2A 5B0KA 4P0XA 3G4FA 4KPDA 3KRFB 2E8WA 4OGUA 1N22A 1HXCA 2I19A 4RNQA 1YJ4A 4PVXF 1V4IA 3DYFA 5IMIA 1YYTA 2Q9ZA 2ONHA 3P41A 1RTRA 3EFQA 3N5HF 4KVYA 1N1BA 3LGKA 3ICZA 3M00A 3TS7A 3MAVA 3WCDA 5JUZF 4LA5A 4OKMA 5ILDA 3LEEA 1DGPA 2F8CF 1N21A 5EAUA 4GP1A 2QISA 5A0IA 3KROB 3KRPA 2E4OA 3N46F 1HM4A 4XQRF 1WKZA 4KFAA 3OACB 3APZA 3N6KF 3S4JA 2O1OA 3CKEA 3KRFA 3P5PA 3LMDA 5DHIA 2Z50A 3WCLA 1N1ZA 3VJBA 2RAHA 4OMGA 4GP2A 3TFPA 1WY0A 3PKOA 1HXAA 4FP4A 4N1ZF 2AEKA 5IKHA 3SAEA 2Q58A 3SDUA 2Q9YA 3V1XA 4KWDA 3QQVA 4DXJA 3WE9A 4JVJF 4QXSF 5DIQF 2AETA 4LIXA 4KVDA 3ICNA 4MC8A 3ADZA 3RYEA 5DGNF 3WEJA 4NUAA 3KROA 5HNAA 1YHMA 3ICKA 3Q1OA 2E90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC9 A;  3N1V F;  2E8T A;  3OAC A;  3LVS A;  1WL1 A;  3Q30 A;  1YV5 A;  3NPK A;  3LOM A;  3ASX A;  5B00 A;  3ID0 A;  4LTZ A;  3Q2Q A;  5IK6 A;  1V4K A;  5I1U A;  2FOR A;  3VJ8 A;  1YYU A;  5B01 A;  2E94 A;  4MC3 A;  3AE0 A;  3VJD A;  2AZJ A;  2ZEU A;  2F92 F;  3ZL6 A;  3WEI A;  2H8O A;  3BNY A;  2AEL A;  2J1O A;  3PDE A;  3NPR A;  2PS7 A;  5IL8 A;  4H5E F;  3WCM A;  3W7F A;  1V4E A;  3LGZ B;  3WEK A;  3ZMB A;  3LDW A;  4Q23 A;  3WCE A;  3PH7 A;  3RBM A;  4EA0 A;  3VJ9 A;  4DWG A;  5ILY A;  3SDV A;  5JA0 F;  4LPG F;  5IL3 A;  2ONG A;  2E8X A;  3EZ3 A;  2FTZ A;  3WCB A;  4RXD A;  5B02 A;  1KIZ A;  5IMP A;  1WL2 A;  5DGS F;  4KQS A;  2E91 A;  3P8L A;  4OMH A;  4E1E A;  3AQC B;  4F6X A;  4QPF A;  4NKE A;  4ZQ8 A;  5AYP A;  3VJC A;  5JV1 F;  4GAX A;  3M02 A;  4LFV F;  4GA3 A;  2Z7I A;  5IK9 A;  4NFK F;  2Z4V A;  4PVY F;  5ILJ A;  5DW7 A;  4RXC A;  4KQ5 A;  3IBA A;  2J1P A;  1ZW5 A;  4E9Z A;  1RQJ A;  1VG6 A;  3SDR A;  3KRC B;  5A0K A;  3ZMC A;  4N9U A;  2OA6 A;  4LPH F;  3N1W F;  5ILH A;  4KKM A;  2P1C A;  2Z52 A;  3NF2 A;  4RXA A;  1YYR A;  4LUU A;  5ERN A;  1UBW A;  5CG6 A;  3WSB A;  4LLT A;  5AFX A;  1HM7 A;  4LXW A;  2E8U A;  3RYW A;  3SDT A;  5CG5 A;  4XQS F;  4WK5 A;  1V4J A;  5DGM F;  3B7L A;  3WCH A;  3N3L F;  3M9U A;  3OAB A;  3WJK A;  5ILK A;  1VG7 A;  1YYS A;  3NRI A;  1HXG A;  3TC1 A;  3PYB A;  3S9V A;  2Z4W A;  5DHK A;  4NFJ F;  3QKC A;  1YYQ A;  5EAT A;  4P0W A;  4F6V A;  4NKF A;  3WC9 A;  4JYX A;  3LLW A;  1N24 A;  3KRA B;  4JXN A;  2PS8 A;  3KRC A;  3RMG A;  2AZK A;  2E8V A;  3N45 F;  5DZ2 A;  4KVW A;  3AQ0 A;  5B0L A;  3WJN A;  1FPS A;  3WSA A;  5B0J A;  2Z78 A;  4LZ3 A;  3IPI A;  1VG3 A;  3WEF A;  5ERM A;  4LZ0 A;  2DH4 A;  2OPM A;  2E92 A;  2Z7H A;  1YHL A;  3KB9 A;  4DI5 A;  2VF6 A;  3ZCD A;  3N49 F;  3V1V A;  4LFE A;  2PS6 A;  4H5C F;  4LFG A;  3WCC A;  3ICM A;  5IKA A;  4EA1 A;  5DJR F;  5C05 A;  3ACY A;  4KUX A;  2ZCR A;  1WL0 A;  1HX9 A;  2Z4X A;  3BNX A;  3UCA A;  3LG5 A;  3KRA A;  3LK5 A;  3OYR A;  1VG2 A;  3WCF A;  5B03 A;  4NG6 A;  2ZCS A;  1N23 A;  5AEL A;  2ZCO A;  3M0G A;  5B0I A;  3V66 A;  4DZW A;  3M01 A;  5IN8 A;  1JFG A;  3WCA A;  1VG4 A;  5AHU B;  3ACX A;  2Z4Z A;  5B0M A;  5E8L A;  5IMN A;  4LTV A;  3OAB B;  1YQ7 A;  4XQT F;  5IM1 A;  3LJI A;  2OPN A;  1YHK A;  4KPJ A;  1V4H A;  1WMW A;  4UMJ A;  5E8H A;  1WL3 A;  5DJV F;  3N0G A;  3P5R A;  4NFI F;  4MC0 A;  3DYG A;  4RXE A;  2ZY1 A;  1N20 A;  4LOB A;  4DEM F;  4LLS A;  3P8R A;  2Q80 A;  2E95 A;  2PS4 A;  4RYP A;  1UBV A;  2F8Z F;  3WCJ A;  4JZX A;  4LA6 A;  3MZV A;  5A0J A;  3N5J F;  4E9U A;  3N3D A;  1JFA A;  1KIY A;  4DWB A;  5DJP F;  5ERO A;  4K10 A;  5HN8 A;  4OKZ A;  4LZC A;  3LSN A;  1UBY A;  3N0F A;  5ILI A;  4HD1 A;  4F62 A;  5EAS A;  3WJO A;  3KBK A;  4P0V A;  1DI1 A;  2ZEV A;  2Z4Y A;  3SDQ A;  5H9D A;  4KQU A;  3PYA A;  2F94 F;  2F89 F;  5ER8 A;  4H5D F;  2AZL A;  4FJQ A;  5JV2 F;  2OGD A;  4KVI A;  3WCG A;  5HN9 A;  3WEH A;  5E8K A;  3ZOU A;  5IK0 A;  3TFV A;  2E93 A;  1EZF A;  2ZCQ A;  4JXY A;  3WCI A;  1UBX A;  5JV0 F;  2PS5 A;  3DYH A;  5ILZ A;  4JZB A;  3CP6 A;  3VJE A;  1PS1 A;  3Q2Z A;  3G4D A;  3TFN A;  1RQI A;  4KK2 A;  5KSX F;  3AQB B;  4DHD A;  2EWG A;  3VJA A;  4L2X F;  5HN7 A;  3KRP B;  3ACW A;  2F9K F;  3EGT A;  2F7M F;  2J5C A;  3LZ9 A;  5IVG A;  3WEG A;  4EA2 A;  5B0K A;  4P0X A;  3G4F A;  4KPD A;  3KRF B;  2E8W A;  4OGU A;  1N22 A;  1HXC A;  2I19 A;  4RNQ A;  1YJ4 A;  4PVX F;  1V4I A;  3DYF A;  5IMI A;  1YYT A;  2Q9Z A;  2ONH A;  3P41 A;  1RTR A;  3EFQ A;  3N5H F;  4KVY A;  1N1B A;  3LGK A;  3ICZ A;  3M00 A;  3TS7 A;  3MAV A;  3WCD A;  5JUZ F;  4LA5 A;  4OKM A;  5ILD A;  3LEE A;  1DGP A;  2F8C F;  1N21 A;  5EAU A;  4GP1 A;  2QIS A;  5A0I A;  3KRO B;  3KRP A;  2E4O A;  3N46 F;  1HM4 A;  4XQR F;  1WKZ A;  4KFA A;  3OAC B;  3APZ A;  3N6K F;  3S4J A;  2O1O A;  3CKE A;  3KRF A;  3P5P A;  3LMD A;  5DHI A;  2Z50 A;  3WCL A;  1N1Z A;  3VJB A;  2RAH A;  4OMG A;  4GP2 A;  3TFP A;  1WY0 A;  3PKO A;  1HXA A;  4FP4 A;  4N1Z F;  2AEK A;  5IKH A;  3SAE A;  2Q58 A;  3SDU A;  2Q9Y A;  3V1X A;  4KWD A;  3QQV A;  4DXJ A;  3WE9 A;  4JVJ F;  4QXS F;  5DIQ F;  2AET A;  4LIX A;  4KVD A;  3ICN A;  4MC8 A;  3ADZ A;  3RYE A;  5DGN F;  3WEJ A;  4NUA A;  3KRO A;  5HNA A;  1YHM A;  3ICK A;  3Q1O A;  2E90 A; 
#chains in the Genus database with same CATH topology
 3CC9 A;  3N1V F;  2E8T A;  3OAC A;  3LVS A;  1WL1 A;  3Q30 A;  1YV5 A;  3NPK A;  3LOM A;  3ASX A;  5B00 A;  3ID0 A;  4LTZ A;  3Q2Q A;  5IK6 A;  1V4K A;  5I1U A;  2FOR A;  3VJ8 A;  1YYU A;  5B01 A;  2E94 A;  4MC3 A;  3AE0 A;  3VJD A;  2AZJ A;  2ZEU A;  2F92 F;  3ZL6 A;  3WEI A;  2H8O A;  3BNY A;  2AEL A;  2J1O A;  3PDE A;  3NPR A;  2PS7 A;  5IL8 A;  4H5E F;  3WCM A;  3W7F A;  1V4E A;  3LGZ B;  3WEK A;  3ZMB A;  3LDW A;  4Q23 A;  3WCE A;  3PH7 A;  3RBM A;  4EA0 A;  3VJ9 A;  4DWG A;  5ILY A;  3SDV A;  5JA0 F;  4LPG F;  5IL3 A;  2ONG A;  2E8X A;  3EZ3 A;  2FTZ A;  3WCB A;  4RXD A;  5B02 A;  1KIZ A;  5IMP A;  1WL2 A;  5DGS F;  4KQS A;  2E91 A;  3P8L A;  4OMH A;  4E1E A;  3AQC B;  4F6X A;  4QPF A;  4NKE A;  4ZQ8 A;  5AYP A;  3VJC A;  5JV1 F;  4GAX A;  3M02 A;  4LFV F;  4GA3 A;  2Z7I A;  5IK9 A;  4NFK F;  2Z4V A;  4PVY F;  5ILJ A;  5DW7 A;  4RXC A;  4KQ5 A;  3IBA A;  2J1P A;  1ZW5 A;  4E9Z A;  1RQJ A;  1VG6 A;  3SDR A;  3KRC B;  5A0K A;  3ZMC A;  4N9U A;  2OA6 A;  4LPH F;  3N1W F;  5ILH A;  4KKM A;  2P1C A;  2Z52 A;  3NF2 A;  4RXA A;  1YYR A;  4LUU A;  5ERN A;  1UBW A;  5CG6 A;  3WSB A;  4LLT A;  5AFX A;  1HM7 A;  4LXW A;  2E8U A;  3RYW A;  3SDT A;  5CG5 A;  4XQS F;  4WK5 A;  1V4J A;  5DGM F;  3B7L A;  3WCH A;  3N3L F;  3M9U A;  3OAB A;  3WJK A;  5ILK A;  1VG7 A;  1YYS A;  3NRI A;  1HXG A;  3TC1 A;  3PYB A;  3S9V A;  2Z4W A;  5DHK A;  4NFJ F;  3QKC A;  1YYQ A;  5EAT A;  4P0W A;  4F6V A;  4NKF A;  3WC9 A;  4JYX A;  3LLW A;  1N24 A;  3KRA B;  4JXN A;  2PS8 A;  3KRC A;  3RMG A;  2AZK A;  2E8V A;  3N45 F;  5DZ2 A;  4KVW A;  3AQ0 A;  5B0L A;  3WJN A;  1FPS A;  3WSA A;  5B0J A;  2Z78 A;  4LZ3 A;  3IPI A;  1VG3 A;  3WEF A;  5ERM A;  4LZ0 A;  2DH4 A;  2OPM A;  2E92 A;  2Z7H A;  1YHL A;  3KB9 A;  4DI5 A;  2VF6 A;  3ZCD A;  3N49 F;  3V1V A;  4LFE A;  2PS6 A;  4H5C F;  4LFG A;  3WCC A;  3ICM A;  5IKA A;  4EA1 A;  5DJR F;  5C05 A;  3ACY A;  4KUX A;  2ZCR A;  1WL0 A;  1HX9 A;  2Z4X A;  3BNX A;  3UCA A;  3LG5 A;  3KRA A;  3LK5 A;  3OYR A;  1VG2 A;  3WCF A;  5B03 A;  4NG6 A;  2ZCS A;  1N23 A;  5AEL A;  2ZCO A;  3M0G A;  5B0I A;  3V66 A;  4DZW A;  3M01 A;  5IN8 A;  1JFG A;  3WCA A;  1VG4 A;  5AHU B;  3ACX A;  2Z4Z A;  5B0M A;  5E8L A;  5IMN A;  4LTV A;  3OAB B;  1YQ7 A;  4XQT F;  5IM1 A;  3LJI A;  2OPN A;  1YHK A;  4KPJ A;  1V4H A;  1WMW A;  4UMJ A;  5E8H A;  1WL3 A;  5DJV F;  3N0G A;  3P5R A;  4NFI F;  4MC0 A;  3DYG A;  4RXE A;  2ZY1 A;  1N20 A;  4LOB A;  4DEM F;  4LLS A;  3P8R A;  2Q80 A;  2E95 A;  2PS4 A;  4RYP A;  1UBV A;  2F8Z F;  3WCJ A;  4JZX A;  4LA6 A;  3MZV A;  5A0J A;  3N5J F;  4E9U A;  3N3D A;  1JFA A;  1KIY A;  4DWB A;  5DJP F;  5ERO A;  4K10 A;  5HN8 A;  4OKZ A;  4LZC A;  3LSN A;  1UBY A;  3N0F A;  5ILI A;  4HD1 A;  4F62 A;  5EAS A;  3WJO A;  3KBK A;  4P0V A;  1DI1 A;  2ZEV A;  2Z4Y A;  3SDQ A;  5H9D A;  4KQU A;  3PYA A;  2F94 F;  2F89 F;  5ER8 A;  4H5D F;  2AZL A;  4FJQ A;  5JV2 F;  2OGD A;  4KVI A;  3WCG A;  5HN9 A;  3WEH A;  5E8K A;  3ZOU A;  5IK0 A;  3TFV A;  2E93 A;  1EZF A;  2ZCQ A;  4JXY A;  3WCI A;  1UBX A;  5JV0 F;  2PS5 A;  3DYH A;  5ILZ A;  4JZB A;  3CP6 A;  3VJE A;  1PS1 A;  3Q2Z A;  3G4D A;  3TFN A;  1RQI A;  4KK2 A;  5KSX F;  3AQB B;  4DHD A;  2EWG A;  3VJA A;  4L2X F;  5HN7 A;  3KRP B;  3ACW A;  2F9K F;  3EGT A;  2F7M F;  2J5C A;  3LZ9 A;  5IVG A;  3WEG A;  4EA2 A;  5B0K A;  4P0X A;  3G4F A;  4KPD A;  3KRF B;  2E8W A;  4OGU A;  1N22 A;  1HXC A;  2I19 A;  4RNQ A;  1YJ4 A;  4PVX F;  1V4I A;  3DYF A;  5IMI A;  1YYT A;  2Q9Z A;  2ONH A;  3P41 A;  1RTR A;  3EFQ A;  3N5H F;  4KVY A;  1N1B A;  3LGK A;  3ICZ A;  3M00 A;  3TS7 A;  3MAV A;  3WCD A;  5JUZ F;  4LA5 A;  4OKM A;  5ILD A;  3LEE A;  1DGP A;  2F8C F;  1N21 A;  5EAU A;  4GP1 A;  2QIS A;  5A0I A;  3KRO B;  3KRP A;  2E4O A;  3N46 F;  1HM4 A;  4XQR F;  1WKZ A;  4KFA A;  3OAC B;  3APZ A;  3N6K F;  3S4J A;  2O1O A;  3CKE A;  3KRF A;  3P5P A;  3LMD A;  5DHI A;  2Z50 A;  3WCL A;  1N1Z A;  3VJB A;  2RAH A;  4OMG A;  4GP2 A;  3TFP A;  1WY0 A;  3PKO A;  1HXA A;  4FP4 A;  4N1Z F;  2AEK A;  5IKH A;  3SAE A;  2Q58 A;  3SDU A;  2Q9Y A;  3V1X A;  4KWD A;  3QQV A;  4DXJ A;  3WE9 A;  4JVJ F;  4QXS F;  5DIQ F;  2AET A;  4LIX A;  4KVD A;  3ICN A;  4MC8 A;  3ADZ A;  3RYE A;  5DGN F;  3WEJ A;  4NUA A;  3KRO A;  5HNA A;  1YHM A;  3ICK A;  3Q1O A;  2E90 A; 
#chains in the Genus database with same CATH homology
 3CC9 A;  3N1V F;  2E8T A;  3OAC A;  3LVS A;  1WL1 A;  3Q30 A;  1YV5 A;  3NPK A;  3LOM A;  3ASX A;  5B00 A;  3ID0 A;  4LTZ A;  3Q2Q A;  5IK6 A;  1V4K A;  5I1U A;  2FOR A;  3VJ8 A;  1YYU A;  5B01 A;  2E94 A;  4MC3 A;  3AE0 A;  3VJD A;  2AZJ A;  2ZEU A;  2F92 F;  3ZL6 A;  3WEI A;  2H8O A;  3BNY A;  2AEL A;  2J1O A;  3PDE A;  3NPR A;  2PS7 A;  5IL8 A;  4H5E F;  3WCM A;  3W7F A;  1V4E A;  3LGZ B;  3WEK A;  3ZMB A;  3LDW A;  4Q23 A;  3WCE A;  3PH7 A;  3RBM A;  4EA0 A;  3VJ9 A;  4DWG A;  5ILY A;  3SDV A;  5JA0 F;  4LPG F;  5IL3 A;  2ONG A;  2E8X A;  3EZ3 A;  2FTZ A;  3WCB A;  4RXD A;  5B02 A;  1KIZ A;  5IMP A;  1WL2 A;  5DGS F;  4KQS A;  2E91 A;  3P8L A;  4OMH A;  4E1E A;  3AQC B;  4F6X A;  4QPF A;  4NKE A;  4ZQ8 A;  5AYP A;  3VJC A;  5JV1 F;  4GAX A;  3M02 A;  4LFV F;  4GA3 A;  2Z7I A;  5IK9 A;  4NFK F;  2Z4V A;  4PVY F;  5ILJ A;  5DW7 A;  4RXC A;  4KQ5 A;  3IBA A;  2J1P A;  1ZW5 A;  4E9Z A;  1RQJ A;  1VG6 A;  3SDR A;  3KRC B;  5A0K A;  3ZMC A;  4N9U A;  2OA6 A;  4LPH F;  3N1W F;  5ILH A;  4KKM A;  2P1C A;  2Z52 A;  3NF2 A;  4RXA A;  1YYR A;  4LUU A;  5ERN A;  1UBW A;  5CG6 A;  3WSB A;  4LLT A;  5AFX A;  1HM7 A;  4LXW A;  2E8U A;  3RYW A;  3SDT A;  5CG5 A;  4XQS F;  4WK5 A;  1V4J A;  5DGM F;  3B7L A;  3WCH A;  3N3L F;  3M9U A;  3OAB A;  3WJK A;  5ILK A;  1VG7 A;  1YYS A;  3NRI A;  1HXG A;  3TC1 A;  3PYB A;  3S9V A;  2Z4W A;  5DHK A;  4NFJ F;  3QKC A;  1YYQ A;  5EAT A;  4P0W A;  4F6V A;  4NKF A;  3WC9 A;  4JYX A;  3LLW A;  1N24 A;  3KRA B;  4JXN A;  2PS8 A;  3KRC A;  3RMG A;  2AZK A;  2E8V A;  3N45 F;  5DZ2 A;  4KVW A;  3AQ0 A;  5B0L A;  3WJN A;  1FPS A;  3WSA A;  5B0J A;  2Z78 A;  4LZ3 A;  3IPI A;  1VG3 A;  3WEF A;  5ERM A;  4LZ0 A;  2DH4 A;  2OPM A;  2E92 A;  2Z7H A;  1YHL A;  3KB9 A;  4DI5 A;  2VF6 A;  3ZCD A;  3N49 F;  3V1V A;  4LFE A;  2PS6 A;  4H5C F;  4LFG A;  3WCC A;  3ICM A;  5IKA A;  4EA1 A;  5DJR F;  5C05 A;  3ACY A;  4KUX A;  2ZCR A;  1WL0 A;  1HX9 A;  2Z4X A;  3BNX A;  3UCA A;  3LG5 A;  3KRA A;  3LK5 A;  3OYR A;  1VG2 A;  3WCF A;  5B03 A;  4NG6 A;  2ZCS A;  1N23 A;  5AEL A;  2ZCO A;  3M0G A;  5B0I A;  3V66 A;  4DZW A;  3M01 A;  5IN8 A;  1JFG A;  3WCA A;  1VG4 A;  5AHU B;  3ACX A;  2Z4Z A;  5B0M A;  5E8L A;  5IMN A;  4LTV A;  3OAB B;  1YQ7 A;  4XQT F;  5IM1 A;  3LJI A;  2OPN A;  1YHK A;  4KPJ A;  1V4H A;  1WMW A;  4UMJ A;  5E8H A;  1WL3 A;  5DJV F;  3N0G A;  3P5R A;  4NFI F;  4MC0 A;  3DYG A;  4RXE A;  2ZY1 A;  1N20 A;  4LOB A;  4DEM F;  4LLS A;  3P8R A;  2Q80 A;  2E95 A;  2PS4 A;  4RYP A;  1UBV A;  2F8Z F;  3WCJ A;  4JZX A;  4LA6 A;  3MZV A;  5A0J A;  3N5J F;  4E9U A;  3N3D A;  1JFA A;  1KIY A;  4DWB A;  5DJP F;  5ERO A;  4K10 A;  5HN8 A;  4OKZ A;  4LZC A;  3LSN A;  1UBY A;  3N0F A;  5ILI A;  4HD1 A;  4F62 A;  5EAS A;  3WJO A;  3KBK A;  4P0V A;  1DI1 A;  2ZEV A;  2Z4Y A;  3SDQ A;  5H9D A;  4KQU A;  3PYA A;  2F94 F;  2F89 F;  5ER8 A;  4H5D F;  2AZL A;  4FJQ A;  5JV2 F;  2OGD A;  4KVI A;  3WCG A;  5HN9 A;  3WEH A;  5E8K A;  3ZOU A;  5IK0 A;  3TFV A;  2E93 A;  1EZF A;  2ZCQ A;  4JXY A;  3WCI A;  1UBX A;  5JV0 F;  2PS5 A;  3DYH A;  5ILZ A;  4JZB A;  3CP6 A;  3VJE A;  1PS1 A;  3Q2Z A;  3G4D A;  3TFN A;  1RQI A;  4KK2 A;  5KSX F;  3AQB B;  4DHD A;  2EWG A;  3VJA A;  4L2X F;  5HN7 A;  3KRP B;  3ACW A;  2F9K F;  3EGT A;  2F7M F;  2J5C A;  3LZ9 A;  5IVG A;  3WEG A;  4EA2 A;  5B0K A;  4P0X A;  3G4F A;  4KPD A;  3KRF B;  2E8W A;  4OGU A;  1N22 A;  1HXC A;  2I19 A;  4RNQ A;  1YJ4 A;  4PVX F;  1V4I A;  3DYF A;  5IMI A;  1YYT A;  2Q9Z A;  2ONH A;  3P41 A;  1RTR A;  3EFQ A;  3N5H F;  4KVY A;  1N1B A;  3LGK A;  3ICZ A;  3M00 A;  3TS7 A;  3MAV A;  3WCD A;  5JUZ F;  4LA5 A;  4OKM A;  5ILD A;  3LEE A;  1DGP A;  2F8C F;  1N21 A;  5EAU A;  4GP1 A;  2QIS A;  5A0I A;  3KRO B;  3KRP A;  2E4O A;  3N46 F;  1HM4 A;  4XQR F;  1WKZ A;  4KFA A;  3OAC B;  3APZ A;  3N6K F;  3S4J A;  2O1O A;  3CKE A;  3KRF A;  3P5P A;  3LMD A;  5DHI A;  2Z50 A;  3WCL A;  1N1Z A;  3VJB A;  2RAH A;  4OMG A;  4GP2 A;  3TFP A;  1WY0 A;  3PKO A;  1HXA A;  4FP4 A;  4N1Z F;  2AEK A;  5IKH A;  3SAE A;  2Q58 A;  3SDU A;  2Q9Y A;  3V1X A;  4KWD A;  3QQV A;  4DXJ A;  3WE9 A;  4JVJ F;  4QXS F;  5DIQ F;  2AET A;  4LIX A;  4KVD A;  3ICN A;  4MC8 A;  3ADZ A;  3RYE A;  5DGN F;  3WEJ A;  4NUA A;  3KRO A;  5HNA A;  1YHM A;  3ICK A;  3Q1O A;  2E90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...