3RBMA

Crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase complexed with bph -703
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
360
structure length
355
Chain Sequence
LAFFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVKNRINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSEIDVNNINVPEQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIAVDNLIYKKIEDISMLMGEYFQIHDDYLDIFGDSTKTGKVGSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl pyrophosphate synthase
publication title Lipophilic analogs of zoledronate and risedronate inhibit Plasmodium geranylgeranyl diphosphate synthase (GGPPS) and exhibit potent antimalarial activity.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase/transferase inhibitor
total genus 147
structure length 355
sequence length 360
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3rbmA00
3TFNA 5B03A 5IK6A 3WEIA 4FP4A 4LZ0A 4JZBA 1VG2A 3ZOUA 5ER8A 4WK5A 3KRPB 4DEMF 1YJ4A 3KRFA 1KIZA 2E90A 3KRCA 5JA0F 3AQ0A 4L2XF 3WCAA 5HN8A 3S9VA 3B7LA 3ADZA 2Q58A 5CG5A 3ACYA 2E92A 4KQSA 3SDVA 4NFKF 4OMGA 2VF6A 5HNAA 4ZQ8A 3CC9A 4MC0A 4NFJF 3BNYA 3WC9A 3P5RA 5HN7A 2OGDA 3S4JA 4F6VA 2Z4WA 3Q2ZA 5CG6A 1KIYA 5JV2F 3WEJA 5B0MA 1HX9A 3VJCA 3WCLA 2ZCSA 4KK2A 1HXCA 2AZKA 5AHUB 3P8LA 3N5HF 5DJPF 5EATA 2ZCOA 4OKMA 3WCDA 4JVJF 4RXEA 5ILZA 4DWBA 4GAXA 2J5CA 3EGTA 3OYRA 5DGMF 4GP2A 3OACA 3N3DA 3WSAA 3N45F 3N3LF 4PVXF 5B01A 1RQIA 3WEGA 5I1UA 1UBXA 4LTVA 3SAEA 2AETA 4MC3A 1YV5A 3ZMCA 2EWGA 4N9UA 4GA3A 3VJDA 3RYEA 4EA0A 4F6XA 4LLTA 5B0LA 2E8XA 2QISA 3NPKA 4KKMA 2E4OA 4RXDA 3ACWA 5DGSF 3N0FA 2AZJA 3AE0A 3N5JF 3NF2A 3RYWA 4LIXA 1WL1A 4P0VA 5DJRF 5IK0A 4JZXA 3DYFA 3RBMA 4P0WA 3TFVA 2Q9YA 5C05A 1VG4A 5ERMA 4LTZA 4DHDA 1HM7A 5ILHA 5DJVF 3LOMA 3OABB 5ILYA 4LFGA 1WKZA 4LXWA 5JV1F 4PVYF 1YYUA 4LZ3A 3PYAA 4KWDA 1N20A 3KB9A 1DGPA 3CKEA 5IMNA 5A0KA 1FPSA 3TS7A 2F89F 4LA6A 3WEHA 1YYSA 3LLWA 3WCFA 4JYXA 4LPHF 5IM1A 3WJOA 3ID0A 2AELA 3LG5A 3VJBA 3V1XA 1UBVA 2Z7IA 3Q2QA 3NRIA 1N24A 2AEKA 3SDRA 2J1PA 4LA5A 3ICNA 3KBKA 2OPMA 3NPRA 1RQJA 4DXJA 3Q1OA 5HN9A 5JUZF 2H8OA 2ZCQA 3WE9A 3RMGA 3N1VF 2ONGA 1HM4A 2E8TA 2PS7A 4LLSA 4DI5A 3VJ9A 1EZFA 4LUUA 3WCMA 1YYTA 2O1OA 3UCAA 4F62A 2OPNA 4MC8A 2E91A 3WJKA 1YHKA 5B0IA 3WEKA 4XQRF 5A0JA 3WCBA 2ZEVA 4RYPA 4NKEA 3VJ8A 5DHKA 5AYPA 5IKAA 2F9KF 3SDTA 4NUAA 3LK5A 3OABA 3WEFA 4E1EA 3AQBB 3KRAB 4GP1A 3N46F 4K10A 1VG7A 3LSNA 3KRFB 3KRPA 3KRCB 4RXCA 5DHIA 3LEEA 1V4EA 4KPJA 4LFVF 4DZWA 4KVIA 3VJAA 3WCHA 2Z4VA 3AQCB 4FJQA 5H9DA 5DIQF 3M00A 3M9UA 3ZMBA 3WJNA 4OKZA 2Z4YA 4EA1A 1YYQA 3P5PA 5A0IA 4NFIF 1WMWA 4KVWA 3LGZB 1HXAA 4KPDA 4E9UA 3IPIA 5ILJA 4H5CF 2P1CA 3V66A 1DI1A 1WY0A 3CP6A 1JFAA 3ICKA 5IK9A 2Q9ZA 3ICMA 3ICZA 4QPFA 1HXGA 3ZL6A 5IMIA 4QXSF 1PS1A 2F8ZF 2OA6A 3M02A 3N0GA 5IKHA 2PS8A 4UMJA 2F94F 4H5DF 5E8LA 3MZVA 2Z78A 2RAHA 5ILKA 3QQVA 2E8UA 4KFAA 1N23A 1V4KA 2E8VA 3APZA 3N6KF 3TFPA 1UBWA 2ZCRA 4XQTF 3KRAA 3QKCA 4RXAA 4NG6A 2E94A 3BNXA 1N1BA 3LGKA 3KROB 4HD1A 4DWGA 4XQSF 3WCIA 3WCCA 3DYHA 5ILIA 2ZY1A 2E8WA 2Z52A 3M01A 4OGUA 3WCEA 4N1ZF 3G4FA 3P8RA 1YQ7A 2J1OA 3PKOA 4EA2A 5AFXA 3MAVA 4LFEA 1UBYA 3WCJA 3PYBA 5IVGA 5AELA 3V1VA 1N21A 5ERNA 3LMDA 4RNQA 2ZEUA 2AZLA 1ZW5A 1YHMA 3G4DA 1VG3A 5IMPA 2ONHA 5EROA 2PS6A 1N22A 5EAUA 4LPGF 5B0JA 1YYRA 4P0XA 3N49F 1V4IA 1V4JA 3ACXA 4NKFA 4KQUA 2Q80A 5DW7A 1RTRA 3EZ3A 2Z50A 4KVDA 4LZCA 5KSXF 3SDQA 1WL3A 2FTZA 3P41A 3Q30A 2F92F 3IBAA 4KQ5A 5IL8A 3LZ9A 2PS5A 4KUXA 3N1WF 3ZCDA 3PH7A 3TC1A 3M0GA 4Q23A 1WL2A 5EASA 2E95A 3VJEA 3LDWA 3KROA 3LJIA 4JXYA 2I19A 1VG6A 1JFGA 2F8CF 5ILDA 4LOBA 3WSBA 5E8KA 3WCGA 3EFQA 2FORA 5JV0F 1V4HA 2E93A 5B00A 4JXNA 4OMHA 3SDUA 5B0KA 5IN8A 1YHLA 3DYGA 3LVSA 5IL3A 5DZ2A 5DGNF 3PDEA 2Z4ZA 4KVYA 3W7FA 5B02A 1WL0A 2Z4XA 5E8HA 2PS4A 2F7MF 2DH4A 2Z7HA 1N1ZA 3ASXA 4H5EF 4E9ZA 3OACB
chains in the Genus database with same CATH superfamily
3TFNA 5B03A 5IK6A 3WEIA 4FP4A 4LZ0A 4JZBA 1VG2A 3ZOUA 5ER8A 4WK5A 3KRPB 4DEMF 1YJ4A 3KRFA 1KIZA 2E90A 3KRCA 5JA0F 3AQ0A 4L2XF 3WCAA 5HN8A 3S9VA 3B7LA 3ADZA 2Q58A 5CG5A 3ACYA 2E92A 4KQSA 3SDVA 4NFKF 4OMGA 2VF6A 5HNAA 4ZQ8A 3CC9A 4MC0A 4NFJF 3BNYA 3WC9A 3P5RA 5HN7A 2OGDA 3S4JA 4F6VA 2Z4WA 3Q2ZA 5CG6A 1KIYA 5JV2F 3WEJA 5B0MA 1HX9A 3VJCA 3WCLA 2ZCSA 4KK2A 1HXCA 2AZKA 5AHUB 3P8LA 3N5HF 5DJPF 5EATA 2ZCOA 4OKMA 3WCDA 4JVJF 4RXEA 5ILZA 4DWBA 4GAXA 2J5CA 3EGTA 3OYRA 5DGMF 4GP2A 3OACA 3N3DA 3WSAA 3N45F 3N3LF 4PVXF 5B01A 1RQIA 3WEGA 5I1UA 1UBXA 4LTVA 3SAEA 2AETA 4MC3A 1YV5A 3ZMCA 2EWGA 4N9UA 4GA3A 3VJDA 3RYEA 4EA0A 4F6XA 4LLTA 5B0LA 2E8XA 2QISA 3NPKA 4KKMA 2E4OA 4RXDA 3ACWA 5DGSF 3N0FA 2AZJA 3AE0A 3N5JF 3NF2A 3RYWA 4LIXA 1WL1A 4P0VA 5DJRF 5IK0A 4JZXA 3DYFA 3RBMA 4P0WA 3TFVA 2Q9YA 5C05A 1VG4A 5ERMA 4LTZA 4DHDA 1HM7A 5ILHA 5DJVF 3LOMA 3OABB 5ILYA 4LFGA 1WKZA 4LXWA 5JV1F 4PVYF 1YYUA 4LZ3A 3PYAA 4KWDA 1N20A 3KB9A 1DGPA 3CKEA 5IMNA 5A0KA 1FPSA 3TS7A 2F89F 4LA6A 3WEHA 1YYSA 3LLWA 3WCFA 4JYXA 4LPHF 5IM1A 3WJOA 3ID0A 2AELA 3LG5A 3VJBA 3V1XA 1UBVA 2Z7IA 3Q2QA 3NRIA 1N24A 2AEKA 3SDRA 2J1PA 4LA5A 3ICNA 3KBKA 2OPMA 3NPRA 1RQJA 4DXJA 3Q1OA 5HN9A 5JUZF 2H8OA 2ZCQA 3WE9A 3RMGA 3N1VF 2ONGA 1HM4A 2E8TA 2PS7A 4LLSA 4DI5A 3VJ9A 1EZFA 4LUUA 3WCMA 1YYTA 2O1OA 3UCAA 4F62A 2OPNA 4MC8A 2E91A 3WJKA 1YHKA 5B0IA 3WEKA 4XQRF 5A0JA 3WCBA 2ZEVA 4RYPA 4NKEA 3VJ8A 5DHKA 5AYPA 5IKAA 2F9KF 3SDTA 4NUAA 3LK5A 3OABA 3WEFA 4E1EA 3AQBB 3KRAB 4GP1A 3N46F 4K10A 1VG7A 3LSNA 3KRFB 3KRPA 3KRCB 4RXCA 5DHIA 3LEEA 1V4EA 4KPJA 4LFVF 4DZWA 4KVIA 3VJAA 3WCHA 2Z4VA 3AQCB 4FJQA 5H9DA 5DIQF 3M00A 3M9UA 3ZMBA 3WJNA 4OKZA 2Z4YA 4EA1A 1YYQA 3P5PA 5A0IA 4NFIF 1WMWA 4KVWA 3LGZB 1HXAA 4KPDA 4E9UA 3IPIA 5ILJA 4H5CF 2P1CA 3V66A 1DI1A 1WY0A 3CP6A 1JFAA 3ICKA 5IK9A 2Q9ZA 3ICMA 3ICZA 4QPFA 1HXGA 3ZL6A 5IMIA 4QXSF 1PS1A 2F8ZF 2OA6A 3M02A 3N0GA 5IKHA 2PS8A 4UMJA 2F94F 4H5DF 5E8LA 3MZVA 2Z78A 2RAHA 5ILKA 3QQVA 2E8UA 4KFAA 1N23A 1V4KA 2E8VA 3APZA 3N6KF 3TFPA 1UBWA 2ZCRA 4XQTF 3KRAA 3QKCA 4RXAA 4NG6A 2E94A 3BNXA 1N1BA 3LGKA 3KROB 4HD1A 4DWGA 4XQSF 3WCIA 3WCCA 3DYHA 5ILIA 2ZY1A 2E8WA 2Z52A 3M01A 4OGUA 3WCEA 4N1ZF 3G4FA 3P8RA 1YQ7A 2J1OA 3PKOA 4EA2A 5AFXA 3MAVA 4LFEA 1UBYA 3WCJA 3PYBA 5IVGA 5AELA 3V1VA 1N21A 5ERNA 3LMDA 4RNQA 2ZEUA 2AZLA 1ZW5A 1YHMA 3G4DA 1VG3A 5IMPA 2ONHA 5EROA 2PS6A 1N22A 5EAUA 4LPGF 5B0JA 1YYRA 4P0XA 3N49F 1V4IA 1V4JA 3ACXA 4NKFA 4KQUA 2Q80A 5DW7A 1RTRA 3EZ3A 2Z50A 4KVDA 4LZCA 5KSXF 3SDQA 1WL3A 2FTZA 3P41A 3Q30A 2F92F 3IBAA 4KQ5A 5IL8A 3LZ9A 2PS5A 4KUXA 3N1WF 3ZCDA 3PH7A 3TC1A 3M0GA 4Q23A 1WL2A 5EASA 2E95A 3VJEA 3LDWA 3KROA 3LJIA 4JXYA 2I19A 1VG6A 1JFGA 2F8CF 5ILDA 4LOBA 3WSBA 5E8KA 3WCGA 3EFQA 2FORA 5JV0F 1V4HA 2E93A 5B00A 4JXNA 4OMHA 3SDUA 5B0KA 5IN8A 1YHLA 3DYGA 3LVSA 5IL3A 5DZ2A 5DGNF 3PDEA 2Z4ZA 4KVYA 3W7FA 5B02A 1WL0A 2Z4XA 5E8HA 2PS4A 2F7MF 2DH4A 2Z7HA 1N1ZA 3ASXA 4H5EF 4E9ZA 3OACB
chains in the Genus database with same CATH topology
3TFNA 5B03A 5IK6A 3WEIA 4FP4A 4LZ0A 4JZBA 1VG2A 3ZOUA 5ER8A 4WK5A 3KRPB 4DEMF 1YJ4A 3KRFA 1KIZA 2E90A 3KRCA 5JA0F 3AQ0A 4L2XF 3WCAA 5HN8A 3S9VA 3B7LA 3ADZA 2Q58A 5CG5A 3ACYA 2E92A 4KQSA 3SDVA 4NFKF 4OMGA 2VF6A 5HNAA 4ZQ8A 3CC9A 4MC0A 4NFJF 3BNYA 3WC9A 3P5RA 5HN7A 2OGDA 3S4JA 4F6VA 2Z4WA 3Q2ZA 5CG6A 1KIYA 5JV2F 3WEJA 5B0MA 1HX9A 3VJCA 3WCLA 2ZCSA 4KK2A 1HXCA 2AZKA 5AHUB 3P8LA 3N5HF 5DJPF 5EATA 2ZCOA 4OKMA 3WCDA 4JVJF 4RXEA 5ILZA 4DWBA 4GAXA 2J5CA 3EGTA 3OYRA 5DGMF 4GP2A 3OACA 3N3DA 3WSAA 3N45F 3N3LF 4PVXF 5B01A 1RQIA 3WEGA 5I1UA 1UBXA 4LTVA 3SAEA 2AETA 4MC3A 1YV5A 3ZMCA 2EWGA 4N9UA 4GA3A 3VJDA 3RYEA 4EA0A 4F6XA 4LLTA 5B0LA 2E8XA 2QISA 3NPKA 4KKMA 2E4OA 4RXDA 3ACWA 5DGSF 3N0FA 2AZJA 3AE0A 3N5JF 3NF2A 3RYWA 4LIXA 1WL1A 4P0VA 5DJRF 5IK0A 4JZXA 3DYFA 3RBMA 4P0WA 3TFVA 2Q9YA 5C05A 1VG4A 5ERMA 4LTZA 4DHDA 1HM7A 5ILHA 5DJVF 3LOMA 3OABB 5ILYA 4LFGA 1WKZA 4LXWA 5JV1F 4PVYF 1YYUA 4LZ3A 3PYAA 4KWDA 1N20A 3KB9A 1DGPA 3CKEA 5IMNA 5A0KA 1FPSA 3TS7A 2F89F 4LA6A 3WEHA 1YYSA 3LLWA 3WCFA 4JYXA 4LPHF 5IM1A 3WJOA 3ID0A 2AELA 3LG5A 3VJBA 3V1XA 1UBVA 2Z7IA 3Q2QA 3NRIA 1N24A 2AEKA 3SDRA 2J1PA 4LA5A 3ICNA 3KBKA 2OPMA 3NPRA 1RQJA 4DXJA 3Q1OA 5HN9A 5JUZF 2H8OA 2ZCQA 3WE9A 3RMGA 3N1VF 2ONGA 1HM4A 2E8TA 2PS7A 4LLSA 4DI5A 3VJ9A 1EZFA 4LUUA 3WCMA 1YYTA 2O1OA 3UCAA 4F62A 2OPNA 4MC8A 2E91A 3WJKA 1YHKA 5B0IA 3WEKA 4XQRF 5A0JA 3WCBA 2ZEVA 4RYPA 4NKEA 3VJ8A 5DHKA 5AYPA 5IKAA 2F9KF 3SDTA 4NUAA 3LK5A 3OABA 3WEFA 4E1EA 3AQBB 3KRAB 4GP1A 3N46F 4K10A 1VG7A 3LSNA 3KRFB 3KRPA 3KRCB 4RXCA 5DHIA 3LEEA 1V4EA 4KPJA 4LFVF 4DZWA 4KVIA 3VJAA 3WCHA 2Z4VA 3AQCB 4FJQA 5H9DA 5DIQF 3M00A 3M9UA 3ZMBA 3WJNA 4OKZA 2Z4YA 4EA1A 1YYQA 3P5PA 5A0IA 4NFIF 1WMWA 4KVWA 3LGZB 1HXAA 4KPDA 4E9UA 3IPIA 5ILJA 4H5CF 2P1CA 3V66A 1DI1A 1WY0A 3CP6A 1JFAA 3ICKA 5IK9A 2Q9ZA 3ICMA 3ICZA 4QPFA 1HXGA 3ZL6A 5IMIA 4QXSF 1PS1A 2F8ZF 2OA6A 3M02A 3N0GA 5IKHA 2PS8A 4UMJA 2F94F 4H5DF 5E8LA 3MZVA 2Z78A 2RAHA 5ILKA 3QQVA 2E8UA 4KFAA 1N23A 1V4KA 2E8VA 3APZA 3N6KF 3TFPA 1UBWA 2ZCRA 4XQTF 3KRAA 3QKCA 4RXAA 4NG6A 2E94A 3BNXA 1N1BA 3LGKA 3KROB 4HD1A 4DWGA 4XQSF 3WCIA 3WCCA 3DYHA 5ILIA 2ZY1A 2E8WA 2Z52A 3M01A 4OGUA 3WCEA 4N1ZF 3G4FA 3P8RA 1YQ7A 2J1OA 3PKOA 4EA2A 5AFXA 3MAVA 4LFEA 1UBYA 3WCJA 3PYBA 5IVGA 5AELA 3V1VA 1N21A 5ERNA 3LMDA 4RNQA 2ZEUA 2AZLA 1ZW5A 1YHMA 3G4DA 1VG3A 5IMPA 2ONHA 5EROA 2PS6A 1N22A 5EAUA 4LPGF 5B0JA 1YYRA 4P0XA 3N49F 1V4IA 1V4JA 3ACXA 4NKFA 4KQUA 2Q80A 5DW7A 1RTRA 3EZ3A 2Z50A 4KVDA 4LZCA 5KSXF 3SDQA 1WL3A 2FTZA 3P41A 3Q30A 2F92F 3IBAA 4KQ5A 5IL8A 3LZ9A 2PS5A 4KUXA 3N1WF 3ZCDA 3PH7A 3TC1A 3M0GA 4Q23A 1WL2A 5EASA 2E95A 3VJEA 3LDWA 3KROA 3LJIA 4JXYA 2I19A 1VG6A 1JFGA 2F8CF 5ILDA 4LOBA 3WSBA 5E8KA 3WCGA 3EFQA 2FORA 5JV0F 1V4HA 2E93A 5B00A 4JXNA 4OMHA 3SDUA 5B0KA 5IN8A 1YHLA 3DYGA 3LVSA 5IL3A 5DZ2A 5DGNF 3PDEA 2Z4ZA 4KVYA 3W7FA 5B02A 1WL0A 2Z4XA 5E8HA 2PS4A 2F7MF 2DH4A 2Z7HA 1N1ZA 3ASXA 4H5EF 4E9ZA 3OACB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TFN A;  5B03 A;  5IK6 A;  3WEI A;  4FP4 A;  4LZ0 A;  4JZB A;  1VG2 A;  3ZOU A;  5ER8 A;  4WK5 A;  3KRP B;  4DEM F;  1YJ4 A;  3KRF A;  1KIZ A;  2E90 A;  3KRC A;  5JA0 F;  3AQ0 A;  4L2X F;  3WCA A;  5HN8 A;  3S9V A;  3B7L A;  3ADZ A;  2Q58 A;  5CG5 A;  3ACY A;  2E92 A;  4KQS A;  3SDV A;  4NFK F;  4OMG A;  2VF6 A;  5HNA A;  4ZQ8 A;  3CC9 A;  4MC0 A;  4NFJ F;  3BNY A;  3WC9 A;  3P5R A;  5HN7 A;  2OGD A;  3S4J A;  4F6V A;  2Z4W A;  3Q2Z A;  5CG6 A;  1KIY A;  5JV2 F;  3WEJ A;  5B0M A;  1HX9 A;  3VJC A;  3WCL A;  2ZCS A;  4KK2 A;  1HXC A;  2AZK A;  5AHU B;  3P8L A;  3N5H F;  5DJP F;  5EAT A;  2ZCO A;  4OKM A;  3WCD A;  4JVJ F;  4RXE A;  5ILZ A;  4DWB A;  4GAX A;  2J5C A;  3EGT A;  3OYR A;  5DGM F;  4GP2 A;  3OAC A;  3N3D A;  3WSA A;  3N45 F;  3N3L F;  4PVX F;  5B01 A;  1RQI A;  3WEG A;  5I1U A;  1UBX A;  4LTV A;  3SAE A;  2AET A;  4MC3 A;  1YV5 A;  3ZMC A;  2EWG A;  4N9U A;  4GA3 A;  3VJD A;  3RYE A;  4EA0 A;  4F6X A;  4LLT A;  5B0L A;  2E8X A;  2QIS A;  3NPK A;  4KKM A;  2E4O A;  4RXD A;  3ACW A;  5DGS F;  3N0F A;  2AZJ A;  3AE0 A;  3N5J F;  3NF2 A;  3RYW A;  4LIX A;  1WL1 A;  4P0V A;  5DJR F;  5IK0 A;  4JZX A;  3DYF A;  3RBM A;  4P0W A;  3TFV A;  2Q9Y A;  5C05 A;  1VG4 A;  5ERM A;  4LTZ A;  4DHD A;  1HM7 A;  5ILH A;  5DJV F;  3LOM A;  3OAB B;  5ILY A;  4LFG A;  1WKZ A;  4LXW A;  5JV1 F;  4PVY F;  1YYU A;  4LZ3 A;  3PYA A;  4KWD A;  1N20 A;  3KB9 A;  1DGP A;  3CKE A;  5IMN A;  5A0K A;  1FPS A;  3TS7 A;  2F89 F;  4LA6 A;  3WEH A;  1YYS A;  3LLW A;  3WCF A;  4JYX A;  4LPH F;  5IM1 A;  3WJO A;  3ID0 A;  2AEL A;  3LG5 A;  3VJB A;  3V1X A;  1UBV A;  2Z7I A;  3Q2Q A;  3NRI A;  1N24 A;  2AEK A;  3SDR A;  2J1P A;  4LA5 A;  3ICN A;  3KBK A;  2OPM A;  3NPR A;  1RQJ A;  4DXJ A;  3Q1O A;  5HN9 A;  5JUZ F;  2H8O A;  2ZCQ A;  3WE9 A;  3RMG A;  3N1V F;  2ONG A;  1HM4 A;  2E8T A;  2PS7 A;  4LLS A;  4DI5 A;  3VJ9 A;  1EZF A;  4LUU A;  3WCM A;  1YYT A;  2O1O A;  3UCA A;  4F62 A;  2OPN A;  4MC8 A;  2E91 A;  3WJK A;  1YHK A;  5B0I A;  3WEK A;  4XQR F;  5A0J A;  3WCB A;  2ZEV A;  4RYP A;  4NKE A;  3VJ8 A;  5DHK A;  5AYP A;  5IKA A;  2F9K F;  3SDT A;  4NUA A;  3LK5 A;  3OAB A;  3WEF A;  4E1E A;  3AQB B;  3KRA B;  4GP1 A;  3N46 F;  4K10 A;  1VG7 A;  3LSN A;  3KRF B;  3KRP A;  3KRC B;  4RXC A;  5DHI A;  3LEE A;  1V4E A;  4KPJ A;  4LFV F;  4DZW A;  4KVI A;  3VJA A;  3WCH A;  2Z4V A;  3AQC B;  4FJQ A;  5H9D A;  5DIQ F;  3M00 A;  3M9U A;  3ZMB A;  3WJN A;  4OKZ A;  2Z4Y A;  4EA1 A;  1YYQ A;  3P5P A;  5A0I A;  4NFI F;  1WMW A;  4KVW A;  3LGZ B;  1HXA A;  4KPD A;  4E9U A;  3IPI A;  5ILJ A;  4H5C F;  2P1C A;  3V66 A;  1DI1 A;  1WY0 A;  3CP6 A;  1JFA A;  3ICK A;  5IK9 A;  2Q9Z A;  3ICM A;  3ICZ A;  4QPF A;  1HXG A;  3ZL6 A;  5IMI A;  4QXS F;  1PS1 A;  2F8Z F;  2OA6 A;  3M02 A;  3N0G A;  5IKH A;  2PS8 A;  4UMJ A;  2F94 F;  4H5D F;  5E8L A;  3MZV A;  2Z78 A;  2RAH A;  5ILK A;  3QQV A;  2E8U A;  4KFA A;  1N23 A;  1V4K A;  2E8V A;  3APZ A;  3N6K F;  3TFP A;  1UBW A;  2ZCR A;  4XQT F;  3KRA A;  3QKC A;  4RXA A;  4NG6 A;  2E94 A;  3BNX A;  1N1B A;  3LGK A;  3KRO B;  4HD1 A;  4DWG A;  4XQS F;  3WCI A;  3WCC A;  3DYH A;  5ILI A;  2ZY1 A;  2E8W A;  2Z52 A;  3M01 A;  4OGU A;  3WCE A;  4N1Z F;  3G4F A;  3P8R A;  1YQ7 A;  2J1O A;  3PKO A;  4EA2 A;  5AFX A;  3MAV A;  4LFE A;  1UBY A;  3WCJ A;  3PYB A;  5IVG A;  5AEL A;  3V1V A;  1N21 A;  5ERN A;  3LMD A;  4RNQ A;  2ZEU A;  2AZL A;  1ZW5 A;  1YHM A;  3G4D A;  1VG3 A;  5IMP A;  2ONH A;  5ERO A;  2PS6 A;  1N22 A;  5EAU A;  4LPG F;  5B0J A;  1YYR A;  4P0X A;  3N49 F;  1V4I A;  1V4J A;  3ACX A;  4NKF A;  4KQU A;  2Q80 A;  5DW7 A;  1RTR A;  3EZ3 A;  2Z50 A;  4KVD A;  4LZC A;  5KSX F;  3SDQ A;  1WL3 A;  2FTZ A;  3P41 A;  3Q30 A;  2F92 F;  3IBA A;  4KQ5 A;  5IL8 A;  3LZ9 A;  2PS5 A;  4KUX A;  3N1W F;  3ZCD A;  3PH7 A;  3TC1 A;  3M0G A;  4Q23 A;  1WL2 A;  5EAS A;  2E95 A;  3VJE A;  3LDW A;  3KRO A;  3LJI A;  4JXY A;  2I19 A;  1VG6 A;  1JFG A;  2F8C F;  5ILD A;  4LOB A;  3WSB A;  5E8K A;  3WCG A;  3EFQ A;  2FOR A;  5JV0 F;  1V4H A;  2E93 A;  5B00 A;  4JXN A;  4OMH A;  3SDU A;  5B0K A;  5IN8 A;  1YHL A;  3DYG A;  3LVS A;  5IL3 A;  5DZ2 A;  5DGN F;  3PDE A;  2Z4Z A;  4KVY A;  3W7F A;  5B02 A;  1WL0 A;  2Z4X A;  5E8H A;  2PS4 A;  2F7M F;  2DH4 A;  2Z7H A;  1N1Z A;  3ASX A;  4H5E F;  4E9Z A;  3OAC B; 
#chains in the Genus database with same CATH topology
 3TFN A;  5B03 A;  5IK6 A;  3WEI A;  4FP4 A;  4LZ0 A;  4JZB A;  1VG2 A;  3ZOU A;  5ER8 A;  4WK5 A;  3KRP B;  4DEM F;  1YJ4 A;  3KRF A;  1KIZ A;  2E90 A;  3KRC A;  5JA0 F;  3AQ0 A;  4L2X F;  3WCA A;  5HN8 A;  3S9V A;  3B7L A;  3ADZ A;  2Q58 A;  5CG5 A;  3ACY A;  2E92 A;  4KQS A;  3SDV A;  4NFK F;  4OMG A;  2VF6 A;  5HNA A;  4ZQ8 A;  3CC9 A;  4MC0 A;  4NFJ F;  3BNY A;  3WC9 A;  3P5R A;  5HN7 A;  2OGD A;  3S4J A;  4F6V A;  2Z4W A;  3Q2Z A;  5CG6 A;  1KIY A;  5JV2 F;  3WEJ A;  5B0M A;  1HX9 A;  3VJC A;  3WCL A;  2ZCS A;  4KK2 A;  1HXC A;  2AZK A;  5AHU B;  3P8L A;  3N5H F;  5DJP F;  5EAT A;  2ZCO A;  4OKM A;  3WCD A;  4JVJ F;  4RXE A;  5ILZ A;  4DWB A;  4GAX A;  2J5C A;  3EGT A;  3OYR A;  5DGM F;  4GP2 A;  3OAC A;  3N3D A;  3WSA A;  3N45 F;  3N3L F;  4PVX F;  5B01 A;  1RQI A;  3WEG A;  5I1U A;  1UBX A;  4LTV A;  3SAE A;  2AET A;  4MC3 A;  1YV5 A;  3ZMC A;  2EWG A;  4N9U A;  4GA3 A;  3VJD A;  3RYE A;  4EA0 A;  4F6X A;  4LLT A;  5B0L A;  2E8X A;  2QIS A;  3NPK A;  4KKM A;  2E4O A;  4RXD A;  3ACW A;  5DGS F;  3N0F A;  2AZJ A;  3AE0 A;  3N5J F;  3NF2 A;  3RYW A;  4LIX A;  1WL1 A;  4P0V A;  5DJR F;  5IK0 A;  4JZX A;  3DYF A;  3RBM A;  4P0W A;  3TFV A;  2Q9Y A;  5C05 A;  1VG4 A;  5ERM A;  4LTZ A;  4DHD A;  1HM7 A;  5ILH A;  5DJV F;  3LOM A;  3OAB B;  5ILY A;  4LFG A;  1WKZ A;  4LXW A;  5JV1 F;  4PVY F;  1YYU A;  4LZ3 A;  3PYA A;  4KWD A;  1N20 A;  3KB9 A;  1DGP A;  3CKE A;  5IMN A;  5A0K A;  1FPS A;  3TS7 A;  2F89 F;  4LA6 A;  3WEH A;  1YYS A;  3LLW A;  3WCF A;  4JYX A;  4LPH F;  5IM1 A;  3WJO A;  3ID0 A;  2AEL A;  3LG5 A;  3VJB A;  3V1X A;  1UBV A;  2Z7I A;  3Q2Q A;  3NRI A;  1N24 A;  2AEK A;  3SDR A;  2J1P A;  4LA5 A;  3ICN A;  3KBK A;  2OPM A;  3NPR A;  1RQJ A;  4DXJ A;  3Q1O A;  5HN9 A;  5JUZ F;  2H8O A;  2ZCQ A;  3WE9 A;  3RMG A;  3N1V F;  2ONG A;  1HM4 A;  2E8T A;  2PS7 A;  4LLS A;  4DI5 A;  3VJ9 A;  1EZF A;  4LUU A;  3WCM A;  1YYT A;  2O1O A;  3UCA A;  4F62 A;  2OPN A;  4MC8 A;  2E91 A;  3WJK A;  1YHK A;  5B0I A;  3WEK A;  4XQR F;  5A0J A;  3WCB A;  2ZEV A;  4RYP A;  4NKE A;  3VJ8 A;  5DHK A;  5AYP A;  5IKA A;  2F9K F;  3SDT A;  4NUA A;  3LK5 A;  3OAB A;  3WEF A;  4E1E A;  3AQB B;  3KRA B;  4GP1 A;  3N46 F;  4K10 A;  1VG7 A;  3LSN A;  3KRF B;  3KRP A;  3KRC B;  4RXC A;  5DHI A;  3LEE A;  1V4E A;  4KPJ A;  4LFV F;  4DZW A;  4KVI A;  3VJA A;  3WCH A;  2Z4V A;  3AQC B;  4FJQ A;  5H9D A;  5DIQ F;  3M00 A;  3M9U A;  3ZMB A;  3WJN A;  4OKZ A;  2Z4Y A;  4EA1 A;  1YYQ A;  3P5P A;  5A0I A;  4NFI F;  1WMW A;  4KVW A;  3LGZ B;  1HXA A;  4KPD A;  4E9U A;  3IPI A;  5ILJ A;  4H5C F;  2P1C A;  3V66 A;  1DI1 A;  1WY0 A;  3CP6 A;  1JFA A;  3ICK A;  5IK9 A;  2Q9Z A;  3ICM A;  3ICZ A;  4QPF A;  1HXG A;  3ZL6 A;  5IMI A;  4QXS F;  1PS1 A;  2F8Z F;  2OA6 A;  3M02 A;  3N0G A;  5IKH A;  2PS8 A;  4UMJ A;  2F94 F;  4H5D F;  5E8L A;  3MZV A;  2Z78 A;  2RAH A;  5ILK A;  3QQV A;  2E8U A;  4KFA A;  1N23 A;  1V4K A;  2E8V A;  3APZ A;  3N6K F;  3TFP A;  1UBW A;  2ZCR A;  4XQT F;  3KRA A;  3QKC A;  4RXA A;  4NG6 A;  2E94 A;  3BNX A;  1N1B A;  3LGK A;  3KRO B;  4HD1 A;  4DWG A;  4XQS F;  3WCI A;  3WCC A;  3DYH A;  5ILI A;  2ZY1 A;  2E8W A;  2Z52 A;  3M01 A;  4OGU A;  3WCE A;  4N1Z F;  3G4F A;  3P8R A;  1YQ7 A;  2J1O A;  3PKO A;  4EA2 A;  5AFX A;  3MAV A;  4LFE A;  1UBY A;  3WCJ A;  3PYB A;  5IVG A;  5AEL A;  3V1V A;  1N21 A;  5ERN A;  3LMD A;  4RNQ A;  2ZEU A;  2AZL A;  1ZW5 A;  1YHM A;  3G4D A;  1VG3 A;  5IMP A;  2ONH A;  5ERO A;  2PS6 A;  1N22 A;  5EAU A;  4LPG F;  5B0J A;  1YYR A;  4P0X A;  3N49 F;  1V4I A;  1V4J A;  3ACX A;  4NKF A;  4KQU A;  2Q80 A;  5DW7 A;  1RTR A;  3EZ3 A;  2Z50 A;  4KVD A;  4LZC A;  5KSX F;  3SDQ A;  1WL3 A;  2FTZ A;  3P41 A;  3Q30 A;  2F92 F;  3IBA A;  4KQ5 A;  5IL8 A;  3LZ9 A;  2PS5 A;  4KUX A;  3N1W F;  3ZCD A;  3PH7 A;  3TC1 A;  3M0G A;  4Q23 A;  1WL2 A;  5EAS A;  2E95 A;  3VJE A;  3LDW A;  3KRO A;  3LJI A;  4JXY A;  2I19 A;  1VG6 A;  1JFG A;  2F8C F;  5ILD A;  4LOB A;  3WSB A;  5E8K A;  3WCG A;  3EFQ A;  2FOR A;  5JV0 F;  1V4H A;  2E93 A;  5B00 A;  4JXN A;  4OMH A;  3SDU A;  5B0K A;  5IN8 A;  1YHL A;  3DYG A;  3LVS A;  5IL3 A;  5DZ2 A;  5DGN F;  3PDE A;  2Z4Z A;  4KVY A;  3W7F A;  5B02 A;  1WL0 A;  2Z4X A;  5E8H A;  2PS4 A;  2F7M F;  2DH4 A;  2Z7H A;  1N1Z A;  3ASX A;  4H5E F;  4E9Z A;  3OAC B; 
#chains in the Genus database with same CATH homology
 3TFN A;  5B03 A;  5IK6 A;  3WEI A;  4FP4 A;  4LZ0 A;  4JZB A;  1VG2 A;  3ZOU A;  5ER8 A;  4WK5 A;  3KRP B;  4DEM F;  1YJ4 A;  3KRF A;  1KIZ A;  2E90 A;  3KRC A;  5JA0 F;  3AQ0 A;  4L2X F;  3WCA A;  5HN8 A;  3S9V A;  3B7L A;  3ADZ A;  2Q58 A;  5CG5 A;  3ACY A;  2E92 A;  4KQS A;  3SDV A;  4NFK F;  4OMG A;  2VF6 A;  5HNA A;  4ZQ8 A;  3CC9 A;  4MC0 A;  4NFJ F;  3BNY A;  3WC9 A;  3P5R A;  5HN7 A;  2OGD A;  3S4J A;  4F6V A;  2Z4W A;  3Q2Z A;  5CG6 A;  1KIY A;  5JV2 F;  3WEJ A;  5B0M A;  1HX9 A;  3VJC A;  3WCL A;  2ZCS A;  4KK2 A;  1HXC A;  2AZK A;  5AHU B;  3P8L A;  3N5H F;  5DJP F;  5EAT A;  2ZCO A;  4OKM A;  3WCD A;  4JVJ F;  4RXE A;  5ILZ A;  4DWB A;  4GAX A;  2J5C A;  3EGT A;  3OYR A;  5DGM F;  4GP2 A;  3OAC A;  3N3D A;  3WSA A;  3N45 F;  3N3L F;  4PVX F;  5B01 A;  1RQI A;  3WEG A;  5I1U A;  1UBX A;  4LTV A;  3SAE A;  2AET A;  4MC3 A;  1YV5 A;  3ZMC A;  2EWG A;  4N9U A;  4GA3 A;  3VJD A;  3RYE A;  4EA0 A;  4F6X A;  4LLT A;  5B0L A;  2E8X A;  2QIS A;  3NPK A;  4KKM A;  2E4O A;  4RXD A;  3ACW A;  5DGS F;  3N0F A;  2AZJ A;  3AE0 A;  3N5J F;  3NF2 A;  3RYW A;  4LIX A;  1WL1 A;  4P0V A;  5DJR F;  5IK0 A;  4JZX A;  3DYF A;  3RBM A;  4P0W A;  3TFV A;  2Q9Y A;  5C05 A;  1VG4 A;  5ERM A;  4LTZ A;  4DHD A;  1HM7 A;  5ILH A;  5DJV F;  3LOM A;  3OAB B;  5ILY A;  4LFG A;  1WKZ A;  4LXW A;  5JV1 F;  4PVY F;  1YYU A;  4LZ3 A;  3PYA A;  4KWD A;  1N20 A;  3KB9 A;  1DGP A;  3CKE A;  5IMN A;  5A0K A;  1FPS A;  3TS7 A;  2F89 F;  4LA6 A;  3WEH A;  1YYS A;  3LLW A;  3WCF A;  4JYX A;  4LPH F;  5IM1 A;  3WJO A;  3ID0 A;  2AEL A;  3LG5 A;  3VJB A;  3V1X A;  1UBV A;  2Z7I A;  3Q2Q A;  3NRI A;  1N24 A;  2AEK A;  3SDR A;  2J1P A;  4LA5 A;  3ICN A;  3KBK A;  2OPM A;  3NPR A;  1RQJ A;  4DXJ A;  3Q1O A;  5HN9 A;  5JUZ F;  2H8O A;  2ZCQ A;  3WE9 A;  3RMG A;  3N1V F;  2ONG A;  1HM4 A;  2E8T A;  2PS7 A;  4LLS A;  4DI5 A;  3VJ9 A;  1EZF A;  4LUU A;  3WCM A;  1YYT A;  2O1O A;  3UCA A;  4F62 A;  2OPN A;  4MC8 A;  2E91 A;  3WJK A;  1YHK A;  5B0I A;  3WEK A;  4XQR F;  5A0J A;  3WCB A;  2ZEV A;  4RYP A;  4NKE A;  3VJ8 A;  5DHK A;  5AYP A;  5IKA A;  2F9K F;  3SDT A;  4NUA A;  3LK5 A;  3OAB A;  3WEF A;  4E1E A;  3AQB B;  3KRA B;  4GP1 A;  3N46 F;  4K10 A;  1VG7 A;  3LSN A;  3KRF B;  3KRP A;  3KRC B;  4RXC A;  5DHI A;  3LEE A;  1V4E A;  4KPJ A;  4LFV F;  4DZW A;  4KVI A;  3VJA A;  3WCH A;  2Z4V A;  3AQC B;  4FJQ A;  5H9D A;  5DIQ F;  3M00 A;  3M9U A;  3ZMB A;  3WJN A;  4OKZ A;  2Z4Y A;  4EA1 A;  1YYQ A;  3P5P A;  5A0I A;  4NFI F;  1WMW A;  4KVW A;  3LGZ B;  1HXA A;  4KPD A;  4E9U A;  3IPI A;  5ILJ A;  4H5C F;  2P1C A;  3V66 A;  1DI1 A;  1WY0 A;  3CP6 A;  1JFA A;  3ICK A;  5IK9 A;  2Q9Z A;  3ICM A;  3ICZ A;  4QPF A;  1HXG A;  3ZL6 A;  5IMI A;  4QXS F;  1PS1 A;  2F8Z F;  2OA6 A;  3M02 A;  3N0G A;  5IKH A;  2PS8 A;  4UMJ A;  2F94 F;  4H5D F;  5E8L A;  3MZV A;  2Z78 A;  2RAH A;  5ILK A;  3QQV A;  2E8U A;  4KFA A;  1N23 A;  1V4K A;  2E8V A;  3APZ A;  3N6K F;  3TFP A;  1UBW A;  2ZCR A;  4XQT F;  3KRA A;  3QKC A;  4RXA A;  4NG6 A;  2E94 A;  3BNX A;  1N1B A;  3LGK A;  3KRO B;  4HD1 A;  4DWG A;  4XQS F;  3WCI A;  3WCC A;  3DYH A;  5ILI A;  2ZY1 A;  2E8W A;  2Z52 A;  3M01 A;  4OGU A;  3WCE A;  4N1Z F;  3G4F A;  3P8R A;  1YQ7 A;  2J1O A;  3PKO A;  4EA2 A;  5AFX A;  3MAV A;  4LFE A;  1UBY A;  3WCJ A;  3PYB A;  5IVG A;  5AEL A;  3V1V A;  1N21 A;  5ERN A;  3LMD A;  4RNQ A;  2ZEU A;  2AZL A;  1ZW5 A;  1YHM A;  3G4D A;  1VG3 A;  5IMP A;  2ONH A;  5ERO A;  2PS6 A;  1N22 A;  5EAU A;  4LPG F;  5B0J A;  1YYR A;  4P0X A;  3N49 F;  1V4I A;  1V4J A;  3ACX A;  4NKF A;  4KQU A;  2Q80 A;  5DW7 A;  1RTR A;  3EZ3 A;  2Z50 A;  4KVD A;  4LZC A;  5KSX F;  3SDQ A;  1WL3 A;  2FTZ A;  3P41 A;  3Q30 A;  2F92 F;  3IBA A;  4KQ5 A;  5IL8 A;  3LZ9 A;  2PS5 A;  4KUX A;  3N1W F;  3ZCD A;  3PH7 A;  3TC1 A;  3M0G A;  4Q23 A;  1WL2 A;  5EAS A;  2E95 A;  3VJE A;  3LDW A;  3KRO A;  3LJI A;  4JXY A;  2I19 A;  1VG6 A;  1JFG A;  2F8C F;  5ILD A;  4LOB A;  3WSB A;  5E8K A;  3WCG A;  3EFQ A;  2FOR A;  5JV0 F;  1V4H A;  2E93 A;  5B00 A;  4JXN A;  4OMH A;  3SDU A;  5B0K A;  5IN8 A;  1YHL A;  3DYG A;  3LVS A;  5IL3 A;  5DZ2 A;  5DGN F;  3PDE A;  2Z4Z A;  4KVY A;  3W7F A;  5B02 A;  1WL0 A;  2Z4X A;  5E8H A;  2PS4 A;  2F7M F;  2DH4 A;  2Z7H A;  1N1Z A;  3ASX A;  4H5E F;  4E9Z A;  3OAC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...