4RXCA

T. brucei farnesyl diphosphate synthase complexed with homorisedronate bph-6
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
365
structure length
351
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPRLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl pyrophosphate synthase
publication title Farnesyl diphosphate synthase inhibitors with unique ligand-binding geometries.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 140
structure length 351
sequence length 365
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4rxcA00
4LFGA 4DHDA 3BNYA 3WEKA 4KFAA 4OMGA 4HD1A 4NFJF 4LOBA 2PS4A 3WSBA 5DJVF 4LZ3A 3NF2A 2OPMA 5ILYA 5DJPF 5ILJA 3ZCDA 4JXYA 3Q2ZA 3RBMA 3N5HF 5IKAA 2E8VA 5IMPA 3P8LA 4OMHA 4MC8A 5ER8A 4GA3A 3LSNA 2PS8A 2E8XA 2OA6A 1VG2A 1UBVA 2E8TA 5EAUA 3N3LF 5B00A 3UCAA 2AZKA 1JFAA 1JFGA 3WEIA 2PS5A 3N46F 2E8WA 3SDRA 3LZ9A 4LLTA 1WL3A 3AQBB 2ZCOA 3Q2QA 5JUZF 2P1CA 1V4IA 3W7FA 2F7MF 3OACB 3WCDA 4KKMA 3KB9A 3KROA 2F92F 4NFIF 3S9VA 5HN8A 2ONHA 4LFEA 5IVGA 2ZCSA 5IK6A 3ZOUA 3SDVA 3RYEA 1FPSA 4DXJA 4LUUA 3WCCA 4JXNA 4JZBA 5EATA 3KRAB 3M9UA 5IMIA 3DYHA 1UBXA 3TFPA 1KIZA 4KQ5A 4ZQ8A 5CG5A 4N9UA 4KVYA 2Z4XA 3LK5A 3Q1OA 4K10A 5ILIA 3S4JA 3WC9A 2ZEUA 3N0FA 4F62A 3WJOA 3N6KF 3LG5A 2J1OA 1VG7A 2AETA 4EA2A 1VG6A 1UBYA 5IMNA 3N0GA 3Q30A 2QISA 3VJCA 3CKEA 2FORA 5DGMF 1V4JA 2ZY1A 3ADZA 5C05A 4FP4A 2F9KF 4OGUA 3SDUA 3CC9A 2PS6A 3N45F 1PS1A 5HN7A 3WCLA 4UMJA 3APZA 4EA1A 2ZCQA 5DJRF 3NPRA 4JYXA 3BNXA 3SDTA 5IK0A 5A0IA 4EA0A 1YV5A 2VF6A 3NRIA 4NFKF 3V66A 5DIQF 3ZL6A 3PYAA 3KRFA 3G4DA 5DHIA 3OYRA 2E4OA 4KPDA 4DZWA 4KVWA 4RNQA 2F8ZF 3WCAA 5B03A 1N22A 2ZEVA 2E90A 4LFVF 1N24A 4QXSF 2ONGA 3RYWA 3KROB 5JV2F 3EFQA 5CG6A 2I19A 2J5CA 4PVXF 3ACWA 4LA5A 2AZJA 2E93A 3KRPA 3P5PA 2EWGA 4MC3A 3LGKA 5ERMA 1VG3A 1RTRA 1WMWA 2RAHA 4N1ZF 3WCEA 3ZMBA 3WCJA 5A0KA 3QKCA 5IL8A 3ACYA 3IPIA 1DGPA 3RMGA 4LTVA 2F94F 2Z4YA 3M02A 4XQTF 1WL1A 5B0KA 3N5JF 3VJEA 3QQVA 4DI5A 4GP1A 5DGSF 3ID0A 5JA0F 3TS7A 1YYQA 3ACXA 3ICMA 4H5DF 3SDQA 5B02A 1UBWA 1HX9A 3VJ9A 1YHMA 1YQ7A 5DW7A 5B0MA 1N1ZA 3WJKA 3N49F 4XQRF 3KRCA 5HNAA 2Z7HA 3WE9A 3OABB 1WKZA 3VJ8A 4NKEA 3M00A 2F8CF 4KUXA 4WK5A 3V1XA 1HM4A 4KWDA 3WEGA 1YYSA 5E8LA 3WCHA 1HXAA 5B01A 3P8RA 4H5EF 4F6XA 3N3DA 3PYBA 4NKFA 5DZ2A 3CP6A 1YJ4A 3PH7A 4LLSA 4KPJA 1YYRA 3TFVA 3KRAA 2AEKA 3VJAA 3EGTA 3WSAA 1VG4A 4NG6A 4PVYF 4JVJF 5E8KA 3LOMA 3KBKA 4KK2A 3WCMA 4LPGF 3KRFB 3WEJA 2OPNA 4RXEA 2E92A 3MZVA 4QPFA 3P41A 5I1UA 5B0JA 3WCBA 5ERNA 4OKMA 5HN9A 4DWGA 5E8HA 4LXWA 3WCFA 3LEEA 2H8OA 1WY0A 4LZ0A 2FTZA 2E91A 4LTZA 3N1WF 3N1VF 1HXCA 2DH4A 4LA6A 4P0WA 4NUAA 1N23A 3ICNA 3ICZA 3KRPB 5AYPA 2Q58A 4H5CF 1V4EA 3G4FA 1V4HA 5KSXF 3VJDA 3ICKA 3SAEA 5IL3A 4E1EA 5ILDA 3ZMCA 4GP2A 1YYUA 3WJNA 5JV1F 5A0JA 4KVIA 2Z7IA 5IK9A 5JV0F 3LJIA 3AQCB 4KQUA 3PDEA 3LGZB 3VJBA 1HM7A 1N1BA 3LVSA 2E95A 2E8UA 2OGDA 4JZXA 5IKHA 4KVDA 1HXGA 3TFNA 1KIYA 1YHLA 2Q9ZA 5DGNF 5AFXA 3WCGA 3MAVA 3LDWA 3IBAA 3M0GA 3WEFA 3B7LA 3LMDA 5EROA 3EZ3A 4Q23A 4XQSF 5AELA 5EASA 3V1VA 3WCIA 1YYTA 5ILZA 1EZFA 3KRCB 2ZCRA 2Q80A 4FJQA 1RQJA 5IM1A 5ILHA 4L2XF 2Z52A 3AE0A 3DYGA 4OKZA 2Z78A 2AZLA 3DYFA 3OACA 4F6VA 5AHUB 4E9ZA 3WEHA 2E94A 1DI1A 1YHKA 4RXCA 4RXDA 2O1OA 1V4KA 2Z4ZA 4LZCA 5IN8A 5ILKA 4MC0A 5DHKA 3P5RA 5B0LA 4E9UA 2PS7A 3AQ0A 3ASXA 3M01A 4P0XA 5B0IA 4DEMF 1WL2A 2Z50A 1RQIA 4P0VA 1WL0A 5H9DA 2J1PA 4GAXA 2F89F 4LPHF 4RYPA 1N21A 1N20A 3TC1A 4LIXA 3NPKA 2Q9YA 2Z4VA 2AELA 1ZW5A 3OABA 4KQSA 4DWBA 4RXAA 3PKOA 2Z4WA 3LLWA
chains in the Genus database with same CATH superfamily
4LFGA 4DHDA 3BNYA 3WEKA 4KFAA 4OMGA 4HD1A 4NFJF 4LOBA 2PS4A 3WSBA 5DJVF 4LZ3A 3NF2A 2OPMA 5ILYA 5DJPF 5ILJA 3ZCDA 4JXYA 3Q2ZA 3RBMA 3N5HF 5IKAA 2E8VA 5IMPA 3P8LA 4OMHA 4MC8A 5ER8A 4GA3A 3LSNA 2PS8A 2E8XA 2OA6A 1VG2A 1UBVA 2E8TA 5EAUA 3N3LF 5B00A 3UCAA 2AZKA 1JFAA 1JFGA 3WEIA 2PS5A 3N46F 2E8WA 3SDRA 3LZ9A 4LLTA 1WL3A 3AQBB 2ZCOA 3Q2QA 5JUZF 2P1CA 1V4IA 3W7FA 2F7MF 3OACB 3WCDA 4KKMA 3KB9A 3KROA 2F92F 4NFIF 3S9VA 5HN8A 2ONHA 4LFEA 5IVGA 2ZCSA 5IK6A 3ZOUA 3SDVA 3RYEA 1FPSA 4DXJA 4LUUA 3WCCA 4JXNA 4JZBA 5EATA 3KRAB 3M9UA 5IMIA 3DYHA 1UBXA 3TFPA 1KIZA 4KQ5A 4ZQ8A 5CG5A 4N9UA 4KVYA 2Z4XA 3LK5A 3Q1OA 4K10A 5ILIA 3S4JA 3WC9A 2ZEUA 3N0FA 4F62A 3WJOA 3N6KF 3LG5A 2J1OA 1VG7A 2AETA 4EA2A 1VG6A 1UBYA 5IMNA 3N0GA 3Q30A 2QISA 3VJCA 3CKEA 2FORA 5DGMF 1V4JA 2ZY1A 3ADZA 5C05A 4FP4A 2F9KF 4OGUA 3SDUA 3CC9A 2PS6A 3N45F 1PS1A 5HN7A 3WCLA 4UMJA 3APZA 4EA1A 2ZCQA 5DJRF 3NPRA 4JYXA 3BNXA 3SDTA 5IK0A 5A0IA 4EA0A 1YV5A 2VF6A 3NRIA 4NFKF 3V66A 5DIQF 3ZL6A 3PYAA 3KRFA 3G4DA 5DHIA 3OYRA 2E4OA 4KPDA 4DZWA 4KVWA 4RNQA 2F8ZF 3WCAA 5B03A 1N22A 2ZEVA 2E90A 4LFVF 1N24A 4QXSF 2ONGA 3RYWA 3KROB 5JV2F 3EFQA 5CG6A 2I19A 2J5CA 4PVXF 3ACWA 4LA5A 2AZJA 2E93A 3KRPA 3P5PA 2EWGA 4MC3A 3LGKA 5ERMA 1VG3A 1RTRA 1WMWA 2RAHA 4N1ZF 3WCEA 3ZMBA 3WCJA 5A0KA 3QKCA 5IL8A 3ACYA 3IPIA 1DGPA 3RMGA 4LTVA 2F94F 2Z4YA 3M02A 4XQTF 1WL1A 5B0KA 3N5JF 3VJEA 3QQVA 4DI5A 4GP1A 5DGSF 3ID0A 5JA0F 3TS7A 1YYQA 3ACXA 3ICMA 4H5DF 3SDQA 5B02A 1UBWA 1HX9A 3VJ9A 1YHMA 1YQ7A 5DW7A 5B0MA 1N1ZA 3WJKA 3N49F 4XQRF 3KRCA 5HNAA 2Z7HA 3WE9A 3OABB 1WKZA 3VJ8A 4NKEA 3M00A 2F8CF 4KUXA 4WK5A 3V1XA 1HM4A 4KWDA 3WEGA 1YYSA 5E8LA 3WCHA 1HXAA 5B01A 3P8RA 4H5EF 4F6XA 3N3DA 3PYBA 4NKFA 5DZ2A 3CP6A 1YJ4A 3PH7A 4LLSA 4KPJA 1YYRA 3TFVA 3KRAA 2AEKA 3VJAA 3EGTA 3WSAA 1VG4A 4NG6A 4PVYF 4JVJF 5E8KA 3LOMA 3KBKA 4KK2A 3WCMA 4LPGF 3KRFB 3WEJA 2OPNA 4RXEA 2E92A 3MZVA 4QPFA 3P41A 5I1UA 5B0JA 3WCBA 5ERNA 4OKMA 5HN9A 4DWGA 5E8HA 4LXWA 3WCFA 3LEEA 2H8OA 1WY0A 4LZ0A 2FTZA 2E91A 4LTZA 3N1WF 3N1VF 1HXCA 2DH4A 4LA6A 4P0WA 4NUAA 1N23A 3ICNA 3ICZA 3KRPB 5AYPA 2Q58A 4H5CF 1V4EA 3G4FA 1V4HA 5KSXF 3VJDA 3ICKA 3SAEA 5IL3A 4E1EA 5ILDA 3ZMCA 4GP2A 1YYUA 3WJNA 5JV1F 5A0JA 4KVIA 2Z7IA 5IK9A 5JV0F 3LJIA 3AQCB 4KQUA 3PDEA 3LGZB 3VJBA 1HM7A 1N1BA 3LVSA 2E95A 2E8UA 2OGDA 4JZXA 5IKHA 4KVDA 1HXGA 3TFNA 1KIYA 1YHLA 2Q9ZA 5DGNF 5AFXA 3WCGA 3MAVA 3LDWA 3IBAA 3M0GA 3WEFA 3B7LA 3LMDA 5EROA 3EZ3A 4Q23A 4XQSF 5AELA 5EASA 3V1VA 3WCIA 1YYTA 5ILZA 1EZFA 3KRCB 2ZCRA 2Q80A 4FJQA 1RQJA 5IM1A 5ILHA 4L2XF 2Z52A 3AE0A 3DYGA 4OKZA 2Z78A 2AZLA 3DYFA 3OACA 4F6VA 5AHUB 4E9ZA 3WEHA 2E94A 1DI1A 1YHKA 4RXCA 4RXDA 2O1OA 1V4KA 2Z4ZA 4LZCA 5IN8A 5ILKA 4MC0A 5DHKA 3P5RA 5B0LA 4E9UA 2PS7A 3AQ0A 3ASXA 3M01A 4P0XA 5B0IA 4DEMF 1WL2A 2Z50A 1RQIA 4P0VA 1WL0A 5H9DA 2J1PA 4GAXA 2F89F 4LPHF 4RYPA 1N21A 1N20A 3TC1A 4LIXA 3NPKA 2Q9YA 2Z4VA 2AELA 1ZW5A 3OABA 4KQSA 4DWBA 4RXAA 3PKOA 2Z4WA 3LLWA
chains in the Genus database with same CATH topology
4LFGA 4DHDA 3BNYA 3WEKA 4KFAA 4OMGA 4HD1A 4NFJF 4LOBA 2PS4A 3WSBA 5DJVF 4LZ3A 3NF2A 2OPMA 5ILYA 5DJPF 5ILJA 3ZCDA 4JXYA 3Q2ZA 3RBMA 3N5HF 5IKAA 2E8VA 5IMPA 3P8LA 4OMHA 4MC8A 5ER8A 4GA3A 3LSNA 2PS8A 2E8XA 2OA6A 1VG2A 1UBVA 2E8TA 5EAUA 3N3LF 5B00A 3UCAA 2AZKA 1JFAA 1JFGA 3WEIA 2PS5A 3N46F 2E8WA 3SDRA 3LZ9A 4LLTA 1WL3A 3AQBB 2ZCOA 3Q2QA 5JUZF 2P1CA 1V4IA 3W7FA 2F7MF 3OACB 3WCDA 4KKMA 3KB9A 3KROA 2F92F 4NFIF 3S9VA 5HN8A 2ONHA 4LFEA 5IVGA 2ZCSA 5IK6A 3ZOUA 3SDVA 3RYEA 1FPSA 4DXJA 4LUUA 3WCCA 4JXNA 4JZBA 5EATA 3KRAB 3M9UA 5IMIA 3DYHA 1UBXA 3TFPA 1KIZA 4KQ5A 4ZQ8A 5CG5A 4N9UA 4KVYA 2Z4XA 3LK5A 3Q1OA 4K10A 5ILIA 3S4JA 3WC9A 2ZEUA 3N0FA 4F62A 3WJOA 3N6KF 3LG5A 2J1OA 1VG7A 2AETA 4EA2A 1VG6A 1UBYA 5IMNA 3N0GA 3Q30A 2QISA 3VJCA 3CKEA 2FORA 5DGMF 1V4JA 2ZY1A 3ADZA 5C05A 4FP4A 2F9KF 4OGUA 3SDUA 3CC9A 2PS6A 3N45F 1PS1A 5HN7A 3WCLA 4UMJA 3APZA 4EA1A 2ZCQA 5DJRF 3NPRA 4JYXA 3BNXA 3SDTA 5IK0A 5A0IA 4EA0A 1YV5A 2VF6A 3NRIA 4NFKF 3V66A 5DIQF 3ZL6A 3PYAA 3KRFA 3G4DA 5DHIA 3OYRA 2E4OA 4KPDA 4DZWA 4KVWA 4RNQA 2F8ZF 3WCAA 5B03A 1N22A 2ZEVA 2E90A 4LFVF 1N24A 4QXSF 2ONGA 3RYWA 3KROB 5JV2F 3EFQA 5CG6A 2I19A 2J5CA 4PVXF 3ACWA 4LA5A 2AZJA 2E93A 3KRPA 3P5PA 2EWGA 4MC3A 3LGKA 5ERMA 1VG3A 1RTRA 1WMWA 2RAHA 4N1ZF 3WCEA 3ZMBA 3WCJA 5A0KA 3QKCA 5IL8A 3ACYA 3IPIA 1DGPA 3RMGA 4LTVA 2F94F 2Z4YA 3M02A 4XQTF 1WL1A 5B0KA 3N5JF 3VJEA 3QQVA 4DI5A 4GP1A 5DGSF 3ID0A 5JA0F 3TS7A 1YYQA 3ACXA 3ICMA 4H5DF 3SDQA 5B02A 1UBWA 1HX9A 3VJ9A 1YHMA 1YQ7A 5DW7A 5B0MA 1N1ZA 3WJKA 3N49F 4XQRF 3KRCA 5HNAA 2Z7HA 3WE9A 3OABB 1WKZA 3VJ8A 4NKEA 3M00A 2F8CF 4KUXA 4WK5A 3V1XA 1HM4A 4KWDA 3WEGA 1YYSA 5E8LA 3WCHA 1HXAA 5B01A 3P8RA 4H5EF 4F6XA 3N3DA 3PYBA 4NKFA 5DZ2A 3CP6A 1YJ4A 3PH7A 4LLSA 4KPJA 1YYRA 3TFVA 3KRAA 2AEKA 3VJAA 3EGTA 3WSAA 1VG4A 4NG6A 4PVYF 4JVJF 5E8KA 3LOMA 3KBKA 4KK2A 3WCMA 4LPGF 3KRFB 3WEJA 2OPNA 4RXEA 2E92A 3MZVA 4QPFA 3P41A 5I1UA 5B0JA 3WCBA 5ERNA 4OKMA 5HN9A 4DWGA 5E8HA 4LXWA 3WCFA 3LEEA 2H8OA 1WY0A 4LZ0A 2FTZA 2E91A 4LTZA 3N1WF 3N1VF 1HXCA 2DH4A 4LA6A 4P0WA 4NUAA 1N23A 3ICNA 3ICZA 3KRPB 5AYPA 2Q58A 4H5CF 1V4EA 3G4FA 1V4HA 5KSXF 3VJDA 3ICKA 3SAEA 5IL3A 4E1EA 5ILDA 3ZMCA 4GP2A 1YYUA 3WJNA 5JV1F 5A0JA 4KVIA 2Z7IA 5IK9A 5JV0F 3LJIA 3AQCB 4KQUA 3PDEA 3LGZB 3VJBA 1HM7A 1N1BA 3LVSA 2E95A 2E8UA 2OGDA 4JZXA 5IKHA 4KVDA 1HXGA 3TFNA 1KIYA 1YHLA 2Q9ZA 5DGNF 5AFXA 3WCGA 3MAVA 3LDWA 3IBAA 3M0GA 3WEFA 3B7LA 3LMDA 5EROA 3EZ3A 4Q23A 4XQSF 5AELA 5EASA 3V1VA 3WCIA 1YYTA 5ILZA 1EZFA 3KRCB 2ZCRA 2Q80A 4FJQA 1RQJA 5IM1A 5ILHA 4L2XF 2Z52A 3AE0A 3DYGA 4OKZA 2Z78A 2AZLA 3DYFA 3OACA 4F6VA 5AHUB 4E9ZA 3WEHA 2E94A 1DI1A 1YHKA 4RXCA 4RXDA 2O1OA 1V4KA 2Z4ZA 4LZCA 5IN8A 5ILKA 4MC0A 5DHKA 3P5RA 5B0LA 4E9UA 2PS7A 3AQ0A 3ASXA 3M01A 4P0XA 5B0IA 4DEMF 1WL2A 2Z50A 1RQIA 4P0VA 1WL0A 5H9DA 2J1PA 4GAXA 2F89F 4LPHF 4RYPA 1N21A 1N20A 3TC1A 4LIXA 3NPKA 2Q9YA 2Z4VA 2AELA 1ZW5A 3OABA 4KQSA 4DWBA 4RXAA 3PKOA 2Z4WA 3LLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFG A;  4DHD A;  3BNY A;  3WEK A;  4KFA A;  4OMG A;  4HD1 A;  4NFJ F;  4LOB A;  2PS4 A;  3WSB A;  5DJV F;  4LZ3 A;  3NF2 A;  2OPM A;  5ILY A;  5DJP F;  5ILJ A;  3ZCD A;  4JXY A;  3Q2Z A;  3RBM A;  3N5H F;  5IKA A;  2E8V A;  5IMP A;  3P8L A;  4OMH A;  4MC8 A;  5ER8 A;  4GA3 A;  3LSN A;  2PS8 A;  2E8X A;  2OA6 A;  1VG2 A;  1UBV A;  2E8T A;  5EAU A;  3N3L F;  5B00 A;  3UCA A;  2AZK A;  1JFA A;  1JFG A;  3WEI A;  2PS5 A;  3N46 F;  2E8W A;  3SDR A;  3LZ9 A;  4LLT A;  1WL3 A;  3AQB B;  2ZCO A;  3Q2Q A;  5JUZ F;  2P1C A;  1V4I A;  3W7F A;  2F7M F;  3OAC B;  3WCD A;  4KKM A;  3KB9 A;  3KRO A;  2F92 F;  4NFI F;  3S9V A;  5HN8 A;  2ONH A;  4LFE A;  5IVG A;  2ZCS A;  5IK6 A;  3ZOU A;  3SDV A;  3RYE A;  1FPS A;  4DXJ A;  4LUU A;  3WCC A;  4JXN A;  4JZB A;  5EAT A;  3KRA B;  3M9U A;  5IMI A;  3DYH A;  1UBX A;  3TFP A;  1KIZ A;  4KQ5 A;  4ZQ8 A;  5CG5 A;  4N9U A;  4KVY A;  2Z4X A;  3LK5 A;  3Q1O A;  4K10 A;  5ILI A;  3S4J A;  3WC9 A;  2ZEU A;  3N0F A;  4F62 A;  3WJO A;  3N6K F;  3LG5 A;  2J1O A;  1VG7 A;  2AET A;  4EA2 A;  1VG6 A;  1UBY A;  5IMN A;  3N0G A;  3Q30 A;  2QIS A;  3VJC A;  3CKE A;  2FOR A;  5DGM F;  1V4J A;  2ZY1 A;  3ADZ A;  5C05 A;  4FP4 A;  2F9K F;  4OGU A;  3SDU A;  3CC9 A;  2PS6 A;  3N45 F;  1PS1 A;  5HN7 A;  3WCL A;  4UMJ A;  3APZ A;  4EA1 A;  2ZCQ A;  5DJR F;  3NPR A;  4JYX A;  3BNX A;  3SDT A;  5IK0 A;  5A0I A;  4EA0 A;  1YV5 A;  2VF6 A;  3NRI A;  4NFK F;  3V66 A;  5DIQ F;  3ZL6 A;  3PYA A;  3KRF A;  3G4D A;  5DHI A;  3OYR A;  2E4O A;  4KPD A;  4DZW A;  4KVW A;  4RNQ A;  2F8Z F;  3WCA A;  5B03 A;  1N22 A;  2ZEV A;  2E90 A;  4LFV F;  1N24 A;  4QXS F;  2ONG A;  3RYW A;  3KRO B;  5JV2 F;  3EFQ A;  5CG6 A;  2I19 A;  2J5C A;  4PVX F;  3ACW A;  4LA5 A;  2AZJ A;  2E93 A;  3KRP A;  3P5P A;  2EWG A;  4MC3 A;  3LGK A;  5ERM A;  1VG3 A;  1RTR A;  1WMW A;  2RAH A;  4N1Z F;  3WCE A;  3ZMB A;  3WCJ A;  5A0K A;  3QKC A;  5IL8 A;  3ACY A;  3IPI A;  1DGP A;  3RMG A;  4LTV A;  2F94 F;  2Z4Y A;  3M02 A;  4XQT F;  1WL1 A;  5B0K A;  3N5J F;  3VJE A;  3QQV A;  4DI5 A;  4GP1 A;  5DGS F;  3ID0 A;  5JA0 F;  3TS7 A;  1YYQ A;  3ACX A;  3ICM A;  4H5D F;  3SDQ A;  5B02 A;  1UBW A;  1HX9 A;  3VJ9 A;  1YHM A;  1YQ7 A;  5DW7 A;  5B0M A;  1N1Z A;  3WJK A;  3N49 F;  4XQR F;  3KRC A;  5HNA A;  2Z7H A;  3WE9 A;  3OAB B;  1WKZ A;  3VJ8 A;  4NKE A;  3M00 A;  2F8C F;  4KUX A;  4WK5 A;  3V1X A;  1HM4 A;  4KWD A;  3WEG A;  1YYS A;  5E8L A;  3WCH A;  1HXA A;  5B01 A;  3P8R A;  4H5E F;  4F6X A;  3N3D A;  3PYB A;  4NKF A;  5DZ2 A;  3CP6 A;  1YJ4 A;  3PH7 A;  4LLS A;  4KPJ A;  1YYR A;  3TFV A;  3KRA A;  2AEK A;  3VJA A;  3EGT A;  3WSA A;  1VG4 A;  4NG6 A;  4PVY F;  4JVJ F;  5E8K A;  3LOM A;  3KBK A;  4KK2 A;  3WCM A;  4LPG F;  3KRF B;  3WEJ A;  2OPN A;  4RXE A;  2E92 A;  3MZV A;  4QPF A;  3P41 A;  5I1U A;  5B0J A;  3WCB A;  5ERN A;  4OKM A;  5HN9 A;  4DWG A;  5E8H A;  4LXW A;  3WCF A;  3LEE A;  2H8O A;  1WY0 A;  4LZ0 A;  2FTZ A;  2E91 A;  4LTZ A;  3N1W F;  3N1V F;  1HXC A;  2DH4 A;  4LA6 A;  4P0W A;  4NUA A;  1N23 A;  3ICN A;  3ICZ A;  3KRP B;  5AYP A;  2Q58 A;  4H5C F;  1V4E A;  3G4F A;  1V4H A;  5KSX F;  3VJD A;  3ICK A;  3SAE A;  5IL3 A;  4E1E A;  5ILD A;  3ZMC A;  4GP2 A;  1YYU A;  3WJN A;  5JV1 F;  5A0J A;  4KVI A;  2Z7I A;  5IK9 A;  5JV0 F;  3LJI A;  3AQC B;  4KQU A;  3PDE A;  3LGZ B;  3VJB A;  1HM7 A;  1N1B A;  3LVS A;  2E95 A;  2E8U A;  2OGD A;  4JZX A;  5IKH A;  4KVD A;  1HXG A;  3TFN A;  1KIY A;  1YHL A;  2Q9Z A;  5DGN F;  5AFX A;  3WCG A;  3MAV A;  3LDW A;  3IBA A;  3M0G A;  3WEF A;  3B7L A;  3LMD A;  5ERO A;  3EZ3 A;  4Q23 A;  4XQS F;  5AEL A;  5EAS A;  3V1V A;  3WCI A;  1YYT A;  5ILZ A;  1EZF A;  3KRC B;  2ZCR A;  2Q80 A;  4FJQ A;  1RQJ A;  5IM1 A;  5ILH A;  4L2X F;  2Z52 A;  3AE0 A;  3DYG A;  4OKZ A;  2Z78 A;  2AZL A;  3DYF A;  3OAC A;  4F6V A;  5AHU B;  4E9Z A;  3WEH A;  2E94 A;  1DI1 A;  1YHK A;  4RXC A;  4RXD A;  2O1O A;  1V4K A;  2Z4Z A;  4LZC A;  5IN8 A;  5ILK A;  4MC0 A;  5DHK A;  3P5R A;  5B0L A;  4E9U A;  2PS7 A;  3AQ0 A;  3ASX A;  3M01 A;  4P0X A;  5B0I A;  4DEM F;  1WL2 A;  2Z50 A;  1RQI A;  4P0V A;  1WL0 A;  5H9D A;  2J1P A;  4GAX A;  2F89 F;  4LPH F;  4RYP A;  1N21 A;  1N20 A;  3TC1 A;  4LIX A;  3NPK A;  2Q9Y A;  2Z4V A;  2AEL A;  1ZW5 A;  3OAB A;  4KQS A;  4DWB A;  4RXA A;  3PKO A;  2Z4W A;  3LLW A; 
#chains in the Genus database with same CATH topology
 4LFG A;  4DHD A;  3BNY A;  3WEK A;  4KFA A;  4OMG A;  4HD1 A;  4NFJ F;  4LOB A;  2PS4 A;  3WSB A;  5DJV F;  4LZ3 A;  3NF2 A;  2OPM A;  5ILY A;  5DJP F;  5ILJ A;  3ZCD A;  4JXY A;  3Q2Z A;  3RBM A;  3N5H F;  5IKA A;  2E8V A;  5IMP A;  3P8L A;  4OMH A;  4MC8 A;  5ER8 A;  4GA3 A;  3LSN A;  2PS8 A;  2E8X A;  2OA6 A;  1VG2 A;  1UBV A;  2E8T A;  5EAU A;  3N3L F;  5B00 A;  3UCA A;  2AZK A;  1JFA A;  1JFG A;  3WEI A;  2PS5 A;  3N46 F;  2E8W A;  3SDR A;  3LZ9 A;  4LLT A;  1WL3 A;  3AQB B;  2ZCO A;  3Q2Q A;  5JUZ F;  2P1C A;  1V4I A;  3W7F A;  2F7M F;  3OAC B;  3WCD A;  4KKM A;  3KB9 A;  3KRO A;  2F92 F;  4NFI F;  3S9V A;  5HN8 A;  2ONH A;  4LFE A;  5IVG A;  2ZCS A;  5IK6 A;  3ZOU A;  3SDV A;  3RYE A;  1FPS A;  4DXJ A;  4LUU A;  3WCC A;  4JXN A;  4JZB A;  5EAT A;  3KRA B;  3M9U A;  5IMI A;  3DYH A;  1UBX A;  3TFP A;  1KIZ A;  4KQ5 A;  4ZQ8 A;  5CG5 A;  4N9U A;  4KVY A;  2Z4X A;  3LK5 A;  3Q1O A;  4K10 A;  5ILI A;  3S4J A;  3WC9 A;  2ZEU A;  3N0F A;  4F62 A;  3WJO A;  3N6K F;  3LG5 A;  2J1O A;  1VG7 A;  2AET A;  4EA2 A;  1VG6 A;  1UBY A;  5IMN A;  3N0G A;  3Q30 A;  2QIS A;  3VJC A;  3CKE A;  2FOR A;  5DGM F;  1V4J A;  2ZY1 A;  3ADZ A;  5C05 A;  4FP4 A;  2F9K F;  4OGU A;  3SDU A;  3CC9 A;  2PS6 A;  3N45 F;  1PS1 A;  5HN7 A;  3WCL A;  4UMJ A;  3APZ A;  4EA1 A;  2ZCQ A;  5DJR F;  3NPR A;  4JYX A;  3BNX A;  3SDT A;  5IK0 A;  5A0I A;  4EA0 A;  1YV5 A;  2VF6 A;  3NRI A;  4NFK F;  3V66 A;  5DIQ F;  3ZL6 A;  3PYA A;  3KRF A;  3G4D A;  5DHI A;  3OYR A;  2E4O A;  4KPD A;  4DZW A;  4KVW A;  4RNQ A;  2F8Z F;  3WCA A;  5B03 A;  1N22 A;  2ZEV A;  2E90 A;  4LFV F;  1N24 A;  4QXS F;  2ONG A;  3RYW A;  3KRO B;  5JV2 F;  3EFQ A;  5CG6 A;  2I19 A;  2J5C A;  4PVX F;  3ACW A;  4LA5 A;  2AZJ A;  2E93 A;  3KRP A;  3P5P A;  2EWG A;  4MC3 A;  3LGK A;  5ERM A;  1VG3 A;  1RTR A;  1WMW A;  2RAH A;  4N1Z F;  3WCE A;  3ZMB A;  3WCJ A;  5A0K A;  3QKC A;  5IL8 A;  3ACY A;  3IPI A;  1DGP A;  3RMG A;  4LTV A;  2F94 F;  2Z4Y A;  3M02 A;  4XQT F;  1WL1 A;  5B0K A;  3N5J F;  3VJE A;  3QQV A;  4DI5 A;  4GP1 A;  5DGS F;  3ID0 A;  5JA0 F;  3TS7 A;  1YYQ A;  3ACX A;  3ICM A;  4H5D F;  3SDQ A;  5B02 A;  1UBW A;  1HX9 A;  3VJ9 A;  1YHM A;  1YQ7 A;  5DW7 A;  5B0M A;  1N1Z A;  3WJK A;  3N49 F;  4XQR F;  3KRC A;  5HNA A;  2Z7H A;  3WE9 A;  3OAB B;  1WKZ A;  3VJ8 A;  4NKE A;  3M00 A;  2F8C F;  4KUX A;  4WK5 A;  3V1X A;  1HM4 A;  4KWD A;  3WEG A;  1YYS A;  5E8L A;  3WCH A;  1HXA A;  5B01 A;  3P8R A;  4H5E F;  4F6X A;  3N3D A;  3PYB A;  4NKF A;  5DZ2 A;  3CP6 A;  1YJ4 A;  3PH7 A;  4LLS A;  4KPJ A;  1YYR A;  3TFV A;  3KRA A;  2AEK A;  3VJA A;  3EGT A;  3WSA A;  1VG4 A;  4NG6 A;  4PVY F;  4JVJ F;  5E8K A;  3LOM A;  3KBK A;  4KK2 A;  3WCM A;  4LPG F;  3KRF B;  3WEJ A;  2OPN A;  4RXE A;  2E92 A;  3MZV A;  4QPF A;  3P41 A;  5I1U A;  5B0J A;  3WCB A;  5ERN A;  4OKM A;  5HN9 A;  4DWG A;  5E8H A;  4LXW A;  3WCF A;  3LEE A;  2H8O A;  1WY0 A;  4LZ0 A;  2FTZ A;  2E91 A;  4LTZ A;  3N1W F;  3N1V F;  1HXC A;  2DH4 A;  4LA6 A;  4P0W A;  4NUA A;  1N23 A;  3ICN A;  3ICZ A;  3KRP B;  5AYP A;  2Q58 A;  4H5C F;  1V4E A;  3G4F A;  1V4H A;  5KSX F;  3VJD A;  3ICK A;  3SAE A;  5IL3 A;  4E1E A;  5ILD A;  3ZMC A;  4GP2 A;  1YYU A;  3WJN A;  5JV1 F;  5A0J A;  4KVI A;  2Z7I A;  5IK9 A;  5JV0 F;  3LJI A;  3AQC B;  4KQU A;  3PDE A;  3LGZ B;  3VJB A;  1HM7 A;  1N1B A;  3LVS A;  2E95 A;  2E8U A;  2OGD A;  4JZX A;  5IKH A;  4KVD A;  1HXG A;  3TFN A;  1KIY A;  1YHL A;  2Q9Z A;  5DGN F;  5AFX A;  3WCG A;  3MAV A;  3LDW A;  3IBA A;  3M0G A;  3WEF A;  3B7L A;  3LMD A;  5ERO A;  3EZ3 A;  4Q23 A;  4XQS F;  5AEL A;  5EAS A;  3V1V A;  3WCI A;  1YYT A;  5ILZ A;  1EZF A;  3KRC B;  2ZCR A;  2Q80 A;  4FJQ A;  1RQJ A;  5IM1 A;  5ILH A;  4L2X F;  2Z52 A;  3AE0 A;  3DYG A;  4OKZ A;  2Z78 A;  2AZL A;  3DYF A;  3OAC A;  4F6V A;  5AHU B;  4E9Z A;  3WEH A;  2E94 A;  1DI1 A;  1YHK A;  4RXC A;  4RXD A;  2O1O A;  1V4K A;  2Z4Z A;  4LZC A;  5IN8 A;  5ILK A;  4MC0 A;  5DHK A;  3P5R A;  5B0L A;  4E9U A;  2PS7 A;  3AQ0 A;  3ASX A;  3M01 A;  4P0X A;  5B0I A;  4DEM F;  1WL2 A;  2Z50 A;  1RQI A;  4P0V A;  1WL0 A;  5H9D A;  2J1P A;  4GAX A;  2F89 F;  4LPH F;  4RYP A;  1N21 A;  1N20 A;  3TC1 A;  4LIX A;  3NPK A;  2Q9Y A;  2Z4V A;  2AEL A;  1ZW5 A;  3OAB A;  4KQS A;  4DWB A;  4RXA A;  3PKO A;  2Z4W A;  3LLW A; 
#chains in the Genus database with same CATH homology
 4LFG A;  4DHD A;  3BNY A;  3WEK A;  4KFA A;  4OMG A;  4HD1 A;  4NFJ F;  4LOB A;  2PS4 A;  3WSB A;  5DJV F;  4LZ3 A;  3NF2 A;  2OPM A;  5ILY A;  5DJP F;  5ILJ A;  3ZCD A;  4JXY A;  3Q2Z A;  3RBM A;  3N5H F;  5IKA A;  2E8V A;  5IMP A;  3P8L A;  4OMH A;  4MC8 A;  5ER8 A;  4GA3 A;  3LSN A;  2PS8 A;  2E8X A;  2OA6 A;  1VG2 A;  1UBV A;  2E8T A;  5EAU A;  3N3L F;  5B00 A;  3UCA A;  2AZK A;  1JFA A;  1JFG A;  3WEI A;  2PS5 A;  3N46 F;  2E8W A;  3SDR A;  3LZ9 A;  4LLT A;  1WL3 A;  3AQB B;  2ZCO A;  3Q2Q A;  5JUZ F;  2P1C A;  1V4I A;  3W7F A;  2F7M F;  3OAC B;  3WCD A;  4KKM A;  3KB9 A;  3KRO A;  2F92 F;  4NFI F;  3S9V A;  5HN8 A;  2ONH A;  4LFE A;  5IVG A;  2ZCS A;  5IK6 A;  3ZOU A;  3SDV A;  3RYE A;  1FPS A;  4DXJ A;  4LUU A;  3WCC A;  4JXN A;  4JZB A;  5EAT A;  3KRA B;  3M9U A;  5IMI A;  3DYH A;  1UBX A;  3TFP A;  1KIZ A;  4KQ5 A;  4ZQ8 A;  5CG5 A;  4N9U A;  4KVY A;  2Z4X A;  3LK5 A;  3Q1O A;  4K10 A;  5ILI A;  3S4J A;  3WC9 A;  2ZEU A;  3N0F A;  4F62 A;  3WJO A;  3N6K F;  3LG5 A;  2J1O A;  1VG7 A;  2AET A;  4EA2 A;  1VG6 A;  1UBY A;  5IMN A;  3N0G A;  3Q30 A;  2QIS A;  3VJC A;  3CKE A;  2FOR A;  5DGM F;  1V4J A;  2ZY1 A;  3ADZ A;  5C05 A;  4FP4 A;  2F9K F;  4OGU A;  3SDU A;  3CC9 A;  2PS6 A;  3N45 F;  1PS1 A;  5HN7 A;  3WCL A;  4UMJ A;  3APZ A;  4EA1 A;  2ZCQ A;  5DJR F;  3NPR A;  4JYX A;  3BNX A;  3SDT A;  5IK0 A;  5A0I A;  4EA0 A;  1YV5 A;  2VF6 A;  3NRI A;  4NFK F;  3V66 A;  5DIQ F;  3ZL6 A;  3PYA A;  3KRF A;  3G4D A;  5DHI A;  3OYR A;  2E4O A;  4KPD A;  4DZW A;  4KVW A;  4RNQ A;  2F8Z F;  3WCA A;  5B03 A;  1N22 A;  2ZEV A;  2E90 A;  4LFV F;  1N24 A;  4QXS F;  2ONG A;  3RYW A;  3KRO B;  5JV2 F;  3EFQ A;  5CG6 A;  2I19 A;  2J5C A;  4PVX F;  3ACW A;  4LA5 A;  2AZJ A;  2E93 A;  3KRP A;  3P5P A;  2EWG A;  4MC3 A;  3LGK A;  5ERM A;  1VG3 A;  1RTR A;  1WMW A;  2RAH A;  4N1Z F;  3WCE A;  3ZMB A;  3WCJ A;  5A0K A;  3QKC A;  5IL8 A;  3ACY A;  3IPI A;  1DGP A;  3RMG A;  4LTV A;  2F94 F;  2Z4Y A;  3M02 A;  4XQT F;  1WL1 A;  5B0K A;  3N5J F;  3VJE A;  3QQV A;  4DI5 A;  4GP1 A;  5DGS F;  3ID0 A;  5JA0 F;  3TS7 A;  1YYQ A;  3ACX A;  3ICM A;  4H5D F;  3SDQ A;  5B02 A;  1UBW A;  1HX9 A;  3VJ9 A;  1YHM A;  1YQ7 A;  5DW7 A;  5B0M A;  1N1Z A;  3WJK A;  3N49 F;  4XQR F;  3KRC A;  5HNA A;  2Z7H A;  3WE9 A;  3OAB B;  1WKZ A;  3VJ8 A;  4NKE A;  3M00 A;  2F8C F;  4KUX A;  4WK5 A;  3V1X A;  1HM4 A;  4KWD A;  3WEG A;  1YYS A;  5E8L A;  3WCH A;  1HXA A;  5B01 A;  3P8R A;  4H5E F;  4F6X A;  3N3D A;  3PYB A;  4NKF A;  5DZ2 A;  3CP6 A;  1YJ4 A;  3PH7 A;  4LLS A;  4KPJ A;  1YYR A;  3TFV A;  3KRA A;  2AEK A;  3VJA A;  3EGT A;  3WSA A;  1VG4 A;  4NG6 A;  4PVY F;  4JVJ F;  5E8K A;  3LOM A;  3KBK A;  4KK2 A;  3WCM A;  4LPG F;  3KRF B;  3WEJ A;  2OPN A;  4RXE A;  2E92 A;  3MZV A;  4QPF A;  3P41 A;  5I1U A;  5B0J A;  3WCB A;  5ERN A;  4OKM A;  5HN9 A;  4DWG A;  5E8H A;  4LXW A;  3WCF A;  3LEE A;  2H8O A;  1WY0 A;  4LZ0 A;  2FTZ A;  2E91 A;  4LTZ A;  3N1W F;  3N1V F;  1HXC A;  2DH4 A;  4LA6 A;  4P0W A;  4NUA A;  1N23 A;  3ICN A;  3ICZ A;  3KRP B;  5AYP A;  2Q58 A;  4H5C F;  1V4E A;  3G4F A;  1V4H A;  5KSX F;  3VJD A;  3ICK A;  3SAE A;  5IL3 A;  4E1E A;  5ILD A;  3ZMC A;  4GP2 A;  1YYU A;  3WJN A;  5JV1 F;  5A0J A;  4KVI A;  2Z7I A;  5IK9 A;  5JV0 F;  3LJI A;  3AQC B;  4KQU A;  3PDE A;  3LGZ B;  3VJB A;  1HM7 A;  1N1B A;  3LVS A;  2E95 A;  2E8U A;  2OGD A;  4JZX A;  5IKH A;  4KVD A;  1HXG A;  3TFN A;  1KIY A;  1YHL A;  2Q9Z A;  5DGN F;  5AFX A;  3WCG A;  3MAV A;  3LDW A;  3IBA A;  3M0G A;  3WEF A;  3B7L A;  3LMD A;  5ERO A;  3EZ3 A;  4Q23 A;  4XQS F;  5AEL A;  5EAS A;  3V1V A;  3WCI A;  1YYT A;  5ILZ A;  1EZF A;  3KRC B;  2ZCR A;  2Q80 A;  4FJQ A;  1RQJ A;  5IM1 A;  5ILH A;  4L2X F;  2Z52 A;  3AE0 A;  3DYG A;  4OKZ A;  2Z78 A;  2AZL A;  3DYF A;  3OAC A;  4F6V A;  5AHU B;  4E9Z A;  3WEH A;  2E94 A;  1DI1 A;  1YHK A;  4RXC A;  4RXD A;  2O1O A;  1V4K A;  2Z4Z A;  4LZC A;  5IN8 A;  5ILK A;  4MC0 A;  5DHK A;  3P5R A;  5B0L A;  4E9U A;  2PS7 A;  3AQ0 A;  3ASX A;  3M01 A;  4P0X A;  5B0I A;  4DEM F;  1WL2 A;  2Z50 A;  1RQI A;  4P0V A;  1WL0 A;  5H9D A;  2J1P A;  4GAX A;  2F89 F;  4LPH F;  4RYP A;  1N21 A;  1N20 A;  3TC1 A;  4LIX A;  3NPK A;  2Q9Y A;  2Z4V A;  2AEL A;  1ZW5 A;  3OAB A;  4KQS A;  4DWB A;  4RXA A;  3PKO A;  2Z4W A;  3LLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...