4RXCA

T. brucei farnesyl diphosphate synthase complexed with homorisedronate bph-6
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
365
structure length
351
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPRLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyl pyrophosphate synthase
publication title Farnesyl diphosphate synthase inhibitors with unique ligand-binding geometries.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 140
structure length 351
sequence length 365
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4rxcA00
4L2XF 2OPNA 5ILDA 1HXAA 2PS6A 3P8RA 1V4JA 4LLTA 5AELA 3KRCB 2E8UA 3N3LF 1N21A 1VG3A 5JV0F 4F6VA 2F8CF 4RXDA 3RYEA 3KRFB 3N1WF 3NPRA 5DJRF 3LK5A 1YHKA 3ID0A 4KVDA 4F6XA 2H8OA 4EA0A 3N0GA 4KPJA 3WEGA 1RTRA 1V4HA 2Z4WA 3PYAA 4EA1A 3LOMA 3UCAA 2E92A 2PS5A 1YQ7A 3VJBA 3P5RA 3S9VA 4WK5A 3DYFA 5ILJA 2Q9YA 1V4IA 1DI1A 3Q1OA 4EA2A 2OPMA 4JZXA 3LEEA 3LLWA 3M00A 2Z52A 2J1PA 3AQBB 2AELA 4KQUA 4QXSF 5DGNF 3ACXA 3N5JF 3QKCA 5DGMF 3AQCB 3B7LA 2ONGA 3SDTA 4LTZA 5DHKA 4KPDA 3SDVA 3ICNA 1UBYA 3V1XA 4GP2A 4FJQA 1HXCA 4KVYA 1N23A 3ADZA 2DH4A 3CKEA 1YYSA 1UBWA 2Z50A 3LGZB 2ZEUA 3N46F 4LFVF 2E8VA 1YHMA 2F92F 4RXEA 2VF6A 1N24A 3VJAA 3ACWA 4E1EA 4E9UA 3WSAA 3VJ8A 3VJCA 3LSNA 2PS7A 3SDQA 5CG5A 2Q9ZA 3EFQA 5I1UA 1N20A 3N1VF 5EATA 5CG6A 4LLSA 2Z4XA 3ZL6A 3M01A 1PS1A 5DHIA 4DWBA 3WCBA 3ICZA 2FORA 4XQRF 5EAUA 1YYQA 5IM1A 4JYXA 3PH7A 1ZW5A 2AETA 4RXCA 5IKAA 3KROA 1UBXA 4MC0A 2E94A 3DYHA 2OGDA 4F62A 4LZ0A 4Q23A 1JFAA 5ERMA 2ZCOA 4OMHA 4LA6A 5JV2F 1HM4A 2RAHA 2Z4VA 4LZCA 4NFKF 5IMNA 2ZEVA 1YYTA 5IKHA 4LOBA 3WJKA 5B0IA 1VG2A 4GA3A 1HM7A 3SDRA 5HNAA 3CC9A 2E8XA 3V1VA 4DXJA 5AHUB 3SDUA 5IL8A 1VG7A 1WMWA 3NF2A 5IN8A 3WCDA 5AYPA 2Z4YA 3LDWA 4PVYF 3WCGA 3BNYA 5B00A 2E91A 5DIQF 1WY0A 5A0KA 4PVXF 3PKOA 4H5EF 5JV1F 3PDEA 3OACA 4NFJF 3WEIA 4MC3A 5DGSF 2E8TA 4P0VA 4UMJA 2F8ZF 5KSXF 1N1ZA 5IK0A 1WL2A 5EROA 4OGUA 1KIZA 3P8LA 4KWDA 3LG5A 3WC9A 4P0WA 4RYPA 3KBKA 1WKZA 4HD1A 4NG6A 3WJOA 2AEKA 4K10A 5ILKA 3AQ0A 4KVIA 1WL3A 2Z7HA 3BNXA 3NPKA 2E8WA 5B0KA 1YJ4A 2E4OA 3ACYA 4XQTF 3WCLA 4LTVA 5ERNA 3Q2QA 3N49F 4LFEA 1HXGA 2ZY1A 2O1OA 5DJVF 3OACB 2PS4A 1RQJA 4LA5A 3W7FA 5C05A 3N5HF 5A0JA 4XQSF 4FP4A 4JZBA 5H9DA 3LGKA 4KFAA 5B0MA 4KQSA 3IPIA 5B03A 5E8KA 4KKMA 5IK9A 5A0IA 3EGTA 1DGPA 3SAEA 3VJEA 3N6KF 2F7MF 4H5CF 3ZOUA 4LIXA 5IMIA 3TC1A 3WJNA 3CP6A 3LZ9A 5HN7A 5DJPF 3ICKA 3V66A 2QISA 3VJ9A 3WCFA 4KK2A 4OMGA 3MZVA 3LMDA 5B02A 1V4EA 3ZMBA 3OABA 3WCEA 4KUXA 4LPGF 2AZJA 3WCAA 3ZCDA 5IL3A 3IBAA 4KQ5A 3N3DA 5E8HA 4P0XA 3ICMA 4E9ZA 1FPSA 2OA6A 3DYGA 2FTZA 3KROB 3RBMA 1WL0A 4RXAA 1VG6A 1VG4A 3M02A 3KRAA 2E90A 5IVGA 4LFGA 1EZFA 3WEFA 3QQVA 4H5DF 2PS8A 3Q2ZA 1WL1A 3M9UA 4LXWA 2ZCRA 2Q58A 2ONHA 2F89F 5DZ2A 3PYBA 3MAVA 4KVWA 3OABB 2Z78A 4N9UA 4NUAA 3ZMCA 4LUUA 3WCMA 3WSBA 5ER8A 1N1BA 3TFVA 1KIYA 3OYRA 2EWGA 2E93A 1YHLA 1JFGA 4GAXA 4DEMF 5B0JA 1YYUA 3TFNA 3NRIA 4NKFA 5AFXA 1UBVA 2F9KF 2ZCSA 3KRPA 3WEHA 4JXYA 2J1OA 4LPHF 3KRAB 2J5CA 3P5PA 4ZQ8A 5DW7A 3G4FA 3TFPA 3WE9A 2Z7IA 5HN8A 5ILYA 5JUZF 3WCIA 4JXNA 5HN9A 3N45F 4NFIF 5IK6A 3RMGA 3P41A 4DI5A 2Q80A 5JA0F 3G4DA 3WEJA 2I19A 4DHDA 3WCHA 3KB9A 2Z4ZA 1V4KA 3TS7A 4DWGA 1HX9A 4LZ3A 3AE0A 4DZWA 3RYWA 3S4JA 3VJDA 4QPFA 2AZLA 5IMPA 3ASXA 5ILZA 3KRCA 3N0FA 1YV5A 3M0GA 3LJIA 3WEKA 3KRPB 4OKMA 3KRFA 4GP1A 3WCJA 2AZKA 3EZ3A 1YYRA 4MC8A 3Q30A 5B01A 4N1ZF 5E8LA 5ILHA 1N22A 2F94F 5ILIA 2P1CA 3APZA 5EASA 2ZCQA 4JVJF 1RQIA 3LVSA 2E95A 4OKZA 3WCCA 4RNQA 5B0LA 4NKEA
chains in the Genus database with same CATH superfamily
4L2XF 2OPNA 5ILDA 1HXAA 2PS6A 3P8RA 1V4JA 4LLTA 5AELA 3KRCB 2E8UA 3N3LF 1N21A 1VG3A 5JV0F 4F6VA 2F8CF 4RXDA 3RYEA 3KRFB 3N1WF 3NPRA 5DJRF 3LK5A 1YHKA 3ID0A 4KVDA 4F6XA 2H8OA 4EA0A 3N0GA 4KPJA 3WEGA 1RTRA 1V4HA 2Z4WA 3PYAA 4EA1A 3LOMA 3UCAA 2E92A 2PS5A 1YQ7A 3VJBA 3P5RA 3S9VA 4WK5A 3DYFA 5ILJA 2Q9YA 1V4IA 1DI1A 3Q1OA 4EA2A 2OPMA 4JZXA 3LEEA 3LLWA 3M00A 2Z52A 2J1PA 3AQBB 2AELA 4KQUA 4QXSF 5DGNF 3ACXA 3N5JF 3QKCA 5DGMF 3AQCB 3B7LA 2ONGA 3SDTA 4LTZA 5DHKA 4KPDA 3SDVA 3ICNA 1UBYA 3V1XA 4GP2A 4FJQA 1HXCA 4KVYA 1N23A 3ADZA 2DH4A 3CKEA 1YYSA 1UBWA 2Z50A 3LGZB 2ZEUA 3N46F 4LFVF 2E8VA 1YHMA 2F92F 4RXEA 2VF6A 1N24A 3VJAA 3ACWA 4E1EA 4E9UA 3WSAA 3VJ8A 3VJCA 3LSNA 2PS7A 3SDQA 5CG5A 2Q9ZA 3EFQA 5I1UA 1N20A 3N1VF 5EATA 5CG6A 4LLSA 2Z4XA 3ZL6A 3M01A 1PS1A 5DHIA 4DWBA 3WCBA 3ICZA 2FORA 4XQRF 5EAUA 1YYQA 5IM1A 4JYXA 3PH7A 1ZW5A 2AETA 4RXCA 5IKAA 3KROA 1UBXA 4MC0A 2E94A 3DYHA 2OGDA 4F62A 4LZ0A 4Q23A 1JFAA 5ERMA 2ZCOA 4OMHA 4LA6A 5JV2F 1HM4A 2RAHA 2Z4VA 4LZCA 4NFKF 5IMNA 2ZEVA 1YYTA 5IKHA 4LOBA 3WJKA 5B0IA 1VG2A 4GA3A 1HM7A 3SDRA 5HNAA 3CC9A 2E8XA 3V1VA 4DXJA 5AHUB 3SDUA 5IL8A 1VG7A 1WMWA 3NF2A 5IN8A 3WCDA 5AYPA 2Z4YA 3LDWA 4PVYF 3WCGA 3BNYA 5B00A 2E91A 5DIQF 1WY0A 5A0KA 4PVXF 3PKOA 4H5EF 5JV1F 3PDEA 3OACA 4NFJF 3WEIA 4MC3A 5DGSF 2E8TA 4P0VA 4UMJA 2F8ZF 5KSXF 1N1ZA 5IK0A 1WL2A 5EROA 4OGUA 1KIZA 3P8LA 4KWDA 3LG5A 3WC9A 4P0WA 4RYPA 3KBKA 1WKZA 4HD1A 4NG6A 3WJOA 2AEKA 4K10A 5ILKA 3AQ0A 4KVIA 1WL3A 2Z7HA 3BNXA 3NPKA 2E8WA 5B0KA 1YJ4A 2E4OA 3ACYA 4XQTF 3WCLA 4LTVA 5ERNA 3Q2QA 3N49F 4LFEA 1HXGA 2ZY1A 2O1OA 5DJVF 3OACB 2PS4A 1RQJA 4LA5A 3W7FA 5C05A 3N5HF 5A0JA 4XQSF 4FP4A 4JZBA 5H9DA 3LGKA 4KFAA 5B0MA 4KQSA 3IPIA 5B03A 5E8KA 4KKMA 5IK9A 5A0IA 3EGTA 1DGPA 3SAEA 3VJEA 3N6KF 2F7MF 4H5CF 3ZOUA 4LIXA 5IMIA 3TC1A 3WJNA 3CP6A 3LZ9A 5HN7A 5DJPF 3ICKA 3V66A 2QISA 3VJ9A 3WCFA 4KK2A 4OMGA 3MZVA 3LMDA 5B02A 1V4EA 3ZMBA 3OABA 3WCEA 4KUXA 4LPGF 2AZJA 3WCAA 3ZCDA 5IL3A 3IBAA 4KQ5A 3N3DA 5E8HA 4P0XA 3ICMA 4E9ZA 1FPSA 2OA6A 3DYGA 2FTZA 3KROB 3RBMA 1WL0A 4RXAA 1VG6A 1VG4A 3M02A 3KRAA 2E90A 5IVGA 4LFGA 1EZFA 3WEFA 3QQVA 4H5DF 2PS8A 3Q2ZA 1WL1A 3M9UA 4LXWA 2ZCRA 2Q58A 2ONHA 2F89F 5DZ2A 3PYBA 3MAVA 4KVWA 3OABB 2Z78A 4N9UA 4NUAA 3ZMCA 4LUUA 3WCMA 3WSBA 5ER8A 1N1BA 3TFVA 1KIYA 3OYRA 2EWGA 2E93A 1YHLA 1JFGA 4GAXA 4DEMF 5B0JA 1YYUA 3TFNA 3NRIA 4NKFA 5AFXA 1UBVA 2F9KF 2ZCSA 3KRPA 3WEHA 4JXYA 2J1OA 4LPHF 3KRAB 2J5CA 3P5PA 4ZQ8A 5DW7A 3G4FA 3TFPA 3WE9A 2Z7IA 5HN8A 5ILYA 5JUZF 3WCIA 4JXNA 5HN9A 3N45F 4NFIF 5IK6A 3RMGA 3P41A 4DI5A 2Q80A 5JA0F 3G4DA 3WEJA 2I19A 4DHDA 3WCHA 3KB9A 2Z4ZA 1V4KA 3TS7A 4DWGA 1HX9A 4LZ3A 3AE0A 4DZWA 3RYWA 3S4JA 3VJDA 4QPFA 2AZLA 5IMPA 3ASXA 5ILZA 3KRCA 3N0FA 1YV5A 3M0GA 3LJIA 3WEKA 3KRPB 4OKMA 3KRFA 4GP1A 3WCJA 2AZKA 3EZ3A 1YYRA 4MC8A 3Q30A 5B01A 4N1ZF 5E8LA 5ILHA 1N22A 2F94F 5ILIA 2P1CA 3APZA 5EASA 2ZCQA 4JVJF 1RQIA 3LVSA 2E95A 4OKZA 3WCCA 4RNQA 5B0LA 4NKEA
chains in the Genus database with same CATH topology
4L2XF 2OPNA 5ILDA 1HXAA 2PS6A 3P8RA 1V4JA 4LLTA 5AELA 3KRCB 2E8UA 3N3LF 1N21A 1VG3A 5JV0F 4F6VA 2F8CF 4RXDA 3RYEA 3KRFB 3N1WF 3NPRA 5DJRF 3LK5A 1YHKA 3ID0A 4KVDA 4F6XA 2H8OA 4EA0A 3N0GA 4KPJA 3WEGA 1RTRA 1V4HA 2Z4WA 3PYAA 4EA1A 3LOMA 3UCAA 2E92A 2PS5A 1YQ7A 3VJBA 3P5RA 3S9VA 4WK5A 3DYFA 5ILJA 2Q9YA 1V4IA 1DI1A 3Q1OA 4EA2A 2OPMA 4JZXA 3LEEA 3LLWA 3M00A 2Z52A 2J1PA 3AQBB 2AELA 4KQUA 4QXSF 5DGNF 3ACXA 3N5JF 3QKCA 5DGMF 3AQCB 3B7LA 2ONGA 3SDTA 4LTZA 5DHKA 4KPDA 3SDVA 3ICNA 1UBYA 3V1XA 4GP2A 4FJQA 1HXCA 4KVYA 1N23A 3ADZA 2DH4A 3CKEA 1YYSA 1UBWA 2Z50A 3LGZB 2ZEUA 3N46F 4LFVF 2E8VA 1YHMA 2F92F 4RXEA 2VF6A 1N24A 3VJAA 3ACWA 4E1EA 4E9UA 3WSAA 3VJ8A 3VJCA 3LSNA 2PS7A 3SDQA 5CG5A 2Q9ZA 3EFQA 5I1UA 1N20A 3N1VF 5EATA 5CG6A 4LLSA 2Z4XA 3ZL6A 3M01A 1PS1A 5DHIA 4DWBA 3WCBA 3ICZA 2FORA 4XQRF 5EAUA 1YYQA 5IM1A 4JYXA 3PH7A 1ZW5A 2AETA 4RXCA 5IKAA 3KROA 1UBXA 4MC0A 2E94A 3DYHA 2OGDA 4F62A 4LZ0A 4Q23A 1JFAA 5ERMA 2ZCOA 4OMHA 4LA6A 5JV2F 1HM4A 2RAHA 2Z4VA 4LZCA 4NFKF 5IMNA 2ZEVA 1YYTA 5IKHA 4LOBA 3WJKA 5B0IA 1VG2A 4GA3A 1HM7A 3SDRA 5HNAA 3CC9A 2E8XA 3V1VA 4DXJA 5AHUB 3SDUA 5IL8A 1VG7A 1WMWA 3NF2A 5IN8A 3WCDA 5AYPA 2Z4YA 3LDWA 4PVYF 3WCGA 3BNYA 5B00A 2E91A 5DIQF 1WY0A 5A0KA 4PVXF 3PKOA 4H5EF 5JV1F 3PDEA 3OACA 4NFJF 3WEIA 4MC3A 5DGSF 2E8TA 4P0VA 4UMJA 2F8ZF 5KSXF 1N1ZA 5IK0A 1WL2A 5EROA 4OGUA 1KIZA 3P8LA 4KWDA 3LG5A 3WC9A 4P0WA 4RYPA 3KBKA 1WKZA 4HD1A 4NG6A 3WJOA 2AEKA 4K10A 5ILKA 3AQ0A 4KVIA 1WL3A 2Z7HA 3BNXA 3NPKA 2E8WA 5B0KA 1YJ4A 2E4OA 3ACYA 4XQTF 3WCLA 4LTVA 5ERNA 3Q2QA 3N49F 4LFEA 1HXGA 2ZY1A 2O1OA 5DJVF 3OACB 2PS4A 1RQJA 4LA5A 3W7FA 5C05A 3N5HF 5A0JA 4XQSF 4FP4A 4JZBA 5H9DA 3LGKA 4KFAA 5B0MA 4KQSA 3IPIA 5B03A 5E8KA 4KKMA 5IK9A 5A0IA 3EGTA 1DGPA 3SAEA 3VJEA 3N6KF 2F7MF 4H5CF 3ZOUA 4LIXA 5IMIA 3TC1A 3WJNA 3CP6A 3LZ9A 5HN7A 5DJPF 3ICKA 3V66A 2QISA 3VJ9A 3WCFA 4KK2A 4OMGA 3MZVA 3LMDA 5B02A 1V4EA 3ZMBA 3OABA 3WCEA 4KUXA 4LPGF 2AZJA 3WCAA 3ZCDA 5IL3A 3IBAA 4KQ5A 3N3DA 5E8HA 4P0XA 3ICMA 4E9ZA 1FPSA 2OA6A 3DYGA 2FTZA 3KROB 3RBMA 1WL0A 4RXAA 1VG6A 1VG4A 3M02A 3KRAA 2E90A 5IVGA 4LFGA 1EZFA 3WEFA 3QQVA 4H5DF 2PS8A 3Q2ZA 1WL1A 3M9UA 4LXWA 2ZCRA 2Q58A 2ONHA 2F89F 5DZ2A 3PYBA 3MAVA 4KVWA 3OABB 2Z78A 4N9UA 4NUAA 3ZMCA 4LUUA 3WCMA 3WSBA 5ER8A 1N1BA 3TFVA 1KIYA 3OYRA 2EWGA 2E93A 1YHLA 1JFGA 4GAXA 4DEMF 5B0JA 1YYUA 3TFNA 3NRIA 4NKFA 5AFXA 1UBVA 2F9KF 2ZCSA 3KRPA 3WEHA 4JXYA 2J1OA 4LPHF 3KRAB 2J5CA 3P5PA 4ZQ8A 5DW7A 3G4FA 3TFPA 3WE9A 2Z7IA 5HN8A 5ILYA 5JUZF 3WCIA 4JXNA 5HN9A 3N45F 4NFIF 5IK6A 3RMGA 3P41A 4DI5A 2Q80A 5JA0F 3G4DA 3WEJA 2I19A 4DHDA 3WCHA 3KB9A 2Z4ZA 1V4KA 3TS7A 4DWGA 1HX9A 4LZ3A 3AE0A 4DZWA 3RYWA 3S4JA 3VJDA 4QPFA 2AZLA 5IMPA 3ASXA 5ILZA 3KRCA 3N0FA 1YV5A 3M0GA 3LJIA 3WEKA 3KRPB 4OKMA 3KRFA 4GP1A 3WCJA 2AZKA 3EZ3A 1YYRA 4MC8A 3Q30A 5B01A 4N1ZF 5E8LA 5ILHA 1N22A 2F94F 5ILIA 2P1CA 3APZA 5EASA 2ZCQA 4JVJF 1RQIA 3LVSA 2E95A 4OKZA 3WCCA 4RNQA 5B0LA 4NKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L2X F;  2OPN A;  5ILD A;  1HXA A;  2PS6 A;  3P8R A;  1V4J A;  4LLT A;  5AEL A;  3KRC B;  2E8U A;  3N3L F;  1N21 A;  1VG3 A;  5JV0 F;  4F6V A;  2F8C F;  4RXD A;  3RYE A;  3KRF B;  3N1W F;  3NPR A;  5DJR F;  3LK5 A;  1YHK A;  3ID0 A;  4KVD A;  4F6X A;  2H8O A;  4EA0 A;  3N0G A;  4KPJ A;  3WEG A;  1RTR A;  1V4H A;  2Z4W A;  3PYA A;  4EA1 A;  3LOM A;  3UCA A;  2E92 A;  2PS5 A;  1YQ7 A;  3VJB A;  3P5R A;  3S9V A;  4WK5 A;  3DYF A;  5ILJ A;  2Q9Y A;  1V4I A;  1DI1 A;  3Q1O A;  4EA2 A;  2OPM A;  4JZX A;  3LEE A;  3LLW A;  3M00 A;  2Z52 A;  2J1P A;  3AQB B;  2AEL A;  4KQU A;  4QXS F;  5DGN F;  3ACX A;  3N5J F;  3QKC A;  5DGM F;  3AQC B;  3B7L A;  2ONG A;  3SDT A;  4LTZ A;  5DHK A;  4KPD A;  3SDV A;  3ICN A;  1UBY A;  3V1X A;  4GP2 A;  4FJQ A;  1HXC A;  4KVY A;  1N23 A;  3ADZ A;  2DH4 A;  3CKE A;  1YYS A;  1UBW A;  2Z50 A;  3LGZ B;  2ZEU A;  3N46 F;  4LFV F;  2E8V A;  1YHM A;  2F92 F;  4RXE A;  2VF6 A;  1N24 A;  3VJA A;  3ACW A;  4E1E A;  4E9U A;  3WSA A;  3VJ8 A;  3VJC A;  3LSN A;  2PS7 A;  3SDQ A;  5CG5 A;  2Q9Z A;  3EFQ A;  5I1U A;  1N20 A;  3N1V F;  5EAT A;  5CG6 A;  4LLS A;  2Z4X A;  3ZL6 A;  3M01 A;  1PS1 A;  5DHI A;  4DWB A;  3WCB A;  3ICZ A;  2FOR A;  4XQR F;  5EAU A;  1YYQ A;  5IM1 A;  4JYX A;  3PH7 A;  1ZW5 A;  2AET A;  4RXC A;  5IKA A;  3KRO A;  1UBX A;  4MC0 A;  2E94 A;  3DYH A;  2OGD A;  4F62 A;  4LZ0 A;  4Q23 A;  1JFA A;  5ERM A;  2ZCO A;  4OMH A;  4LA6 A;  5JV2 F;  1HM4 A;  2RAH A;  2Z4V A;  4LZC A;  4NFK F;  5IMN A;  2ZEV A;  1YYT A;  5IKH A;  4LOB A;  3WJK A;  5B0I A;  1VG2 A;  4GA3 A;  1HM7 A;  3SDR A;  5HNA A;  3CC9 A;  2E8X A;  3V1V A;  4DXJ A;  5AHU B;  3SDU A;  5IL8 A;  1VG7 A;  1WMW A;  3NF2 A;  5IN8 A;  3WCD A;  5AYP A;  2Z4Y A;  3LDW A;  4PVY F;  3WCG A;  3BNY A;  5B00 A;  2E91 A;  5DIQ F;  1WY0 A;  5A0K A;  4PVX F;  3PKO A;  4H5E F;  5JV1 F;  3PDE A;  3OAC A;  4NFJ F;  3WEI A;  4MC3 A;  5DGS F;  2E8T A;  4P0V A;  4UMJ A;  2F8Z F;  5KSX F;  1N1Z A;  5IK0 A;  1WL2 A;  5ERO A;  4OGU A;  1KIZ A;  3P8L A;  4KWD A;  3LG5 A;  3WC9 A;  4P0W A;  4RYP A;  3KBK A;  1WKZ A;  4HD1 A;  4NG6 A;  3WJO A;  2AEK A;  4K10 A;  5ILK A;  3AQ0 A;  4KVI A;  1WL3 A;  2Z7H A;  3BNX A;  3NPK A;  2E8W A;  5B0K A;  1YJ4 A;  2E4O A;  3ACY A;  4XQT F;  3WCL A;  4LTV A;  5ERN A;  3Q2Q A;  3N49 F;  4LFE A;  1HXG A;  2ZY1 A;  2O1O A;  5DJV F;  3OAC B;  2PS4 A;  1RQJ A;  4LA5 A;  3W7F A;  5C05 A;  3N5H F;  5A0J A;  4XQS F;  4FP4 A;  4JZB A;  5H9D A;  3LGK A;  4KFA A;  5B0M A;  4KQS A;  3IPI A;  5B03 A;  5E8K A;  4KKM A;  5IK9 A;  5A0I A;  3EGT A;  1DGP A;  3SAE A;  3VJE A;  3N6K F;  2F7M F;  4H5C F;  3ZOU A;  4LIX A;  5IMI A;  3TC1 A;  3WJN A;  3CP6 A;  3LZ9 A;  5HN7 A;  5DJP F;  3ICK A;  3V66 A;  2QIS A;  3VJ9 A;  3WCF A;  4KK2 A;  4OMG A;  3MZV A;  3LMD A;  5B02 A;  1V4E A;  3ZMB A;  3OAB A;  3WCE A;  4KUX A;  4LPG F;  2AZJ A;  3WCA A;  3ZCD A;  5IL3 A;  3IBA A;  4KQ5 A;  3N3D A;  5E8H A;  4P0X A;  3ICM A;  4E9Z A;  1FPS A;  2OA6 A;  3DYG A;  2FTZ A;  3KRO B;  3RBM A;  1WL0 A;  4RXA A;  1VG6 A;  1VG4 A;  3M02 A;  3KRA A;  2E90 A;  5IVG A;  4LFG A;  1EZF A;  3WEF A;  3QQV A;  4H5D F;  2PS8 A;  3Q2Z A;  1WL1 A;  3M9U A;  4LXW A;  2ZCR A;  2Q58 A;  2ONH A;  2F89 F;  5DZ2 A;  3PYB A;  3MAV A;  4KVW A;  3OAB B;  2Z78 A;  4N9U A;  4NUA A;  3ZMC A;  4LUU A;  3WCM A;  3WSB A;  5ER8 A;  1N1B A;  3TFV A;  1KIY A;  3OYR A;  2EWG A;  2E93 A;  1YHL A;  1JFG A;  4GAX A;  4DEM F;  5B0J A;  1YYU A;  3TFN A;  3NRI A;  4NKF A;  5AFX A;  1UBV A;  2F9K F;  2ZCS A;  3KRP A;  3WEH A;  4JXY A;  2J1O A;  4LPH F;  3KRA B;  2J5C A;  3P5P A;  4ZQ8 A;  5DW7 A;  3G4F A;  3TFP A;  3WE9 A;  2Z7I A;  5HN8 A;  5ILY A;  5JUZ F;  3WCI A;  4JXN A;  5HN9 A;  3N45 F;  4NFI F;  5IK6 A;  3RMG A;  3P41 A;  4DI5 A;  2Q80 A;  5JA0 F;  3G4D A;  3WEJ A;  2I19 A;  4DHD A;  3WCH A;  3KB9 A;  2Z4Z A;  1V4K A;  3TS7 A;  4DWG A;  1HX9 A;  4LZ3 A;  3AE0 A;  4DZW A;  3RYW A;  3S4J A;  3VJD A;  4QPF A;  2AZL A;  5IMP A;  3ASX A;  5ILZ A;  3KRC A;  3N0F A;  1YV5 A;  3M0G A;  3LJI A;  3WEK A;  3KRP B;  4OKM A;  3KRF A;  4GP1 A;  3WCJ A;  2AZK A;  3EZ3 A;  1YYR A;  4MC8 A;  3Q30 A;  5B01 A;  4N1Z F;  5E8L A;  5ILH A;  1N22 A;  2F94 F;  5ILI A;  2P1C A;  3APZ A;  5EAS A;  2ZCQ A;  4JVJ F;  1RQI A;  3LVS A;  2E95 A;  4OKZ A;  3WCC A;  4RNQ A;  5B0L A;  4NKE A; 
#chains in the Genus database with same CATH topology
 4L2X F;  2OPN A;  5ILD A;  1HXA A;  2PS6 A;  3P8R A;  1V4J A;  4LLT A;  5AEL A;  3KRC B;  2E8U A;  3N3L F;  1N21 A;  1VG3 A;  5JV0 F;  4F6V A;  2F8C F;  4RXD A;  3RYE A;  3KRF B;  3N1W F;  3NPR A;  5DJR F;  3LK5 A;  1YHK A;  3ID0 A;  4KVD A;  4F6X A;  2H8O A;  4EA0 A;  3N0G A;  4KPJ A;  3WEG A;  1RTR A;  1V4H A;  2Z4W A;  3PYA A;  4EA1 A;  3LOM A;  3UCA A;  2E92 A;  2PS5 A;  1YQ7 A;  3VJB A;  3P5R A;  3S9V A;  4WK5 A;  3DYF A;  5ILJ A;  2Q9Y A;  1V4I A;  1DI1 A;  3Q1O A;  4EA2 A;  2OPM A;  4JZX A;  3LEE A;  3LLW A;  3M00 A;  2Z52 A;  2J1P A;  3AQB B;  2AEL A;  4KQU A;  4QXS F;  5DGN F;  3ACX A;  3N5J F;  3QKC A;  5DGM F;  3AQC B;  3B7L A;  2ONG A;  3SDT A;  4LTZ A;  5DHK A;  4KPD A;  3SDV A;  3ICN A;  1UBY A;  3V1X A;  4GP2 A;  4FJQ A;  1HXC A;  4KVY A;  1N23 A;  3ADZ A;  2DH4 A;  3CKE A;  1YYS A;  1UBW A;  2Z50 A;  3LGZ B;  2ZEU A;  3N46 F;  4LFV F;  2E8V A;  1YHM A;  2F92 F;  4RXE A;  2VF6 A;  1N24 A;  3VJA A;  3ACW A;  4E1E A;  4E9U A;  3WSA A;  3VJ8 A;  3VJC A;  3LSN A;  2PS7 A;  3SDQ A;  5CG5 A;  2Q9Z A;  3EFQ A;  5I1U A;  1N20 A;  3N1V F;  5EAT A;  5CG6 A;  4LLS A;  2Z4X A;  3ZL6 A;  3M01 A;  1PS1 A;  5DHI A;  4DWB A;  3WCB A;  3ICZ A;  2FOR A;  4XQR F;  5EAU A;  1YYQ A;  5IM1 A;  4JYX A;  3PH7 A;  1ZW5 A;  2AET A;  4RXC A;  5IKA A;  3KRO A;  1UBX A;  4MC0 A;  2E94 A;  3DYH A;  2OGD A;  4F62 A;  4LZ0 A;  4Q23 A;  1JFA A;  5ERM A;  2ZCO A;  4OMH A;  4LA6 A;  5JV2 F;  1HM4 A;  2RAH A;  2Z4V A;  4LZC A;  4NFK F;  5IMN A;  2ZEV A;  1YYT A;  5IKH A;  4LOB A;  3WJK A;  5B0I A;  1VG2 A;  4GA3 A;  1HM7 A;  3SDR A;  5HNA A;  3CC9 A;  2E8X A;  3V1V A;  4DXJ A;  5AHU B;  3SDU A;  5IL8 A;  1VG7 A;  1WMW A;  3NF2 A;  5IN8 A;  3WCD A;  5AYP A;  2Z4Y A;  3LDW A;  4PVY F;  3WCG A;  3BNY A;  5B00 A;  2E91 A;  5DIQ F;  1WY0 A;  5A0K A;  4PVX F;  3PKO A;  4H5E F;  5JV1 F;  3PDE A;  3OAC A;  4NFJ F;  3WEI A;  4MC3 A;  5DGS F;  2E8T A;  4P0V A;  4UMJ A;  2F8Z F;  5KSX F;  1N1Z A;  5IK0 A;  1WL2 A;  5ERO A;  4OGU A;  1KIZ A;  3P8L A;  4KWD A;  3LG5 A;  3WC9 A;  4P0W A;  4RYP A;  3KBK A;  1WKZ A;  4HD1 A;  4NG6 A;  3WJO A;  2AEK A;  4K10 A;  5ILK A;  3AQ0 A;  4KVI A;  1WL3 A;  2Z7H A;  3BNX A;  3NPK A;  2E8W A;  5B0K A;  1YJ4 A;  2E4O A;  3ACY A;  4XQT F;  3WCL A;  4LTV A;  5ERN A;  3Q2Q A;  3N49 F;  4LFE A;  1HXG A;  2ZY1 A;  2O1O A;  5DJV F;  3OAC B;  2PS4 A;  1RQJ A;  4LA5 A;  3W7F A;  5C05 A;  3N5H F;  5A0J A;  4XQS F;  4FP4 A;  4JZB A;  5H9D A;  3LGK A;  4KFA A;  5B0M A;  4KQS A;  3IPI A;  5B03 A;  5E8K A;  4KKM A;  5IK9 A;  5A0I A;  3EGT A;  1DGP A;  3SAE A;  3VJE A;  3N6K F;  2F7M F;  4H5C F;  3ZOU A;  4LIX A;  5IMI A;  3TC1 A;  3WJN A;  3CP6 A;  3LZ9 A;  5HN7 A;  5DJP F;  3ICK A;  3V66 A;  2QIS A;  3VJ9 A;  3WCF A;  4KK2 A;  4OMG A;  3MZV A;  3LMD A;  5B02 A;  1V4E A;  3ZMB A;  3OAB A;  3WCE A;  4KUX A;  4LPG F;  2AZJ A;  3WCA A;  3ZCD A;  5IL3 A;  3IBA A;  4KQ5 A;  3N3D A;  5E8H A;  4P0X A;  3ICM A;  4E9Z A;  1FPS A;  2OA6 A;  3DYG A;  2FTZ A;  3KRO B;  3RBM A;  1WL0 A;  4RXA A;  1VG6 A;  1VG4 A;  3M02 A;  3KRA A;  2E90 A;  5IVG A;  4LFG A;  1EZF A;  3WEF A;  3QQV A;  4H5D F;  2PS8 A;  3Q2Z A;  1WL1 A;  3M9U A;  4LXW A;  2ZCR A;  2Q58 A;  2ONH A;  2F89 F;  5DZ2 A;  3PYB A;  3MAV A;  4KVW A;  3OAB B;  2Z78 A;  4N9U A;  4NUA A;  3ZMC A;  4LUU A;  3WCM A;  3WSB A;  5ER8 A;  1N1B A;  3TFV A;  1KIY A;  3OYR A;  2EWG A;  2E93 A;  1YHL A;  1JFG A;  4GAX A;  4DEM F;  5B0J A;  1YYU A;  3TFN A;  3NRI A;  4NKF A;  5AFX A;  1UBV A;  2F9K F;  2ZCS A;  3KRP A;  3WEH A;  4JXY A;  2J1O A;  4LPH F;  3KRA B;  2J5C A;  3P5P A;  4ZQ8 A;  5DW7 A;  3G4F A;  3TFP A;  3WE9 A;  2Z7I A;  5HN8 A;  5ILY A;  5JUZ F;  3WCI A;  4JXN A;  5HN9 A;  3N45 F;  4NFI F;  5IK6 A;  3RMG A;  3P41 A;  4DI5 A;  2Q80 A;  5JA0 F;  3G4D A;  3WEJ A;  2I19 A;  4DHD A;  3WCH A;  3KB9 A;  2Z4Z A;  1V4K A;  3TS7 A;  4DWG A;  1HX9 A;  4LZ3 A;  3AE0 A;  4DZW A;  3RYW A;  3S4J A;  3VJD A;  4QPF A;  2AZL A;  5IMP A;  3ASX A;  5ILZ A;  3KRC A;  3N0F A;  1YV5 A;  3M0G A;  3LJI A;  3WEK A;  3KRP B;  4OKM A;  3KRF A;  4GP1 A;  3WCJ A;  2AZK A;  3EZ3 A;  1YYR A;  4MC8 A;  3Q30 A;  5B01 A;  4N1Z F;  5E8L A;  5ILH A;  1N22 A;  2F94 F;  5ILI A;  2P1C A;  3APZ A;  5EAS A;  2ZCQ A;  4JVJ F;  1RQI A;  3LVS A;  2E95 A;  4OKZ A;  3WCC A;  4RNQ A;  5B0L A;  4NKE A; 
#chains in the Genus database with same CATH homology
 4L2X F;  2OPN A;  5ILD A;  1HXA A;  2PS6 A;  3P8R A;  1V4J A;  4LLT A;  5AEL A;  3KRC B;  2E8U A;  3N3L F;  1N21 A;  1VG3 A;  5JV0 F;  4F6V A;  2F8C F;  4RXD A;  3RYE A;  3KRF B;  3N1W F;  3NPR A;  5DJR F;  3LK5 A;  1YHK A;  3ID0 A;  4KVD A;  4F6X A;  2H8O A;  4EA0 A;  3N0G A;  4KPJ A;  3WEG A;  1RTR A;  1V4H A;  2Z4W A;  3PYA A;  4EA1 A;  3LOM A;  3UCA A;  2E92 A;  2PS5 A;  1YQ7 A;  3VJB A;  3P5R A;  3S9V A;  4WK5 A;  3DYF A;  5ILJ A;  2Q9Y A;  1V4I A;  1DI1 A;  3Q1O A;  4EA2 A;  2OPM A;  4JZX A;  3LEE A;  3LLW A;  3M00 A;  2Z52 A;  2J1P A;  3AQB B;  2AEL A;  4KQU A;  4QXS F;  5DGN F;  3ACX A;  3N5J F;  3QKC A;  5DGM F;  3AQC B;  3B7L A;  2ONG A;  3SDT A;  4LTZ A;  5DHK A;  4KPD A;  3SDV A;  3ICN A;  1UBY A;  3V1X A;  4GP2 A;  4FJQ A;  1HXC A;  4KVY A;  1N23 A;  3ADZ A;  2DH4 A;  3CKE A;  1YYS A;  1UBW A;  2Z50 A;  3LGZ B;  2ZEU A;  3N46 F;  4LFV F;  2E8V A;  1YHM A;  2F92 F;  4RXE A;  2VF6 A;  1N24 A;  3VJA A;  3ACW A;  4E1E A;  4E9U A;  3WSA A;  3VJ8 A;  3VJC A;  3LSN A;  2PS7 A;  3SDQ A;  5CG5 A;  2Q9Z A;  3EFQ A;  5I1U A;  1N20 A;  3N1V F;  5EAT A;  5CG6 A;  4LLS A;  2Z4X A;  3ZL6 A;  3M01 A;  1PS1 A;  5DHI A;  4DWB A;  3WCB A;  3ICZ A;  2FOR A;  4XQR F;  5EAU A;  1YYQ A;  5IM1 A;  4JYX A;  3PH7 A;  1ZW5 A;  2AET A;  4RXC A;  5IKA A;  3KRO A;  1UBX A;  4MC0 A;  2E94 A;  3DYH A;  2OGD A;  4F62 A;  4LZ0 A;  4Q23 A;  1JFA A;  5ERM A;  2ZCO A;  4OMH A;  4LA6 A;  5JV2 F;  1HM4 A;  2RAH A;  2Z4V A;  4LZC A;  4NFK F;  5IMN A;  2ZEV A;  1YYT A;  5IKH A;  4LOB A;  3WJK A;  5B0I A;  1VG2 A;  4GA3 A;  1HM7 A;  3SDR A;  5HNA A;  3CC9 A;  2E8X A;  3V1V A;  4DXJ A;  5AHU B;  3SDU A;  5IL8 A;  1VG7 A;  1WMW A;  3NF2 A;  5IN8 A;  3WCD A;  5AYP A;  2Z4Y A;  3LDW A;  4PVY F;  3WCG A;  3BNY A;  5B00 A;  2E91 A;  5DIQ F;  1WY0 A;  5A0K A;  4PVX F;  3PKO A;  4H5E F;  5JV1 F;  3PDE A;  3OAC A;  4NFJ F;  3WEI A;  4MC3 A;  5DGS F;  2E8T A;  4P0V A;  4UMJ A;  2F8Z F;  5KSX F;  1N1Z A;  5IK0 A;  1WL2 A;  5ERO A;  4OGU A;  1KIZ A;  3P8L A;  4KWD A;  3LG5 A;  3WC9 A;  4P0W A;  4RYP A;  3KBK A;  1WKZ A;  4HD1 A;  4NG6 A;  3WJO A;  2AEK A;  4K10 A;  5ILK A;  3AQ0 A;  4KVI A;  1WL3 A;  2Z7H A;  3BNX A;  3NPK A;  2E8W A;  5B0K A;  1YJ4 A;  2E4O A;  3ACY A;  4XQT F;  3WCL A;  4LTV A;  5ERN A;  3Q2Q A;  3N49 F;  4LFE A;  1HXG A;  2ZY1 A;  2O1O A;  5DJV F;  3OAC B;  2PS4 A;  1RQJ A;  4LA5 A;  3W7F A;  5C05 A;  3N5H F;  5A0J A;  4XQS F;  4FP4 A;  4JZB A;  5H9D A;  3LGK A;  4KFA A;  5B0M A;  4KQS A;  3IPI A;  5B03 A;  5E8K A;  4KKM A;  5IK9 A;  5A0I A;  3EGT A;  1DGP A;  3SAE A;  3VJE A;  3N6K F;  2F7M F;  4H5C F;  3ZOU A;  4LIX A;  5IMI A;  3TC1 A;  3WJN A;  3CP6 A;  3LZ9 A;  5HN7 A;  5DJP F;  3ICK A;  3V66 A;  2QIS A;  3VJ9 A;  3WCF A;  4KK2 A;  4OMG A;  3MZV A;  3LMD A;  5B02 A;  1V4E A;  3ZMB A;  3OAB A;  3WCE A;  4KUX A;  4LPG F;  2AZJ A;  3WCA A;  3ZCD A;  5IL3 A;  3IBA A;  4KQ5 A;  3N3D A;  5E8H A;  4P0X A;  3ICM A;  4E9Z A;  1FPS A;  2OA6 A;  3DYG A;  2FTZ A;  3KRO B;  3RBM A;  1WL0 A;  4RXA A;  1VG6 A;  1VG4 A;  3M02 A;  3KRA A;  2E90 A;  5IVG A;  4LFG A;  1EZF A;  3WEF A;  3QQV A;  4H5D F;  2PS8 A;  3Q2Z A;  1WL1 A;  3M9U A;  4LXW A;  2ZCR A;  2Q58 A;  2ONH A;  2F89 F;  5DZ2 A;  3PYB A;  3MAV A;  4KVW A;  3OAB B;  2Z78 A;  4N9U A;  4NUA A;  3ZMC A;  4LUU A;  3WCM A;  3WSB A;  5ER8 A;  1N1B A;  3TFV A;  1KIY A;  3OYR A;  2EWG A;  2E93 A;  1YHL A;  1JFG A;  4GAX A;  4DEM F;  5B0J A;  1YYU A;  3TFN A;  3NRI A;  4NKF A;  5AFX A;  1UBV A;  2F9K F;  2ZCS A;  3KRP A;  3WEH A;  4JXY A;  2J1O A;  4LPH F;  3KRA B;  2J5C A;  3P5P A;  4ZQ8 A;  5DW7 A;  3G4F A;  3TFP A;  3WE9 A;  2Z7I A;  5HN8 A;  5ILY A;  5JUZ F;  3WCI A;  4JXN A;  5HN9 A;  3N45 F;  4NFI F;  5IK6 A;  3RMG A;  3P41 A;  4DI5 A;  2Q80 A;  5JA0 F;  3G4D A;  3WEJ A;  2I19 A;  4DHD A;  3WCH A;  3KB9 A;  2Z4Z A;  1V4K A;  3TS7 A;  4DWG A;  1HX9 A;  4LZ3 A;  3AE0 A;  4DZW A;  3RYW A;  3S4J A;  3VJD A;  4QPF A;  2AZL A;  5IMP A;  3ASX A;  5ILZ A;  3KRC A;  3N0F A;  1YV5 A;  3M0G A;  3LJI A;  3WEK A;  3KRP B;  4OKM A;  3KRF A;  4GP1 A;  3WCJ A;  2AZK A;  3EZ3 A;  1YYR A;  4MC8 A;  3Q30 A;  5B01 A;  4N1Z F;  5E8L A;  5ILH A;  1N22 A;  2F94 F;  5ILI A;  2P1C A;  3APZ A;  5EAS A;  2ZCQ A;  4JVJ F;  1RQI A;  3LVS A;  2E95 A;  4OKZ A;  3WCC A;  4RNQ A;  5B0L A;  4NKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...