5AYPA

Crystal structure of bacillus stearothermophilus farnesyl pyrophosphate synthase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
258
Chain Sequence
QLSVEQFLNEQKQAVETALSRYIERLEGPAKLKKAMAYSLEAGGKRIRPLLLLSTVRALGKDPAVGLPVACAIEMIHTYSLIHDDLPSMDNDDLRRGKPTNHKVFGEAMAILAGDGLLTYAFQLITEDERIPPSVRLRLIERLAKAAGPEGMVAGQAADMEGEGKTLTLSELEYIHRHKTGKMLQYSVHAGALIGGADARQTRELDEFAAHLGLAFQIRLAGAKEKLAFHIEAAQRHLRNADVDGAALAYICELVAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyl diphosphate synthase
publication title Crystal structure of Bacillus stearothermophilus Farnesyl pyrophosphate synthase
rcsb
source organism Geobacillus stearothermophilus
total genus 99
structure length 258
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2015-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5aypA00
3WSAA 3BNXA 4UMJA 4LLSA 3WCGA 2E90A 3P8RA 1HXAA 5JV0F 5ER8A 4OMGA 5A0KA 3IPIA 3SDTA 4GP1A 4LFEA 4XQTF 4WK5A 1YQ7A 3N45F 1YHMA 1YJ4A 1VG4A 3BNYA 2ONHA 2PS6A 2RAHA 3DYHA 3APZA 3WCIA 3KRFB 4DWGA 5AFXA 4JZBA 5IKHA 2O1OA 3LGZB 3OACA 1DGPA 3WEJA 3AE0A 1JFAA 3ACYA 4ZQ8A 5ILHA 4E9ZA 1HM7A 5ILYA 4LTZA 1WL3A 2H8OA 3ZL6A 2F94F 3IBAA 4RXDA 2QISA 2ZEUA 3SDRA 1YYUA 3G4DA 2P1CA 2AZKA 3LG5A 4NUAA 1KIYA 4NKEA 5DIQF 3DYGA 5JV2F 1WY0A 3KRCB 3LMDA 4LTVA 4XQRF 4JXNA 1JFGA 5IL3A 2F9KF 4L2XF 2Z4XA 4LPHF 3LJIA 2OGDA 3WEFA 1VG6A 1HM4A 4LUUA 2Z7HA 4LPGF 2F7MF 3P8LA 3LVSA 1UBXA 4OKMA 3WC9A 1V4KA 4LA6A 3WCHA 3ADZA 1RTRA 5IMPA 5E8HA 4QPFA 1WL1A 3OABB 3KROA 2F89F 3N1WF 4KPDA 3VJ9A 2EWGA 4E9UA 3QQVA 4DZWA 3WJOA 4LA5A 3ASXA 1RQJA 3CP6A 5H9DA 5C05A 3WCDA 1N24A 1YYTA 3VJDA 2ZCOA 5IMIA 5B0IA 4EA0A 2FTZA 1YYSA 4HD1A 1PS1A 3PYBA 1VG7A 3OYRA 3P5PA 2Q58A 3N6KF 4PVYF 5EATA 3WCAA 1N22A 3LOMA 3RYEA 3ICNA 4H5CF 4JVJF 4PVXF 5DHKA 5EASA 1KIZA 3TFPA 3V66A 5IK0A 5B0KA 3N49F 5IK6A 4LOBA 2PS8A 4RXAA 3WCFA 5CG6A 3CKEA 3EGTA 5I1UA 2ZCSA 2PS4A 3PH7A 4MC8A 4EA2A 5ILIA 3VJBA 3PKOA 4EA1A 5IVGA 3ID0A 3ICKA 2J1OA 3ACWA 3N3DA 3KB9A 3QKCA 3SDVA 3PDEA 4KWDA 2OPNA 3S9VA 4DEMF 3V1VA 1V4JA 2ZEVA 3WEGA 4OMHA 3ACXA 1VG3A 4KFAA 4FJQA 3VJAA 5B01A 5B0LA 2E4OA 1YHKA 1V4IA 1WKZA 3LDWA 5DJVF 4KPJA 4LZ3A 5ERMA 3LZ9A 2AZJA 4FP4A 2PS5A 4K10A 1HXCA 1RQIA 4DHDA 4LXWA 1YYQA 1WL0A 1WMWA 4KQUA 5E8KA 4GP2A 4KUXA 3SDQA 1V4EA 2OA6A 4P0XA 5B02A 5DW7A 3N1VF 3VJEA 4QXSF 3MAVA 3MZVA 3W7FA 2DH4A 1V4HA 5DGNF 3G4FA 3WJNA 1FPSA 5DZ2A 4NFJF 5B00A 4F62A 5DGMF 2ZCRA 3Q2QA 4LFVF 3TS7A 4DI5A 2PS7A 5EAUA 1VG2A 2Z78A 5IN8A 3RBMA 5DJRF 5HN8A 2E8TA 2J5CA 4NKFA 3TFVA 3RMGA 3Q2ZA 4RXCA 5E8LA 2Z4WA 3WE9A 3N3LF 1YHLA 2E91A 4LIXA 3KRAA 3DYFA 4KVYA 2FORA 1N1BA 2AZLA 1UBVA 5DHIA 4DXJA 3NRIA 3WCLA 3ZMBA 1N21A 5ILKA 3CC9A 4NFIF 4RXEA 3N0FA 5DJPF 2I19A 1UBYA 2Z50A 2F92F 2J1PA 3N5HF 3LK5A 4KQSA 2Z4YA 3KRPA 3UCAA 4F6VA 3EZ3A 4E1EA 5AELA 4KQ5A 3NF2A 2OPMA 2Z52A 4N9UA 2E8WA 2Z4VA 3OACB 3WCEA 1YYRA 4KVIA 3TFNA 5HN7A 3WEHA 4P0VA 3PYAA 3N46F 4DWBA 3WCMA 3WEIA 4F6XA 2AETA 3NPRA 5B0JA 2Z7IA 3KRFA 5IL8A 4RNQA 5IKAA 3P5RA 4H5DF 3LGKA 4JYXA 4RYPA 5ILZA 5EROA 2E8UA 2ZY1A 3WCJA 3AQBB 4OKZA 1HXGA 1EZFA 2E8XA 3M0GA 3V1XA 1WL2A 3B7LA 5CG5A 3ZOUA 3LLWA 2Q9ZA 2ONGA 1N1ZA 4NG6A 5B03A 4P0WA 3Q1OA 3SDUA 4JZXA 3WCBA 3P41A 4MC0A 3EFQA 2Z4ZA 4JXYA 5ILDA 5IMNA 2E92A 3M00A 5IM1A 5JV1F 4NFKF 3KRCA 4LLTA 5IK9A 4Q23A 2Q80A 1N23A 5AHUB 3Q30A 4KVWA 2ZCQA 4KVDA 3KROB 5JA0F 3N0GA 3M02A 3WJKA 4GAXA 5DGSF 2F8CF 4H5EF 4LZ0A 3LSNA 3WEKA 3TC1A 3ICZA 3SAEA 2F8ZF 3ZCDA 5HNAA 3KBKA 5A0IA 5JUZF 4OGUA 3M01A 4LFGA 3AQCB 3OABA 2Q9YA 3KRAB 4N1ZF 3S4JA 4MC3A 5HN9A 3WCCA 1HX9A 2E94A 1ZW5A 3AQ0A 3NPKA 4GA3A 4XQSF 3ICMA 5KSXF 4KKMA 4LZCA 3RYWA 3N5JF 1YV5A 2E95A 5ILJA 3ZMCA 2AELA 1DI1A 2AEKA 3VJ8A 3LEEA 5ERNA 2E8VA 3KRPB 5A0JA 5AYPA 3WSBA 5B0MA 3M9UA 1N20A 2VF6A 3VJCA 1UBWA 4KK2A 2E93A
chains in the Genus database with same CATH superfamily
3WSAA 3BNXA 4UMJA 4LLSA 3WCGA 2E90A 3P8RA 1HXAA 5JV0F 5ER8A 4OMGA 5A0KA 3IPIA 3SDTA 4GP1A 4LFEA 4XQTF 4WK5A 1YQ7A 3N45F 1YHMA 1YJ4A 1VG4A 3BNYA 2ONHA 2PS6A 2RAHA 3DYHA 3APZA 3WCIA 3KRFB 4DWGA 5AFXA 4JZBA 5IKHA 2O1OA 3LGZB 3OACA 1DGPA 3WEJA 3AE0A 1JFAA 3ACYA 4ZQ8A 5ILHA 4E9ZA 1HM7A 5ILYA 4LTZA 1WL3A 2H8OA 3ZL6A 2F94F 3IBAA 4RXDA 2QISA 2ZEUA 3SDRA 1YYUA 3G4DA 2P1CA 2AZKA 3LG5A 4NUAA 1KIYA 4NKEA 5DIQF 3DYGA 5JV2F 1WY0A 3KRCB 3LMDA 4LTVA 4XQRF 4JXNA 1JFGA 5IL3A 2F9KF 4L2XF 2Z4XA 4LPHF 3LJIA 2OGDA 3WEFA 1VG6A 1HM4A 4LUUA 2Z7HA 4LPGF 2F7MF 3P8LA 3LVSA 1UBXA 4OKMA 3WC9A 1V4KA 4LA6A 3WCHA 3ADZA 1RTRA 5IMPA 5E8HA 4QPFA 1WL1A 3OABB 3KROA 2F89F 3N1WF 4KPDA 3VJ9A 2EWGA 4E9UA 3QQVA 4DZWA 3WJOA 4LA5A 3ASXA 1RQJA 3CP6A 5H9DA 5C05A 3WCDA 1N24A 1YYTA 3VJDA 2ZCOA 5IMIA 5B0IA 4EA0A 2FTZA 1YYSA 4HD1A 1PS1A 3PYBA 1VG7A 3OYRA 3P5PA 2Q58A 3N6KF 4PVYF 5EATA 3WCAA 1N22A 3LOMA 3RYEA 3ICNA 4H5CF 4JVJF 4PVXF 5DHKA 5EASA 1KIZA 3TFPA 3V66A 5IK0A 5B0KA 3N49F 5IK6A 4LOBA 2PS8A 4RXAA 3WCFA 5CG6A 3CKEA 3EGTA 5I1UA 2ZCSA 2PS4A 3PH7A 4MC8A 4EA2A 5ILIA 3VJBA 3PKOA 4EA1A 5IVGA 3ID0A 3ICKA 2J1OA 3ACWA 3N3DA 3KB9A 3QKCA 3SDVA 3PDEA 4KWDA 2OPNA 3S9VA 4DEMF 3V1VA 1V4JA 2ZEVA 3WEGA 4OMHA 3ACXA 1VG3A 4KFAA 4FJQA 3VJAA 5B01A 5B0LA 2E4OA 1YHKA 1V4IA 1WKZA 3LDWA 5DJVF 4KPJA 4LZ3A 5ERMA 3LZ9A 2AZJA 4FP4A 2PS5A 4K10A 1HXCA 1RQIA 4DHDA 4LXWA 1YYQA 1WL0A 1WMWA 4KQUA 5E8KA 4GP2A 4KUXA 3SDQA 1V4EA 2OA6A 4P0XA 5B02A 5DW7A 3N1VF 3VJEA 4QXSF 3MAVA 3MZVA 3W7FA 2DH4A 1V4HA 5DGNF 3G4FA 3WJNA 1FPSA 5DZ2A 4NFJF 5B00A 4F62A 5DGMF 2ZCRA 3Q2QA 4LFVF 3TS7A 4DI5A 2PS7A 5EAUA 1VG2A 2Z78A 5IN8A 3RBMA 5DJRF 5HN8A 2E8TA 2J5CA 4NKFA 3TFVA 3RMGA 3Q2ZA 4RXCA 5E8LA 2Z4WA 3WE9A 3N3LF 1YHLA 2E91A 4LIXA 3KRAA 3DYFA 4KVYA 2FORA 1N1BA 2AZLA 1UBVA 5DHIA 4DXJA 3NRIA 3WCLA 3ZMBA 1N21A 5ILKA 3CC9A 4NFIF 4RXEA 3N0FA 5DJPF 2I19A 1UBYA 2Z50A 2F92F 2J1PA 3N5HF 3LK5A 4KQSA 2Z4YA 3KRPA 3UCAA 4F6VA 3EZ3A 4E1EA 5AELA 4KQ5A 3NF2A 2OPMA 2Z52A 4N9UA 2E8WA 2Z4VA 3OACB 3WCEA 1YYRA 4KVIA 3TFNA 5HN7A 3WEHA 4P0VA 3PYAA 3N46F 4DWBA 3WCMA 3WEIA 4F6XA 2AETA 3NPRA 5B0JA 2Z7IA 3KRFA 5IL8A 4RNQA 5IKAA 3P5RA 4H5DF 3LGKA 4JYXA 4RYPA 5ILZA 5EROA 2E8UA 2ZY1A 3WCJA 3AQBB 4OKZA 1HXGA 1EZFA 2E8XA 3M0GA 3V1XA 1WL2A 3B7LA 5CG5A 3ZOUA 3LLWA 2Q9ZA 2ONGA 1N1ZA 4NG6A 5B03A 4P0WA 3Q1OA 3SDUA 4JZXA 3WCBA 3P41A 4MC0A 3EFQA 2Z4ZA 4JXYA 5ILDA 5IMNA 2E92A 3M00A 5IM1A 5JV1F 4NFKF 3KRCA 4LLTA 5IK9A 4Q23A 2Q80A 1N23A 5AHUB 3Q30A 4KVWA 2ZCQA 4KVDA 3KROB 5JA0F 3N0GA 3M02A 3WJKA 4GAXA 5DGSF 2F8CF 4H5EF 4LZ0A 3LSNA 3WEKA 3TC1A 3ICZA 3SAEA 2F8ZF 3ZCDA 5HNAA 3KBKA 5A0IA 5JUZF 4OGUA 3M01A 4LFGA 3AQCB 3OABA 2Q9YA 3KRAB 4N1ZF 3S4JA 4MC3A 5HN9A 3WCCA 1HX9A 2E94A 1ZW5A 3AQ0A 3NPKA 4GA3A 4XQSF 3ICMA 5KSXF 4KKMA 4LZCA 3RYWA 3N5JF 1YV5A 2E95A 5ILJA 3ZMCA 2AELA 1DI1A 2AEKA 3VJ8A 3LEEA 5ERNA 2E8VA 3KRPB 5A0JA 5AYPA 3WSBA 5B0MA 3M9UA 1N20A 2VF6A 3VJCA 1UBWA 4KK2A 2E93A
chains in the Genus database with same CATH topology
3WSAA 3BNXA 4UMJA 4LLSA 3WCGA 2E90A 3P8RA 1HXAA 5JV0F 5ER8A 4OMGA 5A0KA 3IPIA 3SDTA 4GP1A 4LFEA 4XQTF 4WK5A 1YQ7A 3N45F 1YHMA 1YJ4A 1VG4A 3BNYA 2ONHA 2PS6A 2RAHA 3DYHA 3APZA 3WCIA 3KRFB 4DWGA 5AFXA 4JZBA 5IKHA 2O1OA 3LGZB 3OACA 1DGPA 3WEJA 3AE0A 1JFAA 3ACYA 4ZQ8A 5ILHA 4E9ZA 1HM7A 5ILYA 4LTZA 1WL3A 2H8OA 3ZL6A 2F94F 3IBAA 4RXDA 2QISA 2ZEUA 3SDRA 1YYUA 3G4DA 2P1CA 2AZKA 3LG5A 4NUAA 1KIYA 4NKEA 5DIQF 3DYGA 5JV2F 1WY0A 3KRCB 3LMDA 4LTVA 4XQRF 4JXNA 1JFGA 5IL3A 2F9KF 4L2XF 2Z4XA 4LPHF 3LJIA 2OGDA 3WEFA 1VG6A 1HM4A 4LUUA 2Z7HA 4LPGF 2F7MF 3P8LA 3LVSA 1UBXA 4OKMA 3WC9A 1V4KA 4LA6A 3WCHA 3ADZA 1RTRA 5IMPA 5E8HA 4QPFA 1WL1A 3OABB 3KROA 2F89F 3N1WF 4KPDA 3VJ9A 2EWGA 4E9UA 3QQVA 4DZWA 3WJOA 4LA5A 3ASXA 1RQJA 3CP6A 5H9DA 5C05A 3WCDA 1N24A 1YYTA 3VJDA 2ZCOA 5IMIA 5B0IA 4EA0A 2FTZA 1YYSA 4HD1A 1PS1A 3PYBA 1VG7A 3OYRA 3P5PA 2Q58A 3N6KF 4PVYF 5EATA 3WCAA 1N22A 3LOMA 3RYEA 3ICNA 4H5CF 4JVJF 4PVXF 5DHKA 5EASA 1KIZA 3TFPA 3V66A 5IK0A 5B0KA 3N49F 5IK6A 4LOBA 2PS8A 4RXAA 3WCFA 5CG6A 3CKEA 3EGTA 5I1UA 2ZCSA 2PS4A 3PH7A 4MC8A 4EA2A 5ILIA 3VJBA 3PKOA 4EA1A 5IVGA 3ID0A 3ICKA 2J1OA 3ACWA 3N3DA 3KB9A 3QKCA 3SDVA 3PDEA 4KWDA 2OPNA 3S9VA 4DEMF 3V1VA 1V4JA 2ZEVA 3WEGA 4OMHA 3ACXA 1VG3A 4KFAA 4FJQA 3VJAA 5B01A 5B0LA 2E4OA 1YHKA 1V4IA 1WKZA 3LDWA 5DJVF 4KPJA 4LZ3A 5ERMA 3LZ9A 2AZJA 4FP4A 2PS5A 4K10A 1HXCA 1RQIA 4DHDA 4LXWA 1YYQA 1WL0A 1WMWA 4KQUA 5E8KA 4GP2A 4KUXA 3SDQA 1V4EA 2OA6A 4P0XA 5B02A 5DW7A 3N1VF 3VJEA 4QXSF 3MAVA 3MZVA 3W7FA 2DH4A 1V4HA 5DGNF 3G4FA 3WJNA 1FPSA 5DZ2A 4NFJF 5B00A 4F62A 5DGMF 2ZCRA 3Q2QA 4LFVF 3TS7A 4DI5A 2PS7A 5EAUA 1VG2A 2Z78A 5IN8A 3RBMA 5DJRF 5HN8A 2E8TA 2J5CA 4NKFA 3TFVA 3RMGA 3Q2ZA 4RXCA 5E8LA 2Z4WA 3WE9A 3N3LF 1YHLA 2E91A 4LIXA 3KRAA 3DYFA 4KVYA 2FORA 1N1BA 2AZLA 1UBVA 5DHIA 4DXJA 3NRIA 3WCLA 3ZMBA 1N21A 5ILKA 3CC9A 4NFIF 4RXEA 3N0FA 5DJPF 2I19A 1UBYA 2Z50A 2F92F 2J1PA 3N5HF 3LK5A 4KQSA 2Z4YA 3KRPA 3UCAA 4F6VA 3EZ3A 4E1EA 5AELA 4KQ5A 3NF2A 2OPMA 2Z52A 4N9UA 2E8WA 2Z4VA 3OACB 3WCEA 1YYRA 4KVIA 3TFNA 5HN7A 3WEHA 4P0VA 3PYAA 3N46F 4DWBA 3WCMA 3WEIA 4F6XA 2AETA 3NPRA 5B0JA 2Z7IA 3KRFA 5IL8A 4RNQA 5IKAA 3P5RA 4H5DF 3LGKA 4JYXA 4RYPA 5ILZA 5EROA 2E8UA 2ZY1A 3WCJA 3AQBB 4OKZA 1HXGA 1EZFA 2E8XA 3M0GA 3V1XA 1WL2A 3B7LA 5CG5A 3ZOUA 3LLWA 2Q9ZA 2ONGA 1N1ZA 4NG6A 5B03A 4P0WA 3Q1OA 3SDUA 4JZXA 3WCBA 3P41A 4MC0A 3EFQA 2Z4ZA 4JXYA 5ILDA 5IMNA 2E92A 3M00A 5IM1A 5JV1F 4NFKF 3KRCA 4LLTA 5IK9A 4Q23A 2Q80A 1N23A 5AHUB 3Q30A 4KVWA 2ZCQA 4KVDA 3KROB 5JA0F 3N0GA 3M02A 3WJKA 4GAXA 5DGSF 2F8CF 4H5EF 4LZ0A 3LSNA 3WEKA 3TC1A 3ICZA 3SAEA 2F8ZF 3ZCDA 5HNAA 3KBKA 5A0IA 5JUZF 4OGUA 3M01A 4LFGA 3AQCB 3OABA 2Q9YA 3KRAB 4N1ZF 3S4JA 4MC3A 5HN9A 3WCCA 1HX9A 2E94A 1ZW5A 3AQ0A 3NPKA 4GA3A 4XQSF 3ICMA 5KSXF 4KKMA 4LZCA 3RYWA 3N5JF 1YV5A 2E95A 5ILJA 3ZMCA 2AELA 1DI1A 2AEKA 3VJ8A 3LEEA 5ERNA 2E8VA 3KRPB 5A0JA 5AYPA 3WSBA 5B0MA 3M9UA 1N20A 2VF6A 3VJCA 1UBWA 4KK2A 2E93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WSA A;  3BNX A;  4UMJ A;  4LLS A;  3WCG A;  2E90 A;  3P8R A;  1HXA A;  5JV0 F;  5ER8 A;  4OMG A;  5A0K A;  3IPI A;  3SDT A;  4GP1 A;  4LFE A;  4XQT F;  4WK5 A;  1YQ7 A;  3N45 F;  1YHM A;  1YJ4 A;  1VG4 A;  3BNY A;  2ONH A;  2PS6 A;  2RAH A;  3DYH A;  3APZ A;  3WCI A;  3KRF B;  4DWG A;  5AFX A;  4JZB A;  5IKH A;  2O1O A;  3LGZ B;  3OAC A;  1DGP A;  3WEJ A;  3AE0 A;  1JFA A;  3ACY A;  4ZQ8 A;  5ILH A;  4E9Z A;  1HM7 A;  5ILY A;  4LTZ A;  1WL3 A;  2H8O A;  3ZL6 A;  2F94 F;  3IBA A;  4RXD A;  2QIS A;  2ZEU A;  3SDR A;  1YYU A;  3G4D A;  2P1C A;  2AZK A;  3LG5 A;  4NUA A;  1KIY A;  4NKE A;  5DIQ F;  3DYG A;  5JV2 F;  1WY0 A;  3KRC B;  3LMD A;  4LTV A;  4XQR F;  4JXN A;  1JFG A;  5IL3 A;  2F9K F;  4L2X F;  2Z4X A;  4LPH F;  3LJI A;  2OGD A;  3WEF A;  1VG6 A;  1HM4 A;  4LUU A;  2Z7H A;  4LPG F;  2F7M F;  3P8L A;  3LVS A;  1UBX A;  4OKM A;  3WC9 A;  1V4K A;  4LA6 A;  3WCH A;  3ADZ A;  1RTR A;  5IMP A;  5E8H A;  4QPF A;  1WL1 A;  3OAB B;  3KRO A;  2F89 F;  3N1W F;  4KPD A;  3VJ9 A;  2EWG A;  4E9U A;  3QQV A;  4DZW A;  3WJO A;  4LA5 A;  3ASX A;  1RQJ A;  3CP6 A;  5H9D A;  5C05 A;  3WCD A;  1N24 A;  1YYT A;  3VJD A;  2ZCO A;  5IMI A;  5B0I A;  4EA0 A;  2FTZ A;  1YYS A;  4HD1 A;  1PS1 A;  3PYB A;  1VG7 A;  3OYR A;  3P5P A;  2Q58 A;  3N6K F;  4PVY F;  5EAT A;  3WCA A;  1N22 A;  3LOM A;  3RYE A;  3ICN A;  4H5C F;  4JVJ F;  4PVX F;  5DHK A;  5EAS A;  1KIZ A;  3TFP A;  3V66 A;  5IK0 A;  5B0K A;  3N49 F;  5IK6 A;  4LOB A;  2PS8 A;  4RXA A;  3WCF A;  5CG6 A;  3CKE A;  3EGT A;  5I1U A;  2ZCS A;  2PS4 A;  3PH7 A;  4MC8 A;  4EA2 A;  5ILI A;  3VJB A;  3PKO A;  4EA1 A;  5IVG A;  3ID0 A;  3ICK A;  2J1O A;  3ACW A;  3N3D A;  3KB9 A;  3QKC A;  3SDV A;  3PDE A;  4KWD A;  2OPN A;  3S9V A;  4DEM F;  3V1V A;  1V4J A;  2ZEV A;  3WEG A;  4OMH A;  3ACX A;  1VG3 A;  4KFA A;  4FJQ A;  3VJA A;  5B01 A;  5B0L A;  2E4O A;  1YHK A;  1V4I A;  1WKZ A;  3LDW A;  5DJV F;  4KPJ A;  4LZ3 A;  5ERM A;  3LZ9 A;  2AZJ A;  4FP4 A;  2PS5 A;  4K10 A;  1HXC A;  1RQI A;  4DHD A;  4LXW A;  1YYQ A;  1WL0 A;  1WMW A;  4KQU A;  5E8K A;  4GP2 A;  4KUX A;  3SDQ A;  1V4E A;  2OA6 A;  4P0X A;  5B02 A;  5DW7 A;  3N1V F;  3VJE A;  4QXS F;  3MAV A;  3MZV A;  3W7F A;  2DH4 A;  1V4H A;  5DGN F;  3G4F A;  3WJN A;  1FPS A;  5DZ2 A;  4NFJ F;  5B00 A;  4F62 A;  5DGM F;  2ZCR A;  3Q2Q A;  4LFV F;  3TS7 A;  4DI5 A;  2PS7 A;  5EAU A;  1VG2 A;  2Z78 A;  5IN8 A;  3RBM A;  5DJR F;  5HN8 A;  2E8T A;  2J5C A;  4NKF A;  3TFV A;  3RMG A;  3Q2Z A;  4RXC A;  5E8L A;  2Z4W A;  3WE9 A;  3N3L F;  1YHL A;  2E91 A;  4LIX A;  3KRA A;  3DYF A;  4KVY A;  2FOR A;  1N1B A;  2AZL A;  1UBV A;  5DHI A;  4DXJ A;  3NRI A;  3WCL A;  3ZMB A;  1N21 A;  5ILK A;  3CC9 A;  4NFI F;  4RXE A;  3N0F A;  5DJP F;  2I19 A;  1UBY A;  2Z50 A;  2F92 F;  2J1P A;  3N5H F;  3LK5 A;  4KQS A;  2Z4Y A;  3KRP A;  3UCA A;  4F6V A;  3EZ3 A;  4E1E A;  5AEL A;  4KQ5 A;  3NF2 A;  2OPM A;  2Z52 A;  4N9U A;  2E8W A;  2Z4V A;  3OAC B;  3WCE A;  1YYR A;  4KVI A;  3TFN A;  5HN7 A;  3WEH A;  4P0V A;  3PYA A;  3N46 F;  4DWB A;  3WCM A;  3WEI A;  4F6X A;  2AET A;  3NPR A;  5B0J A;  2Z7I A;  3KRF A;  5IL8 A;  4RNQ A;  5IKA A;  3P5R A;  4H5D F;  3LGK A;  4JYX A;  4RYP A;  5ILZ A;  5ERO A;  2E8U A;  2ZY1 A;  3WCJ A;  3AQB B;  4OKZ A;  1HXG A;  1EZF A;  2E8X A;  3M0G A;  3V1X A;  1WL2 A;  3B7L A;  5CG5 A;  3ZOU A;  3LLW A;  2Q9Z A;  2ONG A;  1N1Z A;  4NG6 A;  5B03 A;  4P0W A;  3Q1O A;  3SDU A;  4JZX A;  3WCB A;  3P41 A;  4MC0 A;  3EFQ A;  2Z4Z A;  4JXY A;  5ILD A;  5IMN A;  2E92 A;  3M00 A;  5IM1 A;  5JV1 F;  4NFK F;  3KRC A;  4LLT A;  5IK9 A;  4Q23 A;  2Q80 A;  1N23 A;  5AHU B;  3Q30 A;  4KVW A;  2ZCQ A;  4KVD A;  3KRO B;  5JA0 F;  3N0G A;  3M02 A;  3WJK A;  4GAX A;  5DGS F;  2F8C F;  4H5E F;  4LZ0 A;  3LSN A;  3WEK A;  3TC1 A;  3ICZ A;  3SAE A;  2F8Z F;  3ZCD A;  5HNA A;  3KBK A;  5A0I A;  5JUZ F;  4OGU A;  3M01 A;  4LFG A;  3AQC B;  3OAB A;  2Q9Y A;  3KRA B;  4N1Z F;  3S4J A;  4MC3 A;  5HN9 A;  3WCC A;  1HX9 A;  2E94 A;  1ZW5 A;  3AQ0 A;  3NPK A;  4GA3 A;  4XQS F;  3ICM A;  5KSX F;  4KKM A;  4LZC A;  3RYW A;  3N5J F;  1YV5 A;  2E95 A;  5ILJ A;  3ZMC A;  2AEL A;  1DI1 A;  2AEK A;  3VJ8 A;  3LEE A;  5ERN A;  2E8V A;  3KRP B;  5A0J A;  5AYP A;  3WSB A;  5B0M A;  3M9U A;  1N20 A;  2VF6 A;  3VJC A;  1UBW A;  4KK2 A;  2E93 A; 
#chains in the Genus database with same CATH topology
 3WSA A;  3BNX A;  4UMJ A;  4LLS A;  3WCG A;  2E90 A;  3P8R A;  1HXA A;  5JV0 F;  5ER8 A;  4OMG A;  5A0K A;  3IPI A;  3SDT A;  4GP1 A;  4LFE A;  4XQT F;  4WK5 A;  1YQ7 A;  3N45 F;  1YHM A;  1YJ4 A;  1VG4 A;  3BNY A;  2ONH A;  2PS6 A;  2RAH A;  3DYH A;  3APZ A;  3WCI A;  3KRF B;  4DWG A;  5AFX A;  4JZB A;  5IKH A;  2O1O A;  3LGZ B;  3OAC A;  1DGP A;  3WEJ A;  3AE0 A;  1JFA A;  3ACY A;  4ZQ8 A;  5ILH A;  4E9Z A;  1HM7 A;  5ILY A;  4LTZ A;  1WL3 A;  2H8O A;  3ZL6 A;  2F94 F;  3IBA A;  4RXD A;  2QIS A;  2ZEU A;  3SDR A;  1YYU A;  3G4D A;  2P1C A;  2AZK A;  3LG5 A;  4NUA A;  1KIY A;  4NKE A;  5DIQ F;  3DYG A;  5JV2 F;  1WY0 A;  3KRC B;  3LMD A;  4LTV A;  4XQR F;  4JXN A;  1JFG A;  5IL3 A;  2F9K F;  4L2X F;  2Z4X A;  4LPH F;  3LJI A;  2OGD A;  3WEF A;  1VG6 A;  1HM4 A;  4LUU A;  2Z7H A;  4LPG F;  2F7M F;  3P8L A;  3LVS A;  1UBX A;  4OKM A;  3WC9 A;  1V4K A;  4LA6 A;  3WCH A;  3ADZ A;  1RTR A;  5IMP A;  5E8H A;  4QPF A;  1WL1 A;  3OAB B;  3KRO A;  2F89 F;  3N1W F;  4KPD A;  3VJ9 A;  2EWG A;  4E9U A;  3QQV A;  4DZW A;  3WJO A;  4LA5 A;  3ASX A;  1RQJ A;  3CP6 A;  5H9D A;  5C05 A;  3WCD A;  1N24 A;  1YYT A;  3VJD A;  2ZCO A;  5IMI A;  5B0I A;  4EA0 A;  2FTZ A;  1YYS A;  4HD1 A;  1PS1 A;  3PYB A;  1VG7 A;  3OYR A;  3P5P A;  2Q58 A;  3N6K F;  4PVY F;  5EAT A;  3WCA A;  1N22 A;  3LOM A;  3RYE A;  3ICN A;  4H5C F;  4JVJ F;  4PVX F;  5DHK A;  5EAS A;  1KIZ A;  3TFP A;  3V66 A;  5IK0 A;  5B0K A;  3N49 F;  5IK6 A;  4LOB A;  2PS8 A;  4RXA A;  3WCF A;  5CG6 A;  3CKE A;  3EGT A;  5I1U A;  2ZCS A;  2PS4 A;  3PH7 A;  4MC8 A;  4EA2 A;  5ILI A;  3VJB A;  3PKO A;  4EA1 A;  5IVG A;  3ID0 A;  3ICK A;  2J1O A;  3ACW A;  3N3D A;  3KB9 A;  3QKC A;  3SDV A;  3PDE A;  4KWD A;  2OPN A;  3S9V A;  4DEM F;  3V1V A;  1V4J A;  2ZEV A;  3WEG A;  4OMH A;  3ACX A;  1VG3 A;  4KFA A;  4FJQ A;  3VJA A;  5B01 A;  5B0L A;  2E4O A;  1YHK A;  1V4I A;  1WKZ A;  3LDW A;  5DJV F;  4KPJ A;  4LZ3 A;  5ERM A;  3LZ9 A;  2AZJ A;  4FP4 A;  2PS5 A;  4K10 A;  1HXC A;  1RQI A;  4DHD A;  4LXW A;  1YYQ A;  1WL0 A;  1WMW A;  4KQU A;  5E8K A;  4GP2 A;  4KUX A;  3SDQ A;  1V4E A;  2OA6 A;  4P0X A;  5B02 A;  5DW7 A;  3N1V F;  3VJE A;  4QXS F;  3MAV A;  3MZV A;  3W7F A;  2DH4 A;  1V4H A;  5DGN F;  3G4F A;  3WJN A;  1FPS A;  5DZ2 A;  4NFJ F;  5B00 A;  4F62 A;  5DGM F;  2ZCR A;  3Q2Q A;  4LFV F;  3TS7 A;  4DI5 A;  2PS7 A;  5EAU A;  1VG2 A;  2Z78 A;  5IN8 A;  3RBM A;  5DJR F;  5HN8 A;  2E8T A;  2J5C A;  4NKF A;  3TFV A;  3RMG A;  3Q2Z A;  4RXC A;  5E8L A;  2Z4W A;  3WE9 A;  3N3L F;  1YHL A;  2E91 A;  4LIX A;  3KRA A;  3DYF A;  4KVY A;  2FOR A;  1N1B A;  2AZL A;  1UBV A;  5DHI A;  4DXJ A;  3NRI A;  3WCL A;  3ZMB A;  1N21 A;  5ILK A;  3CC9 A;  4NFI F;  4RXE A;  3N0F A;  5DJP F;  2I19 A;  1UBY A;  2Z50 A;  2F92 F;  2J1P A;  3N5H F;  3LK5 A;  4KQS A;  2Z4Y A;  3KRP A;  3UCA A;  4F6V A;  3EZ3 A;  4E1E A;  5AEL A;  4KQ5 A;  3NF2 A;  2OPM A;  2Z52 A;  4N9U A;  2E8W A;  2Z4V A;  3OAC B;  3WCE A;  1YYR A;  4KVI A;  3TFN A;  5HN7 A;  3WEH A;  4P0V A;  3PYA A;  3N46 F;  4DWB A;  3WCM A;  3WEI A;  4F6X A;  2AET A;  3NPR A;  5B0J A;  2Z7I A;  3KRF A;  5IL8 A;  4RNQ A;  5IKA A;  3P5R A;  4H5D F;  3LGK A;  4JYX A;  4RYP A;  5ILZ A;  5ERO A;  2E8U A;  2ZY1 A;  3WCJ A;  3AQB B;  4OKZ A;  1HXG A;  1EZF A;  2E8X A;  3M0G A;  3V1X A;  1WL2 A;  3B7L A;  5CG5 A;  3ZOU A;  3LLW A;  2Q9Z A;  2ONG A;  1N1Z A;  4NG6 A;  5B03 A;  4P0W A;  3Q1O A;  3SDU A;  4JZX A;  3WCB A;  3P41 A;  4MC0 A;  3EFQ A;  2Z4Z A;  4JXY A;  5ILD A;  5IMN A;  2E92 A;  3M00 A;  5IM1 A;  5JV1 F;  4NFK F;  3KRC A;  4LLT A;  5IK9 A;  4Q23 A;  2Q80 A;  1N23 A;  5AHU B;  3Q30 A;  4KVW A;  2ZCQ A;  4KVD A;  3KRO B;  5JA0 F;  3N0G A;  3M02 A;  3WJK A;  4GAX A;  5DGS F;  2F8C F;  4H5E F;  4LZ0 A;  3LSN A;  3WEK A;  3TC1 A;  3ICZ A;  3SAE A;  2F8Z F;  3ZCD A;  5HNA A;  3KBK A;  5A0I A;  5JUZ F;  4OGU A;  3M01 A;  4LFG A;  3AQC B;  3OAB A;  2Q9Y A;  3KRA B;  4N1Z F;  3S4J A;  4MC3 A;  5HN9 A;  3WCC A;  1HX9 A;  2E94 A;  1ZW5 A;  3AQ0 A;  3NPK A;  4GA3 A;  4XQS F;  3ICM A;  5KSX F;  4KKM A;  4LZC A;  3RYW A;  3N5J F;  1YV5 A;  2E95 A;  5ILJ A;  3ZMC A;  2AEL A;  1DI1 A;  2AEK A;  3VJ8 A;  3LEE A;  5ERN A;  2E8V A;  3KRP B;  5A0J A;  5AYP A;  3WSB A;  5B0M A;  3M9U A;  1N20 A;  2VF6 A;  3VJC A;  1UBW A;  4KK2 A;  2E93 A; 
#chains in the Genus database with same CATH homology
 3WSA A;  3BNX A;  4UMJ A;  4LLS A;  3WCG A;  2E90 A;  3P8R A;  1HXA A;  5JV0 F;  5ER8 A;  4OMG A;  5A0K A;  3IPI A;  3SDT A;  4GP1 A;  4LFE A;  4XQT F;  4WK5 A;  1YQ7 A;  3N45 F;  1YHM A;  1YJ4 A;  1VG4 A;  3BNY A;  2ONH A;  2PS6 A;  2RAH A;  3DYH A;  3APZ A;  3WCI A;  3KRF B;  4DWG A;  5AFX A;  4JZB A;  5IKH A;  2O1O A;  3LGZ B;  3OAC A;  1DGP A;  3WEJ A;  3AE0 A;  1JFA A;  3ACY A;  4ZQ8 A;  5ILH A;  4E9Z A;  1HM7 A;  5ILY A;  4LTZ A;  1WL3 A;  2H8O A;  3ZL6 A;  2F94 F;  3IBA A;  4RXD A;  2QIS A;  2ZEU A;  3SDR A;  1YYU A;  3G4D A;  2P1C A;  2AZK A;  3LG5 A;  4NUA A;  1KIY A;  4NKE A;  5DIQ F;  3DYG A;  5JV2 F;  1WY0 A;  3KRC B;  3LMD A;  4LTV A;  4XQR F;  4JXN A;  1JFG A;  5IL3 A;  2F9K F;  4L2X F;  2Z4X A;  4LPH F;  3LJI A;  2OGD A;  3WEF A;  1VG6 A;  1HM4 A;  4LUU A;  2Z7H A;  4LPG F;  2F7M F;  3P8L A;  3LVS A;  1UBX A;  4OKM A;  3WC9 A;  1V4K A;  4LA6 A;  3WCH A;  3ADZ A;  1RTR A;  5IMP A;  5E8H A;  4QPF A;  1WL1 A;  3OAB B;  3KRO A;  2F89 F;  3N1W F;  4KPD A;  3VJ9 A;  2EWG A;  4E9U A;  3QQV A;  4DZW A;  3WJO A;  4LA5 A;  3ASX A;  1RQJ A;  3CP6 A;  5H9D A;  5C05 A;  3WCD A;  1N24 A;  1YYT A;  3VJD A;  2ZCO A;  5IMI A;  5B0I A;  4EA0 A;  2FTZ A;  1YYS A;  4HD1 A;  1PS1 A;  3PYB A;  1VG7 A;  3OYR A;  3P5P A;  2Q58 A;  3N6K F;  4PVY F;  5EAT A;  3WCA A;  1N22 A;  3LOM A;  3RYE A;  3ICN A;  4H5C F;  4JVJ F;  4PVX F;  5DHK A;  5EAS A;  1KIZ A;  3TFP A;  3V66 A;  5IK0 A;  5B0K A;  3N49 F;  5IK6 A;  4LOB A;  2PS8 A;  4RXA A;  3WCF A;  5CG6 A;  3CKE A;  3EGT A;  5I1U A;  2ZCS A;  2PS4 A;  3PH7 A;  4MC8 A;  4EA2 A;  5ILI A;  3VJB A;  3PKO A;  4EA1 A;  5IVG A;  3ID0 A;  3ICK A;  2J1O A;  3ACW A;  3N3D A;  3KB9 A;  3QKC A;  3SDV A;  3PDE A;  4KWD A;  2OPN A;  3S9V A;  4DEM F;  3V1V A;  1V4J A;  2ZEV A;  3WEG A;  4OMH A;  3ACX A;  1VG3 A;  4KFA A;  4FJQ A;  3VJA A;  5B01 A;  5B0L A;  2E4O A;  1YHK A;  1V4I A;  1WKZ A;  3LDW A;  5DJV F;  4KPJ A;  4LZ3 A;  5ERM A;  3LZ9 A;  2AZJ A;  4FP4 A;  2PS5 A;  4K10 A;  1HXC A;  1RQI A;  4DHD A;  4LXW A;  1YYQ A;  1WL0 A;  1WMW A;  4KQU A;  5E8K A;  4GP2 A;  4KUX A;  3SDQ A;  1V4E A;  2OA6 A;  4P0X A;  5B02 A;  5DW7 A;  3N1V F;  3VJE A;  4QXS F;  3MAV A;  3MZV A;  3W7F A;  2DH4 A;  1V4H A;  5DGN F;  3G4F A;  3WJN A;  1FPS A;  5DZ2 A;  4NFJ F;  5B00 A;  4F62 A;  5DGM F;  2ZCR A;  3Q2Q A;  4LFV F;  3TS7 A;  4DI5 A;  2PS7 A;  5EAU A;  1VG2 A;  2Z78 A;  5IN8 A;  3RBM A;  5DJR F;  5HN8 A;  2E8T A;  2J5C A;  4NKF A;  3TFV A;  3RMG A;  3Q2Z A;  4RXC A;  5E8L A;  2Z4W A;  3WE9 A;  3N3L F;  1YHL A;  2E91 A;  4LIX A;  3KRA A;  3DYF A;  4KVY A;  2FOR A;  1N1B A;  2AZL A;  1UBV A;  5DHI A;  4DXJ A;  3NRI A;  3WCL A;  3ZMB A;  1N21 A;  5ILK A;  3CC9 A;  4NFI F;  4RXE A;  3N0F A;  5DJP F;  2I19 A;  1UBY A;  2Z50 A;  2F92 F;  2J1P A;  3N5H F;  3LK5 A;  4KQS A;  2Z4Y A;  3KRP A;  3UCA A;  4F6V A;  3EZ3 A;  4E1E A;  5AEL A;  4KQ5 A;  3NF2 A;  2OPM A;  2Z52 A;  4N9U A;  2E8W A;  2Z4V A;  3OAC B;  3WCE A;  1YYR A;  4KVI A;  3TFN A;  5HN7 A;  3WEH A;  4P0V A;  3PYA A;  3N46 F;  4DWB A;  3WCM A;  3WEI A;  4F6X A;  2AET A;  3NPR A;  5B0J A;  2Z7I A;  3KRF A;  5IL8 A;  4RNQ A;  5IKA A;  3P5R A;  4H5D F;  3LGK A;  4JYX A;  4RYP A;  5ILZ A;  5ERO A;  2E8U A;  2ZY1 A;  3WCJ A;  3AQB B;  4OKZ A;  1HXG A;  1EZF A;  2E8X A;  3M0G A;  3V1X A;  1WL2 A;  3B7L A;  5CG5 A;  3ZOU A;  3LLW A;  2Q9Z A;  2ONG A;  1N1Z A;  4NG6 A;  5B03 A;  4P0W A;  3Q1O A;  3SDU A;  4JZX A;  3WCB A;  3P41 A;  4MC0 A;  3EFQ A;  2Z4Z A;  4JXY A;  5ILD A;  5IMN A;  2E92 A;  3M00 A;  5IM1 A;  5JV1 F;  4NFK F;  3KRC A;  4LLT A;  5IK9 A;  4Q23 A;  2Q80 A;  1N23 A;  5AHU B;  3Q30 A;  4KVW A;  2ZCQ A;  4KVD A;  3KRO B;  5JA0 F;  3N0G A;  3M02 A;  3WJK A;  4GAX A;  5DGS F;  2F8C F;  4H5E F;  4LZ0 A;  3LSN A;  3WEK A;  3TC1 A;  3ICZ A;  3SAE A;  2F8Z F;  3ZCD A;  5HNA A;  3KBK A;  5A0I A;  5JUZ F;  4OGU A;  3M01 A;  4LFG A;  3AQC B;  3OAB A;  2Q9Y A;  3KRA B;  4N1Z F;  3S4J A;  4MC3 A;  5HN9 A;  3WCC A;  1HX9 A;  2E94 A;  1ZW5 A;  3AQ0 A;  3NPK A;  4GA3 A;  4XQS F;  3ICM A;  5KSX F;  4KKM A;  4LZC A;  3RYW A;  3N5J F;  1YV5 A;  2E95 A;  5ILJ A;  3ZMC A;  2AEL A;  1DI1 A;  2AEK A;  3VJ8 A;  3LEE A;  5ERN A;  2E8V A;  3KRP B;  5A0J A;  5AYP A;  3WSB A;  5B0M A;  3M9U A;  1N20 A;  2VF6 A;  3VJC A;  1UBW A;  4KK2 A;  2E93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...