3RBMA

Crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase complexed with bph -703
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
360
structure length
355
Chain Sequence
LAFFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVKNRINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSEIDVNNINVPEQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIAVDNLIYKKIEDISMLMGEYFQIHDDYLDIFGDSTKTGKVGSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Farnesyl pyrophosphate synthase
publication title Lipophilic analogs of zoledronate and risedronate inhibit Plasmodium geranylgeranyl diphosphate synthase (GGPPS) and exhibit potent antimalarial activity.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 147
structure length 355
sequence length 360
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3rbmA00
3NPKA 3OACB 5E8LA 4LZ3A 3TC1A 2E8TA 1WMWA 5DJRF 3WCLA 5IKAA 3WSBA 4P0WA 3KRPB 4DHDA 1UBWA 4KFAA 4HD1A 3WCBA 3KB9A 3LZ9A 3S4JA 4DWGA 3PDEA 1JFAA 1WKZA 3WCIA 2Z7IA 2Q80A 5IK9A 3DYGA 5IL8A 3WCJA 3OYRA 3WEIA 3LG5A 4K10A 3ICMA 5HN8A 5JV2F 3Q30A 5JUZF 2E94A 4OKZA 5DZ2A 3M9UA 4DZWA 3ACYA 4KQUA 5EAUA 3ZL6A 3P5PA 5ILYA 1N22A 3TFNA 3SDTA 1YV5A 1V4KA 5DHKA 3N0GA 2OPMA 3QKCA 1VG6A 2E8UA 4FJQA 3WSAA 3WCMA 4OKMA 5EATA 3KRFB 3KROA 4EA0A 2H8OA 4MC0A 3LSNA 4E9ZA 3TFPA 1HX9A 3WEGA 2EWGA 3TS7A 4RXAA 4LZ0A 5E8HA 3M02A 4L2XF 3KRAB 3SDVA 4GP2A 3LEEA 3M0GA 3APZA 5EASA 3IPIA 3Q2QA 2E8WA 2ZY1A 2FORA 4JVJF 4JZXA 3WC9A 2DH4A 2Z78A 3G4DA 4P0XA 1RTRA 3ID0A 3OABB 2Z4VA 2F8CF 3VJ8A 5HNAA 1DGPA 2OPNA 4F62A 3RMGA 2AZKA 5DJVF 3BNXA 3AQ0A 1WY0A 1V4IA 4LLTA 1VG2A 4RXCA 3ICZA 4QPFA 3M00A 5B00A 4P0VA 5B0LA 5HN7A 3P8LA 3NF2A 4LA5A 2E90A 1UBXA 4JXNA 3V66A 2QISA 1PS1A 1YYTA 5IKHA 1HXGA 3N1VF 5DW7A 3QQVA 5DIQF 4EA1A 5B0JA 5IK0A 2Q9ZA 4KPDA 3M01A 3VJCA 2OGDA 4KVYA 3RYEA 5IMNA 3ZCDA 1YYSA 2ONHA 4GA3A 5AHUB 3AE0A 3PKOA 5JV1F 5JA0F 4LOBA 4KVDA 5A0KA 4OGUA 4F6XA 2ONGA 2ZEVA 4NFJF 3WJOA 3N46F 2E8XA 3LMDA 5ILKA 5E8KA 1V4EA 1WL2A 1HM4A 1HXAA 2F92F 3KRPA 3ZMBA 5DGNF 3WEKA 3N3LF 4DI5A 4KUXA 3V1VA 1WL3A 4GP1A 2PS4A 2Z4XA 2E91A 3CC9A 4LPHF 4JXYA 3PYBA 3CKEA 3IBAA 3B7LA 1ZW5A 1YYQA 4NFIF 4KKMA 1DI1A 4LIXA 3SAEA 3P41A 5IMPA 3DYFA 5IK6A 4UMJA 4KK2A 4EA2A 5EROA 4XQTF 4N9UA 4OMHA 2Q9YA 3MZVA 3LJIA 3WEJA 5ERNA 4H5EF 2F7MF 5I1UA 1N1BA 5C05A 4LLSA 5AELA 3AQCB 1V4JA 3NRIA 2AZLA 4KQSA 3G4FA 3N49F 2E92A 4LXWA 2ZCRA 4LTVA 2PS6A 5CG6A 1KIYA 3ACXA 3KRCB 3KRFA 5ER8A 5ILIA 1JFGA 5DJPF 2F8ZF 3WCFA 5DHIA 4LA6A 4LFEA 5ILHA 4ZQ8A 1N23A 4MC8A 4RXDA 5IN8A 4NFKF 5ILJA 5HN9A 4F6VA 3S9VA 3N5JF 3Q2ZA 5IMIA 4KVIA 2PS8A 4PVYF 2AELA 5A0IA 3WCDA 1YQ7A 3WCGA 2E95A 3N1WF 3N5HF 3OABA 3WEFA 1HXCA 1EZFA 2AZJA 3SDRA 4KWDA 3SDUA 4E9UA 4KVWA 2ZCSA 3ICNA 4LUUA 5B0KA 2F94F 4E1EA 3RYWA 1YHKA 3BNYA 1KIZA 3CP6A 3EFQA 1N20A 1UBVA 3WEHA 3VJBA 3ASXA 3AQBB 3KBKA 3OACA 3WJKA 3LVSA 1WL1A 3LOMA 3N45F 5IL3A 4GAXA 1YJ4A 4LZCA 4XQRF 1N21A 3ACWA 4N1ZF 1VG3A 3WE9A 3EGTA 4LFGA 3VJ9A 2E8VA 4MC3A 2VF6A 2E93A 1VG4A 3ICKA 3TFVA 1HM7A 3MAVA 4DXJA 4RXEA 2Z4ZA 3LGZB 5KSXF 5DGSF 4H5CF 2Q58A 1WL0A 3KROB 4LFVF 2FTZA 3LK5A 1RQIA 5B0IA 3ZMCA 4DEMF 4DWBA 2ZCQA 4NUAA 3WCEA 3PYAA 5CG5A 3ZOUA 3LDWA 2J5CA 5B02A 2P1CA 1N24A 4KQ5A 4JYXA 2E4OA 5AFXA 3N6KF 4LTZA 3LGKA 2Z4YA 4H5DF 1FPSA 2OA6A 3N0FA 3WCAA 3W7FA 2ZCOA 5ILDA 4WK5A 4KPJA 1YYRA 1YHMA 2PS5A 3EZ3A 2J1PA 2O1OA 5A0JA 3WCHA 5DGMF 5IM1A 4JZBA 3DYHA 4RYPA 3Q1OA 2Z4WA 4PVXF 4Q23A 5B01A 1UBYA 2AEKA 2F89F 5IVGA 2Z52A 3VJEA 3KRAA 2Z7HA 1YHLA 5ERMA 4QXSF 3NPRA 4LPGF 2I19A 4RNQA 2Z50A 4NG6A 2PS7A 3WJNA 1VG7A 4XQSF 1N1ZA 1RQJA 3PH7A 3P5RA 4NKEA 3KRCA 3LLWA 2AETA 5ILZA 2RAHA 3RBMA 4NKFA 3SDQA 5B0MA 3WCCA 3VJDA 3VJAA 5AYPA 3P8RA 2J1OA 3ADZA 1YYUA 5B03A 5H9DA 2ZEUA 3N3DA 1V4HA 3V1XA 3UCAA 2F9KF 4FP4A 5JV0F 4OMGA
chains in the Genus database with same CATH superfamily
3NPKA 3OACB 5E8LA 4LZ3A 3TC1A 2E8TA 1WMWA 5DJRF 3WCLA 5IKAA 3WSBA 4P0WA 3KRPB 4DHDA 1UBWA 4KFAA 4HD1A 3WCBA 3KB9A 3LZ9A 3S4JA 4DWGA 3PDEA 1JFAA 1WKZA 3WCIA 2Z7IA 2Q80A 5IK9A 3DYGA 5IL8A 3WCJA 3OYRA 3WEIA 3LG5A 4K10A 3ICMA 5HN8A 5JV2F 3Q30A 5JUZF 2E94A 4OKZA 5DZ2A 3M9UA 4DZWA 3ACYA 4KQUA 5EAUA 3ZL6A 3P5PA 5ILYA 1N22A 3TFNA 3SDTA 1YV5A 1V4KA 5DHKA 3N0GA 2OPMA 3QKCA 1VG6A 2E8UA 4FJQA 3WSAA 3WCMA 4OKMA 5EATA 3KRFB 3KROA 4EA0A 2H8OA 4MC0A 3LSNA 4E9ZA 3TFPA 1HX9A 3WEGA 2EWGA 3TS7A 4RXAA 4LZ0A 5E8HA 3M02A 4L2XF 3KRAB 3SDVA 4GP2A 3LEEA 3M0GA 3APZA 5EASA 3IPIA 3Q2QA 2E8WA 2ZY1A 2FORA 4JVJF 4JZXA 3WC9A 2DH4A 2Z78A 3G4DA 4P0XA 1RTRA 3ID0A 3OABB 2Z4VA 2F8CF 3VJ8A 5HNAA 1DGPA 2OPNA 4F62A 3RMGA 2AZKA 5DJVF 3BNXA 3AQ0A 1WY0A 1V4IA 4LLTA 1VG2A 4RXCA 3ICZA 4QPFA 3M00A 5B00A 4P0VA 5B0LA 5HN7A 3P8LA 3NF2A 4LA5A 2E90A 1UBXA 4JXNA 3V66A 2QISA 1PS1A 1YYTA 5IKHA 1HXGA 3N1VF 5DW7A 3QQVA 5DIQF 4EA1A 5B0JA 5IK0A 2Q9ZA 4KPDA 3M01A 3VJCA 2OGDA 4KVYA 3RYEA 5IMNA 3ZCDA 1YYSA 2ONHA 4GA3A 5AHUB 3AE0A 3PKOA 5JV1F 5JA0F 4LOBA 4KVDA 5A0KA 4OGUA 4F6XA 2ONGA 2ZEVA 4NFJF 3WJOA 3N46F 2E8XA 3LMDA 5ILKA 5E8KA 1V4EA 1WL2A 1HM4A 1HXAA 2F92F 3KRPA 3ZMBA 5DGNF 3WEKA 3N3LF 4DI5A 4KUXA 3V1VA 1WL3A 4GP1A 2PS4A 2Z4XA 2E91A 3CC9A 4LPHF 4JXYA 3PYBA 3CKEA 3IBAA 3B7LA 1ZW5A 1YYQA 4NFIF 4KKMA 1DI1A 4LIXA 3SAEA 3P41A 5IMPA 3DYFA 5IK6A 4UMJA 4KK2A 4EA2A 5EROA 4XQTF 4N9UA 4OMHA 2Q9YA 3MZVA 3LJIA 3WEJA 5ERNA 4H5EF 2F7MF 5I1UA 1N1BA 5C05A 4LLSA 5AELA 3AQCB 1V4JA 3NRIA 2AZLA 4KQSA 3G4FA 3N49F 2E92A 4LXWA 2ZCRA 4LTVA 2PS6A 5CG6A 1KIYA 3ACXA 3KRCB 3KRFA 5ER8A 5ILIA 1JFGA 5DJPF 2F8ZF 3WCFA 5DHIA 4LA6A 4LFEA 5ILHA 4ZQ8A 1N23A 4MC8A 4RXDA 5IN8A 4NFKF 5ILJA 5HN9A 4F6VA 3S9VA 3N5JF 3Q2ZA 5IMIA 4KVIA 2PS8A 4PVYF 2AELA 5A0IA 3WCDA 1YQ7A 3WCGA 2E95A 3N1WF 3N5HF 3OABA 3WEFA 1HXCA 1EZFA 2AZJA 3SDRA 4KWDA 3SDUA 4E9UA 4KVWA 2ZCSA 3ICNA 4LUUA 5B0KA 2F94F 4E1EA 3RYWA 1YHKA 3BNYA 1KIZA 3CP6A 3EFQA 1N20A 1UBVA 3WEHA 3VJBA 3ASXA 3AQBB 3KBKA 3OACA 3WJKA 3LVSA 1WL1A 3LOMA 3N45F 5IL3A 4GAXA 1YJ4A 4LZCA 4XQRF 1N21A 3ACWA 4N1ZF 1VG3A 3WE9A 3EGTA 4LFGA 3VJ9A 2E8VA 4MC3A 2VF6A 2E93A 1VG4A 3ICKA 3TFVA 1HM7A 3MAVA 4DXJA 4RXEA 2Z4ZA 3LGZB 5KSXF 5DGSF 4H5CF 2Q58A 1WL0A 3KROB 4LFVF 2FTZA 3LK5A 1RQIA 5B0IA 3ZMCA 4DEMF 4DWBA 2ZCQA 4NUAA 3WCEA 3PYAA 5CG5A 3ZOUA 3LDWA 2J5CA 5B02A 2P1CA 1N24A 4KQ5A 4JYXA 2E4OA 5AFXA 3N6KF 4LTZA 3LGKA 2Z4YA 4H5DF 1FPSA 2OA6A 3N0FA 3WCAA 3W7FA 2ZCOA 5ILDA 4WK5A 4KPJA 1YYRA 1YHMA 2PS5A 3EZ3A 2J1PA 2O1OA 5A0JA 3WCHA 5DGMF 5IM1A 4JZBA 3DYHA 4RYPA 3Q1OA 2Z4WA 4PVXF 4Q23A 5B01A 1UBYA 2AEKA 2F89F 5IVGA 2Z52A 3VJEA 3KRAA 2Z7HA 1YHLA 5ERMA 4QXSF 3NPRA 4LPGF 2I19A 4RNQA 2Z50A 4NG6A 2PS7A 3WJNA 1VG7A 4XQSF 1N1ZA 1RQJA 3PH7A 3P5RA 4NKEA 3KRCA 3LLWA 2AETA 5ILZA 2RAHA 3RBMA 4NKFA 3SDQA 5B0MA 3WCCA 3VJDA 3VJAA 5AYPA 3P8RA 2J1OA 3ADZA 1YYUA 5B03A 5H9DA 2ZEUA 3N3DA 1V4HA 3V1XA 3UCAA 2F9KF 4FP4A 5JV0F 4OMGA
chains in the Genus database with same CATH topology
3NPKA 3OACB 5E8LA 4LZ3A 3TC1A 2E8TA 1WMWA 5DJRF 3WCLA 5IKAA 3WSBA 4P0WA 3KRPB 4DHDA 1UBWA 4KFAA 4HD1A 3WCBA 3KB9A 3LZ9A 3S4JA 4DWGA 3PDEA 1JFAA 1WKZA 3WCIA 2Z7IA 2Q80A 5IK9A 3DYGA 5IL8A 3WCJA 3OYRA 3WEIA 3LG5A 4K10A 3ICMA 5HN8A 5JV2F 3Q30A 5JUZF 2E94A 4OKZA 5DZ2A 3M9UA 4DZWA 3ACYA 4KQUA 5EAUA 3ZL6A 3P5PA 5ILYA 1N22A 3TFNA 3SDTA 1YV5A 1V4KA 5DHKA 3N0GA 2OPMA 3QKCA 1VG6A 2E8UA 4FJQA 3WSAA 3WCMA 4OKMA 5EATA 3KRFB 3KROA 4EA0A 2H8OA 4MC0A 3LSNA 4E9ZA 3TFPA 1HX9A 3WEGA 2EWGA 3TS7A 4RXAA 4LZ0A 5E8HA 3M02A 4L2XF 3KRAB 3SDVA 4GP2A 3LEEA 3M0GA 3APZA 5EASA 3IPIA 3Q2QA 2E8WA 2ZY1A 2FORA 4JVJF 4JZXA 3WC9A 2DH4A 2Z78A 3G4DA 4P0XA 1RTRA 3ID0A 3OABB 2Z4VA 2F8CF 3VJ8A 5HNAA 1DGPA 2OPNA 4F62A 3RMGA 2AZKA 5DJVF 3BNXA 3AQ0A 1WY0A 1V4IA 4LLTA 1VG2A 4RXCA 3ICZA 4QPFA 3M00A 5B00A 4P0VA 5B0LA 5HN7A 3P8LA 3NF2A 4LA5A 2E90A 1UBXA 4JXNA 3V66A 2QISA 1PS1A 1YYTA 5IKHA 1HXGA 3N1VF 5DW7A 3QQVA 5DIQF 4EA1A 5B0JA 5IK0A 2Q9ZA 4KPDA 3M01A 3VJCA 2OGDA 4KVYA 3RYEA 5IMNA 3ZCDA 1YYSA 2ONHA 4GA3A 5AHUB 3AE0A 3PKOA 5JV1F 5JA0F 4LOBA 4KVDA 5A0KA 4OGUA 4F6XA 2ONGA 2ZEVA 4NFJF 3WJOA 3N46F 2E8XA 3LMDA 5ILKA 5E8KA 1V4EA 1WL2A 1HM4A 1HXAA 2F92F 3KRPA 3ZMBA 5DGNF 3WEKA 3N3LF 4DI5A 4KUXA 3V1VA 1WL3A 4GP1A 2PS4A 2Z4XA 2E91A 3CC9A 4LPHF 4JXYA 3PYBA 3CKEA 3IBAA 3B7LA 1ZW5A 1YYQA 4NFIF 4KKMA 1DI1A 4LIXA 3SAEA 3P41A 5IMPA 3DYFA 5IK6A 4UMJA 4KK2A 4EA2A 5EROA 4XQTF 4N9UA 4OMHA 2Q9YA 3MZVA 3LJIA 3WEJA 5ERNA 4H5EF 2F7MF 5I1UA 1N1BA 5C05A 4LLSA 5AELA 3AQCB 1V4JA 3NRIA 2AZLA 4KQSA 3G4FA 3N49F 2E92A 4LXWA 2ZCRA 4LTVA 2PS6A 5CG6A 1KIYA 3ACXA 3KRCB 3KRFA 5ER8A 5ILIA 1JFGA 5DJPF 2F8ZF 3WCFA 5DHIA 4LA6A 4LFEA 5ILHA 4ZQ8A 1N23A 4MC8A 4RXDA 5IN8A 4NFKF 5ILJA 5HN9A 4F6VA 3S9VA 3N5JF 3Q2ZA 5IMIA 4KVIA 2PS8A 4PVYF 2AELA 5A0IA 3WCDA 1YQ7A 3WCGA 2E95A 3N1WF 3N5HF 3OABA 3WEFA 1HXCA 1EZFA 2AZJA 3SDRA 4KWDA 3SDUA 4E9UA 4KVWA 2ZCSA 3ICNA 4LUUA 5B0KA 2F94F 4E1EA 3RYWA 1YHKA 3BNYA 1KIZA 3CP6A 3EFQA 1N20A 1UBVA 3WEHA 3VJBA 3ASXA 3AQBB 3KBKA 3OACA 3WJKA 3LVSA 1WL1A 3LOMA 3N45F 5IL3A 4GAXA 1YJ4A 4LZCA 4XQRF 1N21A 3ACWA 4N1ZF 1VG3A 3WE9A 3EGTA 4LFGA 3VJ9A 2E8VA 4MC3A 2VF6A 2E93A 1VG4A 3ICKA 3TFVA 1HM7A 3MAVA 4DXJA 4RXEA 2Z4ZA 3LGZB 5KSXF 5DGSF 4H5CF 2Q58A 1WL0A 3KROB 4LFVF 2FTZA 3LK5A 1RQIA 5B0IA 3ZMCA 4DEMF 4DWBA 2ZCQA 4NUAA 3WCEA 3PYAA 5CG5A 3ZOUA 3LDWA 2J5CA 5B02A 2P1CA 1N24A 4KQ5A 4JYXA 2E4OA 5AFXA 3N6KF 4LTZA 3LGKA 2Z4YA 4H5DF 1FPSA 2OA6A 3N0FA 3WCAA 3W7FA 2ZCOA 5ILDA 4WK5A 4KPJA 1YYRA 1YHMA 2PS5A 3EZ3A 2J1PA 2O1OA 5A0JA 3WCHA 5DGMF 5IM1A 4JZBA 3DYHA 4RYPA 3Q1OA 2Z4WA 4PVXF 4Q23A 5B01A 1UBYA 2AEKA 2F89F 5IVGA 2Z52A 3VJEA 3KRAA 2Z7HA 1YHLA 5ERMA 4QXSF 3NPRA 4LPGF 2I19A 4RNQA 2Z50A 4NG6A 2PS7A 3WJNA 1VG7A 4XQSF 1N1ZA 1RQJA 3PH7A 3P5RA 4NKEA 3KRCA 3LLWA 2AETA 5ILZA 2RAHA 3RBMA 4NKFA 3SDQA 5B0MA 3WCCA 3VJDA 3VJAA 5AYPA 3P8RA 2J1OA 3ADZA 1YYUA 5B03A 5H9DA 2ZEUA 3N3DA 1V4HA 3V1XA 3UCAA 2F9KF 4FP4A 5JV0F 4OMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NPK A;  3OAC B;  5E8L A;  4LZ3 A;  3TC1 A;  2E8T A;  1WMW A;  5DJR F;  3WCL A;  5IKA A;  3WSB A;  4P0W A;  3KRP B;  4DHD A;  1UBW A;  4KFA A;  4HD1 A;  3WCB A;  3KB9 A;  3LZ9 A;  3S4J A;  4DWG A;  3PDE A;  1JFA A;  1WKZ A;  3WCI A;  2Z7I A;  2Q80 A;  5IK9 A;  3DYG A;  5IL8 A;  3WCJ A;  3OYR A;  3WEI A;  3LG5 A;  4K10 A;  3ICM A;  5HN8 A;  5JV2 F;  3Q30 A;  5JUZ F;  2E94 A;  4OKZ A;  5DZ2 A;  3M9U A;  4DZW A;  3ACY A;  4KQU A;  5EAU A;  3ZL6 A;  3P5P A;  5ILY A;  1N22 A;  3TFN A;  3SDT A;  1YV5 A;  1V4K A;  5DHK A;  3N0G A;  2OPM A;  3QKC A;  1VG6 A;  2E8U A;  4FJQ A;  3WSA A;  3WCM A;  4OKM A;  5EAT A;  3KRF B;  3KRO A;  4EA0 A;  2H8O A;  4MC0 A;  3LSN A;  4E9Z A;  3TFP A;  1HX9 A;  3WEG A;  2EWG A;  3TS7 A;  4RXA A;  4LZ0 A;  5E8H A;  3M02 A;  4L2X F;  3KRA B;  3SDV A;  4GP2 A;  3LEE A;  3M0G A;  3APZ A;  5EAS A;  3IPI A;  3Q2Q A;  2E8W A;  2ZY1 A;  2FOR A;  4JVJ F;  4JZX A;  3WC9 A;  2DH4 A;  2Z78 A;  3G4D A;  4P0X A;  1RTR A;  3ID0 A;  3OAB B;  2Z4V A;  2F8C F;  3VJ8 A;  5HNA A;  1DGP A;  2OPN A;  4F62 A;  3RMG A;  2AZK A;  5DJV F;  3BNX A;  3AQ0 A;  1WY0 A;  1V4I A;  4LLT A;  1VG2 A;  4RXC A;  3ICZ A;  4QPF A;  3M00 A;  5B00 A;  4P0V A;  5B0L A;  5HN7 A;  3P8L A;  3NF2 A;  4LA5 A;  2E90 A;  1UBX A;  4JXN A;  3V66 A;  2QIS A;  1PS1 A;  1YYT A;  5IKH A;  1HXG A;  3N1V F;  5DW7 A;  3QQV A;  5DIQ F;  4EA1 A;  5B0J A;  5IK0 A;  2Q9Z A;  4KPD A;  3M01 A;  3VJC A;  2OGD A;  4KVY A;  3RYE A;  5IMN A;  3ZCD A;  1YYS A;  2ONH A;  4GA3 A;  5AHU B;  3AE0 A;  3PKO A;  5JV1 F;  5JA0 F;  4LOB A;  4KVD A;  5A0K A;  4OGU A;  4F6X A;  2ONG A;  2ZEV A;  4NFJ F;  3WJO A;  3N46 F;  2E8X A;  3LMD A;  5ILK A;  5E8K A;  1V4E A;  1WL2 A;  1HM4 A;  1HXA A;  2F92 F;  3KRP A;  3ZMB A;  5DGN F;  3WEK A;  3N3L F;  4DI5 A;  4KUX A;  3V1V A;  1WL3 A;  4GP1 A;  2PS4 A;  2Z4X A;  2E91 A;  3CC9 A;  4LPH F;  4JXY A;  3PYB A;  3CKE A;  3IBA A;  3B7L A;  1ZW5 A;  1YYQ A;  4NFI F;  4KKM A;  1DI1 A;  4LIX A;  3SAE A;  3P41 A;  5IMP A;  3DYF A;  5IK6 A;  4UMJ A;  4KK2 A;  4EA2 A;  5ERO A;  4XQT F;  4N9U A;  4OMH A;  2Q9Y A;  3MZV A;  3LJI A;  3WEJ A;  5ERN A;  4H5E F;  2F7M F;  5I1U A;  1N1B A;  5C05 A;  4LLS A;  5AEL A;  3AQC B;  1V4J A;  3NRI A;  2AZL A;  4KQS A;  3G4F A;  3N49 F;  2E92 A;  4LXW A;  2ZCR A;  4LTV A;  2PS6 A;  5CG6 A;  1KIY A;  3ACX A;  3KRC B;  3KRF A;  5ER8 A;  5ILI A;  1JFG A;  5DJP F;  2F8Z F;  3WCF A;  5DHI A;  4LA6 A;  4LFE A;  5ILH A;  4ZQ8 A;  1N23 A;  4MC8 A;  4RXD A;  5IN8 A;  4NFK F;  5ILJ A;  5HN9 A;  4F6V A;  3S9V A;  3N5J F;  3Q2Z A;  5IMI A;  4KVI A;  2PS8 A;  4PVY F;  2AEL A;  5A0I A;  3WCD A;  1YQ7 A;  3WCG A;  2E95 A;  3N1W F;  3N5H F;  3OAB A;  3WEF A;  1HXC A;  1EZF A;  2AZJ A;  3SDR A;  4KWD A;  3SDU A;  4E9U A;  4KVW A;  2ZCS A;  3ICN A;  4LUU A;  5B0K A;  2F94 F;  4E1E A;  3RYW A;  1YHK A;  3BNY A;  1KIZ A;  3CP6 A;  3EFQ A;  1N20 A;  1UBV A;  3WEH A;  3VJB A;  3ASX A;  3AQB B;  3KBK A;  3OAC A;  3WJK A;  3LVS A;  1WL1 A;  3LOM A;  3N45 F;  5IL3 A;  4GAX A;  1YJ4 A;  4LZC A;  4XQR F;  1N21 A;  3ACW A;  4N1Z F;  1VG3 A;  3WE9 A;  3EGT A;  4LFG A;  3VJ9 A;  2E8V A;  4MC3 A;  2VF6 A;  2E93 A;  1VG4 A;  3ICK A;  3TFV A;  1HM7 A;  3MAV A;  4DXJ A;  4RXE A;  2Z4Z A;  3LGZ B;  5KSX F;  5DGS F;  4H5C F;  2Q58 A;  1WL0 A;  3KRO B;  4LFV F;  2FTZ A;  3LK5 A;  1RQI A;  5B0I A;  3ZMC A;  4DEM F;  4DWB A;  2ZCQ A;  4NUA A;  3WCE A;  3PYA A;  5CG5 A;  3ZOU A;  3LDW A;  2J5C A;  5B02 A;  2P1C A;  1N24 A;  4KQ5 A;  4JYX A;  2E4O A;  5AFX A;  3N6K F;  4LTZ A;  3LGK A;  2Z4Y A;  4H5D F;  1FPS A;  2OA6 A;  3N0F A;  3WCA A;  3W7F A;  2ZCO A;  5ILD A;  4WK5 A;  4KPJ A;  1YYR A;  1YHM A;  2PS5 A;  3EZ3 A;  2J1P A;  2O1O A;  5A0J A;  3WCH A;  5DGM F;  5IM1 A;  4JZB A;  3DYH A;  4RYP A;  3Q1O A;  2Z4W A;  4PVX F;  4Q23 A;  5B01 A;  1UBY A;  2AEK A;  2F89 F;  5IVG A;  2Z52 A;  3VJE A;  3KRA A;  2Z7H A;  1YHL A;  5ERM A;  4QXS F;  3NPR A;  4LPG F;  2I19 A;  4RNQ A;  2Z50 A;  4NG6 A;  2PS7 A;  3WJN A;  1VG7 A;  4XQS F;  1N1Z A;  1RQJ A;  3PH7 A;  3P5R A;  4NKE A;  3KRC A;  3LLW A;  2AET A;  5ILZ A;  2RAH A;  3RBM A;  4NKF A;  3SDQ A;  5B0M A;  3WCC A;  3VJD A;  3VJA A;  5AYP A;  3P8R A;  2J1O A;  3ADZ A;  1YYU A;  5B03 A;  5H9D A;  2ZEU A;  3N3D A;  1V4H A;  3V1X A;  3UCA A;  2F9K F;  4FP4 A;  5JV0 F;  4OMG A; 
#chains in the Genus database with same CATH topology
 3NPK A;  3OAC B;  5E8L A;  4LZ3 A;  3TC1 A;  2E8T A;  1WMW A;  5DJR F;  3WCL A;  5IKA A;  3WSB A;  4P0W A;  3KRP B;  4DHD A;  1UBW A;  4KFA A;  4HD1 A;  3WCB A;  3KB9 A;  3LZ9 A;  3S4J A;  4DWG A;  3PDE A;  1JFA A;  1WKZ A;  3WCI A;  2Z7I A;  2Q80 A;  5IK9 A;  3DYG A;  5IL8 A;  3WCJ A;  3OYR A;  3WEI A;  3LG5 A;  4K10 A;  3ICM A;  5HN8 A;  5JV2 F;  3Q30 A;  5JUZ F;  2E94 A;  4OKZ A;  5DZ2 A;  3M9U A;  4DZW A;  3ACY A;  4KQU A;  5EAU A;  3ZL6 A;  3P5P A;  5ILY A;  1N22 A;  3TFN A;  3SDT A;  1YV5 A;  1V4K A;  5DHK A;  3N0G A;  2OPM A;  3QKC A;  1VG6 A;  2E8U A;  4FJQ A;  3WSA A;  3WCM A;  4OKM A;  5EAT A;  3KRF B;  3KRO A;  4EA0 A;  2H8O A;  4MC0 A;  3LSN A;  4E9Z A;  3TFP A;  1HX9 A;  3WEG A;  2EWG A;  3TS7 A;  4RXA A;  4LZ0 A;  5E8H A;  3M02 A;  4L2X F;  3KRA B;  3SDV A;  4GP2 A;  3LEE A;  3M0G A;  3APZ A;  5EAS A;  3IPI A;  3Q2Q A;  2E8W A;  2ZY1 A;  2FOR A;  4JVJ F;  4JZX A;  3WC9 A;  2DH4 A;  2Z78 A;  3G4D A;  4P0X A;  1RTR A;  3ID0 A;  3OAB B;  2Z4V A;  2F8C F;  3VJ8 A;  5HNA A;  1DGP A;  2OPN A;  4F62 A;  3RMG A;  2AZK A;  5DJV F;  3BNX A;  3AQ0 A;  1WY0 A;  1V4I A;  4LLT A;  1VG2 A;  4RXC A;  3ICZ A;  4QPF A;  3M00 A;  5B00 A;  4P0V A;  5B0L A;  5HN7 A;  3P8L A;  3NF2 A;  4LA5 A;  2E90 A;  1UBX A;  4JXN A;  3V66 A;  2QIS A;  1PS1 A;  1YYT A;  5IKH A;  1HXG A;  3N1V F;  5DW7 A;  3QQV A;  5DIQ F;  4EA1 A;  5B0J A;  5IK0 A;  2Q9Z A;  4KPD A;  3M01 A;  3VJC A;  2OGD A;  4KVY A;  3RYE A;  5IMN A;  3ZCD A;  1YYS A;  2ONH A;  4GA3 A;  5AHU B;  3AE0 A;  3PKO A;  5JV1 F;  5JA0 F;  4LOB A;  4KVD A;  5A0K A;  4OGU A;  4F6X A;  2ONG A;  2ZEV A;  4NFJ F;  3WJO A;  3N46 F;  2E8X A;  3LMD A;  5ILK A;  5E8K A;  1V4E A;  1WL2 A;  1HM4 A;  1HXA A;  2F92 F;  3KRP A;  3ZMB A;  5DGN F;  3WEK A;  3N3L F;  4DI5 A;  4KUX A;  3V1V A;  1WL3 A;  4GP1 A;  2PS4 A;  2Z4X A;  2E91 A;  3CC9 A;  4LPH F;  4JXY A;  3PYB A;  3CKE A;  3IBA A;  3B7L A;  1ZW5 A;  1YYQ A;  4NFI F;  4KKM A;  1DI1 A;  4LIX A;  3SAE A;  3P41 A;  5IMP A;  3DYF A;  5IK6 A;  4UMJ A;  4KK2 A;  4EA2 A;  5ERO A;  4XQT F;  4N9U A;  4OMH A;  2Q9Y A;  3MZV A;  3LJI A;  3WEJ A;  5ERN A;  4H5E F;  2F7M F;  5I1U A;  1N1B A;  5C05 A;  4LLS A;  5AEL A;  3AQC B;  1V4J A;  3NRI A;  2AZL A;  4KQS A;  3G4F A;  3N49 F;  2E92 A;  4LXW A;  2ZCR A;  4LTV A;  2PS6 A;  5CG6 A;  1KIY A;  3ACX A;  3KRC B;  3KRF A;  5ER8 A;  5ILI A;  1JFG A;  5DJP F;  2F8Z F;  3WCF A;  5DHI A;  4LA6 A;  4LFE A;  5ILH A;  4ZQ8 A;  1N23 A;  4MC8 A;  4RXD A;  5IN8 A;  4NFK F;  5ILJ A;  5HN9 A;  4F6V A;  3S9V A;  3N5J F;  3Q2Z A;  5IMI A;  4KVI A;  2PS8 A;  4PVY F;  2AEL A;  5A0I A;  3WCD A;  1YQ7 A;  3WCG A;  2E95 A;  3N1W F;  3N5H F;  3OAB A;  3WEF A;  1HXC A;  1EZF A;  2AZJ A;  3SDR A;  4KWD A;  3SDU A;  4E9U A;  4KVW A;  2ZCS A;  3ICN A;  4LUU A;  5B0K A;  2F94 F;  4E1E A;  3RYW A;  1YHK A;  3BNY A;  1KIZ A;  3CP6 A;  3EFQ A;  1N20 A;  1UBV A;  3WEH A;  3VJB A;  3ASX A;  3AQB B;  3KBK A;  3OAC A;  3WJK A;  3LVS A;  1WL1 A;  3LOM A;  3N45 F;  5IL3 A;  4GAX A;  1YJ4 A;  4LZC A;  4XQR F;  1N21 A;  3ACW A;  4N1Z F;  1VG3 A;  3WE9 A;  3EGT A;  4LFG A;  3VJ9 A;  2E8V A;  4MC3 A;  2VF6 A;  2E93 A;  1VG4 A;  3ICK A;  3TFV A;  1HM7 A;  3MAV A;  4DXJ A;  4RXE A;  2Z4Z A;  3LGZ B;  5KSX F;  5DGS F;  4H5C F;  2Q58 A;  1WL0 A;  3KRO B;  4LFV F;  2FTZ A;  3LK5 A;  1RQI A;  5B0I A;  3ZMC A;  4DEM F;  4DWB A;  2ZCQ A;  4NUA A;  3WCE A;  3PYA A;  5CG5 A;  3ZOU A;  3LDW A;  2J5C A;  5B02 A;  2P1C A;  1N24 A;  4KQ5 A;  4JYX A;  2E4O A;  5AFX A;  3N6K F;  4LTZ A;  3LGK A;  2Z4Y A;  4H5D F;  1FPS A;  2OA6 A;  3N0F A;  3WCA A;  3W7F A;  2ZCO A;  5ILD A;  4WK5 A;  4KPJ A;  1YYR A;  1YHM A;  2PS5 A;  3EZ3 A;  2J1P A;  2O1O A;  5A0J A;  3WCH A;  5DGM F;  5IM1 A;  4JZB A;  3DYH A;  4RYP A;  3Q1O A;  2Z4W A;  4PVX F;  4Q23 A;  5B01 A;  1UBY A;  2AEK A;  2F89 F;  5IVG A;  2Z52 A;  3VJE A;  3KRA A;  2Z7H A;  1YHL A;  5ERM A;  4QXS F;  3NPR A;  4LPG F;  2I19 A;  4RNQ A;  2Z50 A;  4NG6 A;  2PS7 A;  3WJN A;  1VG7 A;  4XQS F;  1N1Z A;  1RQJ A;  3PH7 A;  3P5R A;  4NKE A;  3KRC A;  3LLW A;  2AET A;  5ILZ A;  2RAH A;  3RBM A;  4NKF A;  3SDQ A;  5B0M A;  3WCC A;  3VJD A;  3VJA A;  5AYP A;  3P8R A;  2J1O A;  3ADZ A;  1YYU A;  5B03 A;  5H9D A;  2ZEU A;  3N3D A;  1V4H A;  3V1X A;  3UCA A;  2F9K F;  4FP4 A;  5JV0 F;  4OMG A; 
#chains in the Genus database with same CATH homology
 3NPK A;  3OAC B;  5E8L A;  4LZ3 A;  3TC1 A;  2E8T A;  1WMW A;  5DJR F;  3WCL A;  5IKA A;  3WSB A;  4P0W A;  3KRP B;  4DHD A;  1UBW A;  4KFA A;  4HD1 A;  3WCB A;  3KB9 A;  3LZ9 A;  3S4J A;  4DWG A;  3PDE A;  1JFA A;  1WKZ A;  3WCI A;  2Z7I A;  2Q80 A;  5IK9 A;  3DYG A;  5IL8 A;  3WCJ A;  3OYR A;  3WEI A;  3LG5 A;  4K10 A;  3ICM A;  5HN8 A;  5JV2 F;  3Q30 A;  5JUZ F;  2E94 A;  4OKZ A;  5DZ2 A;  3M9U A;  4DZW A;  3ACY A;  4KQU A;  5EAU A;  3ZL6 A;  3P5P A;  5ILY A;  1N22 A;  3TFN A;  3SDT A;  1YV5 A;  1V4K A;  5DHK A;  3N0G A;  2OPM A;  3QKC A;  1VG6 A;  2E8U A;  4FJQ A;  3WSA A;  3WCM A;  4OKM A;  5EAT A;  3KRF B;  3KRO A;  4EA0 A;  2H8O A;  4MC0 A;  3LSN A;  4E9Z A;  3TFP A;  1HX9 A;  3WEG A;  2EWG A;  3TS7 A;  4RXA A;  4LZ0 A;  5E8H A;  3M02 A;  4L2X F;  3KRA B;  3SDV A;  4GP2 A;  3LEE A;  3M0G A;  3APZ A;  5EAS A;  3IPI A;  3Q2Q A;  2E8W A;  2ZY1 A;  2FOR A;  4JVJ F;  4JZX A;  3WC9 A;  2DH4 A;  2Z78 A;  3G4D A;  4P0X A;  1RTR A;  3ID0 A;  3OAB B;  2Z4V A;  2F8C F;  3VJ8 A;  5HNA A;  1DGP A;  2OPN A;  4F62 A;  3RMG A;  2AZK A;  5DJV F;  3BNX A;  3AQ0 A;  1WY0 A;  1V4I A;  4LLT A;  1VG2 A;  4RXC A;  3ICZ A;  4QPF A;  3M00 A;  5B00 A;  4P0V A;  5B0L A;  5HN7 A;  3P8L A;  3NF2 A;  4LA5 A;  2E90 A;  1UBX A;  4JXN A;  3V66 A;  2QIS A;  1PS1 A;  1YYT A;  5IKH A;  1HXG A;  3N1V F;  5DW7 A;  3QQV A;  5DIQ F;  4EA1 A;  5B0J A;  5IK0 A;  2Q9Z A;  4KPD A;  3M01 A;  3VJC A;  2OGD A;  4KVY A;  3RYE A;  5IMN A;  3ZCD A;  1YYS A;  2ONH A;  4GA3 A;  5AHU B;  3AE0 A;  3PKO A;  5JV1 F;  5JA0 F;  4LOB A;  4KVD A;  5A0K A;  4OGU A;  4F6X A;  2ONG A;  2ZEV A;  4NFJ F;  3WJO A;  3N46 F;  2E8X A;  3LMD A;  5ILK A;  5E8K A;  1V4E A;  1WL2 A;  1HM4 A;  1HXA A;  2F92 F;  3KRP A;  3ZMB A;  5DGN F;  3WEK A;  3N3L F;  4DI5 A;  4KUX A;  3V1V A;  1WL3 A;  4GP1 A;  2PS4 A;  2Z4X A;  2E91 A;  3CC9 A;  4LPH F;  4JXY A;  3PYB A;  3CKE A;  3IBA A;  3B7L A;  1ZW5 A;  1YYQ A;  4NFI F;  4KKM A;  1DI1 A;  4LIX A;  3SAE A;  3P41 A;  5IMP A;  3DYF A;  5IK6 A;  4UMJ A;  4KK2 A;  4EA2 A;  5ERO A;  4XQT F;  4N9U A;  4OMH A;  2Q9Y A;  3MZV A;  3LJI A;  3WEJ A;  5ERN A;  4H5E F;  2F7M F;  5I1U A;  1N1B A;  5C05 A;  4LLS A;  5AEL A;  3AQC B;  1V4J A;  3NRI A;  2AZL A;  4KQS A;  3G4F A;  3N49 F;  2E92 A;  4LXW A;  2ZCR A;  4LTV A;  2PS6 A;  5CG6 A;  1KIY A;  3ACX A;  3KRC B;  3KRF A;  5ER8 A;  5ILI A;  1JFG A;  5DJP F;  2F8Z F;  3WCF A;  5DHI A;  4LA6 A;  4LFE A;  5ILH A;  4ZQ8 A;  1N23 A;  4MC8 A;  4RXD A;  5IN8 A;  4NFK F;  5ILJ A;  5HN9 A;  4F6V A;  3S9V A;  3N5J F;  3Q2Z A;  5IMI A;  4KVI A;  2PS8 A;  4PVY F;  2AEL A;  5A0I A;  3WCD A;  1YQ7 A;  3WCG A;  2E95 A;  3N1W F;  3N5H F;  3OAB A;  3WEF A;  1HXC A;  1EZF A;  2AZJ A;  3SDR A;  4KWD A;  3SDU A;  4E9U A;  4KVW A;  2ZCS A;  3ICN A;  4LUU A;  5B0K A;  2F94 F;  4E1E A;  3RYW A;  1YHK A;  3BNY A;  1KIZ A;  3CP6 A;  3EFQ A;  1N20 A;  1UBV A;  3WEH A;  3VJB A;  3ASX A;  3AQB B;  3KBK A;  3OAC A;  3WJK A;  3LVS A;  1WL1 A;  3LOM A;  3N45 F;  5IL3 A;  4GAX A;  1YJ4 A;  4LZC A;  4XQR F;  1N21 A;  3ACW A;  4N1Z F;  1VG3 A;  3WE9 A;  3EGT A;  4LFG A;  3VJ9 A;  2E8V A;  4MC3 A;  2VF6 A;  2E93 A;  1VG4 A;  3ICK A;  3TFV A;  1HM7 A;  3MAV A;  4DXJ A;  4RXE A;  2Z4Z A;  3LGZ B;  5KSX F;  5DGS F;  4H5C F;  2Q58 A;  1WL0 A;  3KRO B;  4LFV F;  2FTZ A;  3LK5 A;  1RQI A;  5B0I A;  3ZMC A;  4DEM F;  4DWB A;  2ZCQ A;  4NUA A;  3WCE A;  3PYA A;  5CG5 A;  3ZOU A;  3LDW A;  2J5C A;  5B02 A;  2P1C A;  1N24 A;  4KQ5 A;  4JYX A;  2E4O A;  5AFX A;  3N6K F;  4LTZ A;  3LGK A;  2Z4Y A;  4H5D F;  1FPS A;  2OA6 A;  3N0F A;  3WCA A;  3W7F A;  2ZCO A;  5ILD A;  4WK5 A;  4KPJ A;  1YYR A;  1YHM A;  2PS5 A;  3EZ3 A;  2J1P A;  2O1O A;  5A0J A;  3WCH A;  5DGM F;  5IM1 A;  4JZB A;  3DYH A;  4RYP A;  3Q1O A;  2Z4W A;  4PVX F;  4Q23 A;  5B01 A;  1UBY A;  2AEK A;  2F89 F;  5IVG A;  2Z52 A;  3VJE A;  3KRA A;  2Z7H A;  1YHL A;  5ERM A;  4QXS F;  3NPR A;  4LPG F;  2I19 A;  4RNQ A;  2Z50 A;  4NG6 A;  2PS7 A;  3WJN A;  1VG7 A;  4XQS F;  1N1Z A;  1RQJ A;  3PH7 A;  3P5R A;  4NKE A;  3KRC A;  3LLW A;  2AET A;  5ILZ A;  2RAH A;  3RBM A;  4NKF A;  3SDQ A;  5B0M A;  3WCC A;  3VJD A;  3VJA A;  5AYP A;  3P8R A;  2J1O A;  3ADZ A;  1YYU A;  5B03 A;  5H9D A;  2ZEU A;  3N3D A;  1V4H A;  3V1X A;  3UCA A;  2F9K F;  4FP4 A;  5JV0 F;  4OMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...