2ZCSA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-700
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title A cholesterol biosynthesis inhibitor blocks Staphylococcus aureus virulence.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 118
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2007-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2zcsA00
1UBYA 2Z7IA 1N20A 4FP4A 1N22A 4P0VA 1VG4A 3N1WF 4XQTF 1RQIA 3CKEA 4NUAA 5B0KA 2Z4XA 3WCLA 5A0KA 4JZBA 4LZCA 4OKMA 3VJCA 4XQRF 2ZCRA 3G4FA 4NKEA 4FJQA 4GP2A 4EA1A 2E92A 3SAEA 2ONGA 4KVWA 3N3DA 2PS8A 5JV1F 3AE0A 3P41A 3LGKA 3WCAA 3TFNA 3VJDA 3N0FA 1N21A 3IBAA 3RBMA 5IM1A 3AQCB 5IK9A 5ILKA 1V4KA 2Z50A 4DWBA 3LMDA 3RMGA 3KRAA 3WEGA 3WCGA 2Z4ZA 2E95A 4N9UA 4RXAA 2PS7A 3Q2ZA 5EASA 3V1VA 3WCCA 2PS5A 3WEFA 4OGUA 5ERMA 3WCEA 3LGZB 3SDRA 4JXNA 5KSXF 2F9KF 2Z52A 1UBVA 5C05A 3WC9A 5B0LA 1ZW5A 3UCAA 2Z4YA 4EA2A 3Q30A 4F62A 2QISA 4KPJA 5DZ2A 2PS4A 3WCIA 3PYBA 3QKCA 4LFEA 5IN8A 2P1CA 3SDVA 3WCHA 1JFAA 4F6XA 5EAUA 3Q2QA 4KQUA 3ICKA 5DJPF 4HD1A 5DHIA 1N24A 3ICZA 4KWDA 4NKFA 4DI5A 4NFKF 1YHKA 5JUZF 4RNQA 5IVGA 4LFVF 5ILZA 3N46F 5IKAA 2EWGA 2E8VA 2E94A 2RAHA 3KROA 2AZKA 3RYEA 3CP6A 1DI1A 4LTZA 3G4DA 3OABB 2E93A 1KIZA 3M00A 5DW7A 5IL3A 4NFIF 5JA0F 2I19A 3KRPA 2OPNA 3AQ0A 3KRFB 3VJ8A 1HXAA 4DXJA 5IKHA 3N45F 2PS6A 4RXDA 4E1EA 3MZVA 5B00A 3M9UA 4GP1A 3VJAA 1V4JA 5ILHA 4H5CF 1WL3A 4KVIA 3APZA 1N23A 4MC8A 4KQ5A 2E8TA 3LDWA 2ZCQA 3S4JA 2E8XA 3DYGA 5E8KA 1YYTA 4PVYF 4DHDA 3N1VF 5A0JA 4RXCA 3WCMA 3V1XA 2E4OA 3TS7A 4LZ3A 4LPHF 2AEKA 4KPDA 4KK2A 3WEKA 3M0GA 3ACWA 5B0JA 5HN8A 5I1UA 3N6KF 3EGTA 3ZCDA 4E9ZA 2VF6A 3LEEA 3WSBA 3B7LA 4QPFA 3ASXA 1RQJA 5DJRF 1RTRA 3KRAB 3WE9A 3KRCA 2OGDA 5B03A 4GAXA 4LUUA 2E8WA 5E8HA 3M02A 4KKMA 1UBXA 4DEMF 4LXWA 3KB9A 2ZCSA 5AELA 3N3LF 2F7MF 3WEIA 5H9DA 4L2XF 1JFGA 3P8LA 3PYAA 3WEHA 1YHMA 1VG3A 3AQBB 5JV2F 3ICMA 4OKZA 2ONHA 5B02A 4ZQ8A 1V4IA 1WL1A 3BNYA 3KROB 4F6VA 3MAVA 3SDTA 3LLWA 5ILIA 5E8LA 5IK0A 3OACA 3N0GA 1WL2A 1YQ7A 4LFGA 2Z4WA 5B0IA 3EZ3A 4XQSF 5IMPA 4KUXA 4UMJA 1HXCA 3KRPB 3WJKA 3WCDA 1HM4A 3QQVA 3WEJA 5B0MA 3WCBA 5ILDA 2OA6A 4NFJF 3ID0A 3V66A 2F8CF 1YYUA 3N5HF 3CC9A 4JZXA 5A0IA 3WJOA 5AFXA 3EFQA 3ZOUA 1V4EA 1HM7A 4QXSF 5ILYA 3ZMBA 2O1OA 2E8UA 2FTZA 5IMNA 3M01A 3P8RA 1UBWA 1YJ4A 4NG6A 3LZ9A 3PKOA 4OMHA 2ZCOA 4LLTA 1WY0A 3VJBA 2E91A 3PH7A 5CG6A 4LA5A 4EA0A 5ERNA 3DYFA 2Q80A 1N1ZA 2F89F 5EROA 2F92F 1YYSA 3LOMA 3ACXA 5HN7A 3PDEA 3VJEA 4P0WA 1FPSA 5CG5A 5ILJA 1HXGA 4LOBA 3LG5A 4DWGA 2H8OA 3WCFA 4PVXF 5B01A 2Z78A 4Q23A 3SDUA 3ZL6A 2Q9ZA 5DHKA 3OYRA 2Z4VA 3VJ9A 3WCJA 5DIQF 1HX9A 3NRIA 3KRCB 4LLSA 4DZWA 3N49F 2AELA 1YYQA 3LK5A 2ZY1A 5IK6A 2DH4A 2F8ZF 5JV0F 4MC0A 3ICNA 4KVYA 3DYHA 3ZMCA 3IPIA 2J1OA 1WMWA 4P0XA 3NPRA 4JVJF 3S9VA 5ER8A 5DGNF 3P5PA 1N1BA 4WK5A 2Q9YA 3P5RA 2E90A 1VG7A 2Q58A 3LVSA 4RXEA 1WL0A 4JYXA 4LZ0A 1YYRA 5HN9A 2AZLA 2ZEVA 4OMGA 5IMIA 3Q1OA 2FORA 4RYPA 1VG6A 5AYPA 4GA3A 3OACB 1DGPA 4KVDA 5HNAA 1V4HA 4N1ZF 3RYWA 3LSNA 4KQSA 1YV5A 4LA6A 3TFPA 3LJIA 3W7FA 2ZEUA 1VG2A 3NF2A 4H5DF 3OABA 4KFAA 3KBKA 4H5EF 3ACYA 1PS1A 2F94F 5EATA 4K10A 1EZFA 3ADZA 2OPMA 2Z7HA 3TC1A 2AZJA 5IL8A 5DGMF 4E9UA 4MC3A 2J5CA 3KRFA 3NPKA 5DGSF 3WJNA 4LPGF 1KIYA 5DJVF 4LTVA 3SDQA 3TFVA 2AETA 4JXYA 5AHUB 2J1PA 3WSAA 1YHLA 1WKZA 4LIXA 3BNXA 3N5JF
chains in the Genus database with same CATH superfamily
1UBYA 2Z7IA 1N20A 4FP4A 1N22A 4P0VA 1VG4A 3N1WF 4XQTF 1RQIA 3CKEA 4NUAA 5B0KA 2Z4XA 3WCLA 5A0KA 4JZBA 4LZCA 4OKMA 3VJCA 4XQRF 2ZCRA 3G4FA 4NKEA 4FJQA 4GP2A 4EA1A 2E92A 3SAEA 2ONGA 4KVWA 3N3DA 2PS8A 5JV1F 3AE0A 3P41A 3LGKA 3WCAA 3TFNA 3VJDA 3N0FA 1N21A 3IBAA 3RBMA 5IM1A 3AQCB 5IK9A 5ILKA 1V4KA 2Z50A 4DWBA 3LMDA 3RMGA 3KRAA 3WEGA 3WCGA 2Z4ZA 2E95A 4N9UA 4RXAA 2PS7A 3Q2ZA 5EASA 3V1VA 3WCCA 2PS5A 3WEFA 4OGUA 5ERMA 3WCEA 3LGZB 3SDRA 4JXNA 5KSXF 2F9KF 2Z52A 1UBVA 5C05A 3WC9A 5B0LA 1ZW5A 3UCAA 2Z4YA 4EA2A 3Q30A 4F62A 2QISA 4KPJA 5DZ2A 2PS4A 3WCIA 3PYBA 3QKCA 4LFEA 5IN8A 2P1CA 3SDVA 3WCHA 1JFAA 4F6XA 5EAUA 3Q2QA 4KQUA 3ICKA 5DJPF 4HD1A 5DHIA 1N24A 3ICZA 4KWDA 4NKFA 4DI5A 4NFKF 1YHKA 5JUZF 4RNQA 5IVGA 4LFVF 5ILZA 3N46F 5IKAA 2EWGA 2E8VA 2E94A 2RAHA 3KROA 2AZKA 3RYEA 3CP6A 1DI1A 4LTZA 3G4DA 3OABB 2E93A 1KIZA 3M00A 5DW7A 5IL3A 4NFIF 5JA0F 2I19A 3KRPA 2OPNA 3AQ0A 3KRFB 3VJ8A 1HXAA 4DXJA 5IKHA 3N45F 2PS6A 4RXDA 4E1EA 3MZVA 5B00A 3M9UA 4GP1A 3VJAA 1V4JA 5ILHA 4H5CF 1WL3A 4KVIA 3APZA 1N23A 4MC8A 4KQ5A 2E8TA 3LDWA 2ZCQA 3S4JA 2E8XA 3DYGA 5E8KA 1YYTA 4PVYF 4DHDA 3N1VF 5A0JA 4RXCA 3WCMA 3V1XA 2E4OA 3TS7A 4LZ3A 4LPHF 2AEKA 4KPDA 4KK2A 3WEKA 3M0GA 3ACWA 5B0JA 5HN8A 5I1UA 3N6KF 3EGTA 3ZCDA 4E9ZA 2VF6A 3LEEA 3WSBA 3B7LA 4QPFA 3ASXA 1RQJA 5DJRF 1RTRA 3KRAB 3WE9A 3KRCA 2OGDA 5B03A 4GAXA 4LUUA 2E8WA 5E8HA 3M02A 4KKMA 1UBXA 4DEMF 4LXWA 3KB9A 2ZCSA 5AELA 3N3LF 2F7MF 3WEIA 5H9DA 4L2XF 1JFGA 3P8LA 3PYAA 3WEHA 1YHMA 1VG3A 3AQBB 5JV2F 3ICMA 4OKZA 2ONHA 5B02A 4ZQ8A 1V4IA 1WL1A 3BNYA 3KROB 4F6VA 3MAVA 3SDTA 3LLWA 5ILIA 5E8LA 5IK0A 3OACA 3N0GA 1WL2A 1YQ7A 4LFGA 2Z4WA 5B0IA 3EZ3A 4XQSF 5IMPA 4KUXA 4UMJA 1HXCA 3KRPB 3WJKA 3WCDA 1HM4A 3QQVA 3WEJA 5B0MA 3WCBA 5ILDA 2OA6A 4NFJF 3ID0A 3V66A 2F8CF 1YYUA 3N5HF 3CC9A 4JZXA 5A0IA 3WJOA 5AFXA 3EFQA 3ZOUA 1V4EA 1HM7A 4QXSF 5ILYA 3ZMBA 2O1OA 2E8UA 2FTZA 5IMNA 3M01A 3P8RA 1UBWA 1YJ4A 4NG6A 3LZ9A 3PKOA 4OMHA 2ZCOA 4LLTA 1WY0A 3VJBA 2E91A 3PH7A 5CG6A 4LA5A 4EA0A 5ERNA 3DYFA 2Q80A 1N1ZA 2F89F 5EROA 2F92F 1YYSA 3LOMA 3ACXA 5HN7A 3PDEA 3VJEA 4P0WA 1FPSA 5CG5A 5ILJA 1HXGA 4LOBA 3LG5A 4DWGA 2H8OA 3WCFA 4PVXF 5B01A 2Z78A 4Q23A 3SDUA 3ZL6A 2Q9ZA 5DHKA 3OYRA 2Z4VA 3VJ9A 3WCJA 5DIQF 1HX9A 3NRIA 3KRCB 4LLSA 4DZWA 3N49F 2AELA 1YYQA 3LK5A 2ZY1A 5IK6A 2DH4A 2F8ZF 5JV0F 4MC0A 3ICNA 4KVYA 3DYHA 3ZMCA 3IPIA 2J1OA 1WMWA 4P0XA 3NPRA 4JVJF 3S9VA 5ER8A 5DGNF 3P5PA 1N1BA 4WK5A 2Q9YA 3P5RA 2E90A 1VG7A 2Q58A 3LVSA 4RXEA 1WL0A 4JYXA 4LZ0A 1YYRA 5HN9A 2AZLA 2ZEVA 4OMGA 5IMIA 3Q1OA 2FORA 4RYPA 1VG6A 5AYPA 4GA3A 3OACB 1DGPA 4KVDA 5HNAA 1V4HA 4N1ZF 3RYWA 3LSNA 4KQSA 1YV5A 4LA6A 3TFPA 3LJIA 3W7FA 2ZEUA 1VG2A 3NF2A 4H5DF 3OABA 4KFAA 3KBKA 4H5EF 3ACYA 1PS1A 2F94F 5EATA 4K10A 1EZFA 3ADZA 2OPMA 2Z7HA 3TC1A 2AZJA 5IL8A 5DGMF 4E9UA 4MC3A 2J5CA 3KRFA 3NPKA 5DGSF 3WJNA 4LPGF 1KIYA 5DJVF 4LTVA 3SDQA 3TFVA 2AETA 4JXYA 5AHUB 2J1PA 3WSAA 1YHLA 1WKZA 4LIXA 3BNXA 3N5JF
chains in the Genus database with same CATH topology
1UBYA 2Z7IA 1N20A 4FP4A 1N22A 4P0VA 1VG4A 3N1WF 4XQTF 1RQIA 3CKEA 4NUAA 5B0KA 2Z4XA 3WCLA 5A0KA 4JZBA 4LZCA 4OKMA 3VJCA 4XQRF 2ZCRA 3G4FA 4NKEA 4FJQA 4GP2A 4EA1A 2E92A 3SAEA 2ONGA 4KVWA 3N3DA 2PS8A 5JV1F 3AE0A 3P41A 3LGKA 3WCAA 3TFNA 3VJDA 3N0FA 1N21A 3IBAA 3RBMA 5IM1A 3AQCB 5IK9A 5ILKA 1V4KA 2Z50A 4DWBA 3LMDA 3RMGA 3KRAA 3WEGA 3WCGA 2Z4ZA 2E95A 4N9UA 4RXAA 2PS7A 3Q2ZA 5EASA 3V1VA 3WCCA 2PS5A 3WEFA 4OGUA 5ERMA 3WCEA 3LGZB 3SDRA 4JXNA 5KSXF 2F9KF 2Z52A 1UBVA 5C05A 3WC9A 5B0LA 1ZW5A 3UCAA 2Z4YA 4EA2A 3Q30A 4F62A 2QISA 4KPJA 5DZ2A 2PS4A 3WCIA 3PYBA 3QKCA 4LFEA 5IN8A 2P1CA 3SDVA 3WCHA 1JFAA 4F6XA 5EAUA 3Q2QA 4KQUA 3ICKA 5DJPF 4HD1A 5DHIA 1N24A 3ICZA 4KWDA 4NKFA 4DI5A 4NFKF 1YHKA 5JUZF 4RNQA 5IVGA 4LFVF 5ILZA 3N46F 5IKAA 2EWGA 2E8VA 2E94A 2RAHA 3KROA 2AZKA 3RYEA 3CP6A 1DI1A 4LTZA 3G4DA 3OABB 2E93A 1KIZA 3M00A 5DW7A 5IL3A 4NFIF 5JA0F 2I19A 3KRPA 2OPNA 3AQ0A 3KRFB 3VJ8A 1HXAA 4DXJA 5IKHA 3N45F 2PS6A 4RXDA 4E1EA 3MZVA 5B00A 3M9UA 4GP1A 3VJAA 1V4JA 5ILHA 4H5CF 1WL3A 4KVIA 3APZA 1N23A 4MC8A 4KQ5A 2E8TA 3LDWA 2ZCQA 3S4JA 2E8XA 3DYGA 5E8KA 1YYTA 4PVYF 4DHDA 3N1VF 5A0JA 4RXCA 3WCMA 3V1XA 2E4OA 3TS7A 4LZ3A 4LPHF 2AEKA 4KPDA 4KK2A 3WEKA 3M0GA 3ACWA 5B0JA 5HN8A 5I1UA 3N6KF 3EGTA 3ZCDA 4E9ZA 2VF6A 3LEEA 3WSBA 3B7LA 4QPFA 3ASXA 1RQJA 5DJRF 1RTRA 3KRAB 3WE9A 3KRCA 2OGDA 5B03A 4GAXA 4LUUA 2E8WA 5E8HA 3M02A 4KKMA 1UBXA 4DEMF 4LXWA 3KB9A 2ZCSA 5AELA 3N3LF 2F7MF 3WEIA 5H9DA 4L2XF 1JFGA 3P8LA 3PYAA 3WEHA 1YHMA 1VG3A 3AQBB 5JV2F 3ICMA 4OKZA 2ONHA 5B02A 4ZQ8A 1V4IA 1WL1A 3BNYA 3KROB 4F6VA 3MAVA 3SDTA 3LLWA 5ILIA 5E8LA 5IK0A 3OACA 3N0GA 1WL2A 1YQ7A 4LFGA 2Z4WA 5B0IA 3EZ3A 4XQSF 5IMPA 4KUXA 4UMJA 1HXCA 3KRPB 3WJKA 3WCDA 1HM4A 3QQVA 3WEJA 5B0MA 3WCBA 5ILDA 2OA6A 4NFJF 3ID0A 3V66A 2F8CF 1YYUA 3N5HF 3CC9A 4JZXA 5A0IA 3WJOA 5AFXA 3EFQA 3ZOUA 1V4EA 1HM7A 4QXSF 5ILYA 3ZMBA 2O1OA 2E8UA 2FTZA 5IMNA 3M01A 3P8RA 1UBWA 1YJ4A 4NG6A 3LZ9A 3PKOA 4OMHA 2ZCOA 4LLTA 1WY0A 3VJBA 2E91A 3PH7A 5CG6A 4LA5A 4EA0A 5ERNA 3DYFA 2Q80A 1N1ZA 2F89F 5EROA 2F92F 1YYSA 3LOMA 3ACXA 5HN7A 3PDEA 3VJEA 4P0WA 1FPSA 5CG5A 5ILJA 1HXGA 4LOBA 3LG5A 4DWGA 2H8OA 3WCFA 4PVXF 5B01A 2Z78A 4Q23A 3SDUA 3ZL6A 2Q9ZA 5DHKA 3OYRA 2Z4VA 3VJ9A 3WCJA 5DIQF 1HX9A 3NRIA 3KRCB 4LLSA 4DZWA 3N49F 2AELA 1YYQA 3LK5A 2ZY1A 5IK6A 2DH4A 2F8ZF 5JV0F 4MC0A 3ICNA 4KVYA 3DYHA 3ZMCA 3IPIA 2J1OA 1WMWA 4P0XA 3NPRA 4JVJF 3S9VA 5ER8A 5DGNF 3P5PA 1N1BA 4WK5A 2Q9YA 3P5RA 2E90A 1VG7A 2Q58A 3LVSA 4RXEA 1WL0A 4JYXA 4LZ0A 1YYRA 5HN9A 2AZLA 2ZEVA 4OMGA 5IMIA 3Q1OA 2FORA 4RYPA 1VG6A 5AYPA 4GA3A 3OACB 1DGPA 4KVDA 5HNAA 1V4HA 4N1ZF 3RYWA 3LSNA 4KQSA 1YV5A 4LA6A 3TFPA 3LJIA 3W7FA 2ZEUA 1VG2A 3NF2A 4H5DF 3OABA 4KFAA 3KBKA 4H5EF 3ACYA 1PS1A 2F94F 5EATA 4K10A 1EZFA 3ADZA 2OPMA 2Z7HA 3TC1A 2AZJA 5IL8A 5DGMF 4E9UA 4MC3A 2J5CA 3KRFA 3NPKA 5DGSF 3WJNA 4LPGF 1KIYA 5DJVF 4LTVA 3SDQA 3TFVA 2AETA 4JXYA 5AHUB 2J1PA 3WSAA 1YHLA 1WKZA 4LIXA 3BNXA 3N5JF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UBY A;  2Z7I A;  1N20 A;  4FP4 A;  1N22 A;  4P0V A;  1VG4 A;  3N1W F;  4XQT F;  1RQI A;  3CKE A;  4NUA A;  5B0K A;  2Z4X A;  3WCL A;  5A0K A;  4JZB A;  4LZC A;  4OKM A;  3VJC A;  4XQR F;  2ZCR A;  3G4F A;  4NKE A;  4FJQ A;  4GP2 A;  4EA1 A;  2E92 A;  3SAE A;  2ONG A;  4KVW A;  3N3D A;  2PS8 A;  5JV1 F;  3AE0 A;  3P41 A;  3LGK A;  3WCA A;  3TFN A;  3VJD A;  3N0F A;  1N21 A;  3IBA A;  3RBM A;  5IM1 A;  3AQC B;  5IK9 A;  5ILK A;  1V4K A;  2Z50 A;  4DWB A;  3LMD A;  3RMG A;  3KRA A;  3WEG A;  3WCG A;  2Z4Z A;  2E95 A;  4N9U A;  4RXA A;  2PS7 A;  3Q2Z A;  5EAS A;  3V1V A;  3WCC A;  2PS5 A;  3WEF A;  4OGU A;  5ERM A;  3WCE A;  3LGZ B;  3SDR A;  4JXN A;  5KSX F;  2F9K F;  2Z52 A;  1UBV A;  5C05 A;  3WC9 A;  5B0L A;  1ZW5 A;  3UCA A;  2Z4Y A;  4EA2 A;  3Q30 A;  4F62 A;  2QIS A;  4KPJ A;  5DZ2 A;  2PS4 A;  3WCI A;  3PYB A;  3QKC A;  4LFE A;  5IN8 A;  2P1C A;  3SDV A;  3WCH A;  1JFA A;  4F6X A;  5EAU A;  3Q2Q A;  4KQU A;  3ICK A;  5DJP F;  4HD1 A;  5DHI A;  1N24 A;  3ICZ A;  4KWD A;  4NKF A;  4DI5 A;  4NFK F;  1YHK A;  5JUZ F;  4RNQ A;  5IVG A;  4LFV F;  5ILZ A;  3N46 F;  5IKA A;  2EWG A;  2E8V A;  2E94 A;  2RAH A;  3KRO A;  2AZK A;  3RYE A;  3CP6 A;  1DI1 A;  4LTZ A;  3G4D A;  3OAB B;  2E93 A;  1KIZ A;  3M00 A;  5DW7 A;  5IL3 A;  4NFI F;  5JA0 F;  2I19 A;  3KRP A;  2OPN A;  3AQ0 A;  3KRF B;  3VJ8 A;  1HXA A;  4DXJ A;  5IKH A;  3N45 F;  2PS6 A;  4RXD A;  4E1E A;  3MZV A;  5B00 A;  3M9U A;  4GP1 A;  3VJA A;  1V4J A;  5ILH A;  4H5C F;  1WL3 A;  4KVI A;  3APZ A;  1N23 A;  4MC8 A;  4KQ5 A;  2E8T A;  3LDW A;  2ZCQ A;  3S4J A;  2E8X A;  3DYG A;  5E8K A;  1YYT A;  4PVY F;  4DHD A;  3N1V F;  5A0J A;  4RXC A;  3WCM A;  3V1X A;  2E4O A;  3TS7 A;  4LZ3 A;  4LPH F;  2AEK A;  4KPD A;  4KK2 A;  3WEK A;  3M0G A;  3ACW A;  5B0J A;  5HN8 A;  5I1U A;  3N6K F;  3EGT A;  3ZCD A;  4E9Z A;  2VF6 A;  3LEE A;  3WSB A;  3B7L A;  4QPF A;  3ASX A;  1RQJ A;  5DJR F;  1RTR A;  3KRA B;  3WE9 A;  3KRC A;  2OGD A;  5B03 A;  4GAX A;  4LUU A;  2E8W A;  5E8H A;  3M02 A;  4KKM A;  1UBX A;  4DEM F;  4LXW A;  3KB9 A;  2ZCS A;  5AEL A;  3N3L F;  2F7M F;  3WEI A;  5H9D A;  4L2X F;  1JFG A;  3P8L A;  3PYA A;  3WEH A;  1YHM A;  1VG3 A;  3AQB B;  5JV2 F;  3ICM A;  4OKZ A;  2ONH A;  5B02 A;  4ZQ8 A;  1V4I A;  1WL1 A;  3BNY A;  3KRO B;  4F6V A;  3MAV A;  3SDT A;  3LLW A;  5ILI A;  5E8L A;  5IK0 A;  3OAC A;  3N0G A;  1WL2 A;  1YQ7 A;  4LFG A;  2Z4W A;  5B0I A;  3EZ3 A;  4XQS F;  5IMP A;  4KUX A;  4UMJ A;  1HXC A;  3KRP B;  3WJK A;  3WCD A;  1HM4 A;  3QQV A;  3WEJ A;  5B0M A;  3WCB A;  5ILD A;  2OA6 A;  4NFJ F;  3ID0 A;  3V66 A;  2F8C F;  1YYU A;  3N5H F;  3CC9 A;  4JZX A;  5A0I A;  3WJO A;  5AFX A;  3EFQ A;  3ZOU A;  1V4E A;  1HM7 A;  4QXS F;  5ILY A;  3ZMB A;  2O1O A;  2E8U A;  2FTZ A;  5IMN A;  3M01 A;  3P8R A;  1UBW A;  1YJ4 A;  4NG6 A;  3LZ9 A;  3PKO A;  4OMH A;  2ZCO A;  4LLT A;  1WY0 A;  3VJB A;  2E91 A;  3PH7 A;  5CG6 A;  4LA5 A;  4EA0 A;  5ERN A;  3DYF A;  2Q80 A;  1N1Z A;  2F89 F;  5ERO A;  2F92 F;  1YYS A;  3LOM A;  3ACX A;  5HN7 A;  3PDE A;  3VJE A;  4P0W A;  1FPS A;  5CG5 A;  5ILJ A;  1HXG A;  4LOB A;  3LG5 A;  4DWG A;  2H8O A;  3WCF A;  4PVX F;  5B01 A;  2Z78 A;  4Q23 A;  3SDU A;  3ZL6 A;  2Q9Z A;  5DHK A;  3OYR A;  2Z4V A;  3VJ9 A;  3WCJ A;  5DIQ F;  1HX9 A;  3NRI A;  3KRC B;  4LLS A;  4DZW A;  3N49 F;  2AEL A;  1YYQ A;  3LK5 A;  2ZY1 A;  5IK6 A;  2DH4 A;  2F8Z F;  5JV0 F;  4MC0 A;  3ICN A;  4KVY A;  3DYH A;  3ZMC A;  3IPI A;  2J1O A;  1WMW A;  4P0X A;  3NPR A;  4JVJ F;  3S9V A;  5ER8 A;  5DGN F;  3P5P A;  1N1B A;  4WK5 A;  2Q9Y A;  3P5R A;  2E90 A;  1VG7 A;  2Q58 A;  3LVS A;  4RXE A;  1WL0 A;  4JYX A;  4LZ0 A;  1YYR A;  5HN9 A;  2AZL A;  2ZEV A;  4OMG A;  5IMI A;  3Q1O A;  2FOR A;  4RYP A;  1VG6 A;  5AYP A;  4GA3 A;  3OAC B;  1DGP A;  4KVD A;  5HNA A;  1V4H A;  4N1Z F;  3RYW A;  3LSN A;  4KQS A;  1YV5 A;  4LA6 A;  3TFP A;  3LJI A;  3W7F A;  2ZEU A;  1VG2 A;  3NF2 A;  4H5D F;  3OAB A;  4KFA A;  3KBK A;  4H5E F;  3ACY A;  1PS1 A;  2F94 F;  5EAT A;  4K10 A;  1EZF A;  3ADZ A;  2OPM A;  2Z7H A;  3TC1 A;  2AZJ A;  5IL8 A;  5DGM F;  4E9U A;  4MC3 A;  2J5C A;  3KRF A;  3NPK A;  5DGS F;  3WJN A;  4LPG F;  1KIY A;  5DJV F;  4LTV A;  3SDQ A;  3TFV A;  2AET A;  4JXY A;  5AHU B;  2J1P A;  3WSA A;  1YHL A;  1WKZ A;  4LIX A;  3BNX A;  3N5J F; 
#chains in the Genus database with same CATH topology
 1UBY A;  2Z7I A;  1N20 A;  4FP4 A;  1N22 A;  4P0V A;  1VG4 A;  3N1W F;  4XQT F;  1RQI A;  3CKE A;  4NUA A;  5B0K A;  2Z4X A;  3WCL A;  5A0K A;  4JZB A;  4LZC A;  4OKM A;  3VJC A;  4XQR F;  2ZCR A;  3G4F A;  4NKE A;  4FJQ A;  4GP2 A;  4EA1 A;  2E92 A;  3SAE A;  2ONG A;  4KVW A;  3N3D A;  2PS8 A;  5JV1 F;  3AE0 A;  3P41 A;  3LGK A;  3WCA A;  3TFN A;  3VJD A;  3N0F A;  1N21 A;  3IBA A;  3RBM A;  5IM1 A;  3AQC B;  5IK9 A;  5ILK A;  1V4K A;  2Z50 A;  4DWB A;  3LMD A;  3RMG A;  3KRA A;  3WEG A;  3WCG A;  2Z4Z A;  2E95 A;  4N9U A;  4RXA A;  2PS7 A;  3Q2Z A;  5EAS A;  3V1V A;  3WCC A;  2PS5 A;  3WEF A;  4OGU A;  5ERM A;  3WCE A;  3LGZ B;  3SDR A;  4JXN A;  5KSX F;  2F9K F;  2Z52 A;  1UBV A;  5C05 A;  3WC9 A;  5B0L A;  1ZW5 A;  3UCA A;  2Z4Y A;  4EA2 A;  3Q30 A;  4F62 A;  2QIS A;  4KPJ A;  5DZ2 A;  2PS4 A;  3WCI A;  3PYB A;  3QKC A;  4LFE A;  5IN8 A;  2P1C A;  3SDV A;  3WCH A;  1JFA A;  4F6X A;  5EAU A;  3Q2Q A;  4KQU A;  3ICK A;  5DJP F;  4HD1 A;  5DHI A;  1N24 A;  3ICZ A;  4KWD A;  4NKF A;  4DI5 A;  4NFK F;  1YHK A;  5JUZ F;  4RNQ A;  5IVG A;  4LFV F;  5ILZ A;  3N46 F;  5IKA A;  2EWG A;  2E8V A;  2E94 A;  2RAH A;  3KRO A;  2AZK A;  3RYE A;  3CP6 A;  1DI1 A;  4LTZ A;  3G4D A;  3OAB B;  2E93 A;  1KIZ A;  3M00 A;  5DW7 A;  5IL3 A;  4NFI F;  5JA0 F;  2I19 A;  3KRP A;  2OPN A;  3AQ0 A;  3KRF B;  3VJ8 A;  1HXA A;  4DXJ A;  5IKH A;  3N45 F;  2PS6 A;  4RXD A;  4E1E A;  3MZV A;  5B00 A;  3M9U A;  4GP1 A;  3VJA A;  1V4J A;  5ILH A;  4H5C F;  1WL3 A;  4KVI A;  3APZ A;  1N23 A;  4MC8 A;  4KQ5 A;  2E8T A;  3LDW A;  2ZCQ A;  3S4J A;  2E8X A;  3DYG A;  5E8K A;  1YYT A;  4PVY F;  4DHD A;  3N1V F;  5A0J A;  4RXC A;  3WCM A;  3V1X A;  2E4O A;  3TS7 A;  4LZ3 A;  4LPH F;  2AEK A;  4KPD A;  4KK2 A;  3WEK A;  3M0G A;  3ACW A;  5B0J A;  5HN8 A;  5I1U A;  3N6K F;  3EGT A;  3ZCD A;  4E9Z A;  2VF6 A;  3LEE A;  3WSB A;  3B7L A;  4QPF A;  3ASX A;  1RQJ A;  5DJR F;  1RTR A;  3KRA B;  3WE9 A;  3KRC A;  2OGD A;  5B03 A;  4GAX A;  4LUU A;  2E8W A;  5E8H A;  3M02 A;  4KKM A;  1UBX A;  4DEM F;  4LXW A;  3KB9 A;  2ZCS A;  5AEL A;  3N3L F;  2F7M F;  3WEI A;  5H9D A;  4L2X F;  1JFG A;  3P8L A;  3PYA A;  3WEH A;  1YHM A;  1VG3 A;  3AQB B;  5JV2 F;  3ICM A;  4OKZ A;  2ONH A;  5B02 A;  4ZQ8 A;  1V4I A;  1WL1 A;  3BNY A;  3KRO B;  4F6V A;  3MAV A;  3SDT A;  3LLW A;  5ILI A;  5E8L A;  5IK0 A;  3OAC A;  3N0G A;  1WL2 A;  1YQ7 A;  4LFG A;  2Z4W A;  5B0I A;  3EZ3 A;  4XQS F;  5IMP A;  4KUX A;  4UMJ A;  1HXC A;  3KRP B;  3WJK A;  3WCD A;  1HM4 A;  3QQV A;  3WEJ A;  5B0M A;  3WCB A;  5ILD A;  2OA6 A;  4NFJ F;  3ID0 A;  3V66 A;  2F8C F;  1YYU A;  3N5H F;  3CC9 A;  4JZX A;  5A0I A;  3WJO A;  5AFX A;  3EFQ A;  3ZOU A;  1V4E A;  1HM7 A;  4QXS F;  5ILY A;  3ZMB A;  2O1O A;  2E8U A;  2FTZ A;  5IMN A;  3M01 A;  3P8R A;  1UBW A;  1YJ4 A;  4NG6 A;  3LZ9 A;  3PKO A;  4OMH A;  2ZCO A;  4LLT A;  1WY0 A;  3VJB A;  2E91 A;  3PH7 A;  5CG6 A;  4LA5 A;  4EA0 A;  5ERN A;  3DYF A;  2Q80 A;  1N1Z A;  2F89 F;  5ERO A;  2F92 F;  1YYS A;  3LOM A;  3ACX A;  5HN7 A;  3PDE A;  3VJE A;  4P0W A;  1FPS A;  5CG5 A;  5ILJ A;  1HXG A;  4LOB A;  3LG5 A;  4DWG A;  2H8O A;  3WCF A;  4PVX F;  5B01 A;  2Z78 A;  4Q23 A;  3SDU A;  3ZL6 A;  2Q9Z A;  5DHK A;  3OYR A;  2Z4V A;  3VJ9 A;  3WCJ A;  5DIQ F;  1HX9 A;  3NRI A;  3KRC B;  4LLS A;  4DZW A;  3N49 F;  2AEL A;  1YYQ A;  3LK5 A;  2ZY1 A;  5IK6 A;  2DH4 A;  2F8Z F;  5JV0 F;  4MC0 A;  3ICN A;  4KVY A;  3DYH A;  3ZMC A;  3IPI A;  2J1O A;  1WMW A;  4P0X A;  3NPR A;  4JVJ F;  3S9V A;  5ER8 A;  5DGN F;  3P5P A;  1N1B A;  4WK5 A;  2Q9Y A;  3P5R A;  2E90 A;  1VG7 A;  2Q58 A;  3LVS A;  4RXE A;  1WL0 A;  4JYX A;  4LZ0 A;  1YYR A;  5HN9 A;  2AZL A;  2ZEV A;  4OMG A;  5IMI A;  3Q1O A;  2FOR A;  4RYP A;  1VG6 A;  5AYP A;  4GA3 A;  3OAC B;  1DGP A;  4KVD A;  5HNA A;  1V4H A;  4N1Z F;  3RYW A;  3LSN A;  4KQS A;  1YV5 A;  4LA6 A;  3TFP A;  3LJI A;  3W7F A;  2ZEU A;  1VG2 A;  3NF2 A;  4H5D F;  3OAB A;  4KFA A;  3KBK A;  4H5E F;  3ACY A;  1PS1 A;  2F94 F;  5EAT A;  4K10 A;  1EZF A;  3ADZ A;  2OPM A;  2Z7H A;  3TC1 A;  2AZJ A;  5IL8 A;  5DGM F;  4E9U A;  4MC3 A;  2J5C A;  3KRF A;  3NPK A;  5DGS F;  3WJN A;  4LPG F;  1KIY A;  5DJV F;  4LTV A;  3SDQ A;  3TFV A;  2AET A;  4JXY A;  5AHU B;  2J1P A;  3WSA A;  1YHL A;  1WKZ A;  4LIX A;  3BNX A;  3N5J F; 
#chains in the Genus database with same CATH homology
 1UBY A;  2Z7I A;  1N20 A;  4FP4 A;  1N22 A;  4P0V A;  1VG4 A;  3N1W F;  4XQT F;  1RQI A;  3CKE A;  4NUA A;  5B0K A;  2Z4X A;  3WCL A;  5A0K A;  4JZB A;  4LZC A;  4OKM A;  3VJC A;  4XQR F;  2ZCR A;  3G4F A;  4NKE A;  4FJQ A;  4GP2 A;  4EA1 A;  2E92 A;  3SAE A;  2ONG A;  4KVW A;  3N3D A;  2PS8 A;  5JV1 F;  3AE0 A;  3P41 A;  3LGK A;  3WCA A;  3TFN A;  3VJD A;  3N0F A;  1N21 A;  3IBA A;  3RBM A;  5IM1 A;  3AQC B;  5IK9 A;  5ILK A;  1V4K A;  2Z50 A;  4DWB A;  3LMD A;  3RMG A;  3KRA A;  3WEG A;  3WCG A;  2Z4Z A;  2E95 A;  4N9U A;  4RXA A;  2PS7 A;  3Q2Z A;  5EAS A;  3V1V A;  3WCC A;  2PS5 A;  3WEF A;  4OGU A;  5ERM A;  3WCE A;  3LGZ B;  3SDR A;  4JXN A;  5KSX F;  2F9K F;  2Z52 A;  1UBV A;  5C05 A;  3WC9 A;  5B0L A;  1ZW5 A;  3UCA A;  2Z4Y A;  4EA2 A;  3Q30 A;  4F62 A;  2QIS A;  4KPJ A;  5DZ2 A;  2PS4 A;  3WCI A;  3PYB A;  3QKC A;  4LFE A;  5IN8 A;  2P1C A;  3SDV A;  3WCH A;  1JFA A;  4F6X A;  5EAU A;  3Q2Q A;  4KQU A;  3ICK A;  5DJP F;  4HD1 A;  5DHI A;  1N24 A;  3ICZ A;  4KWD A;  4NKF A;  4DI5 A;  4NFK F;  1YHK A;  5JUZ F;  4RNQ A;  5IVG A;  4LFV F;  5ILZ A;  3N46 F;  5IKA A;  2EWG A;  2E8V A;  2E94 A;  2RAH A;  3KRO A;  2AZK A;  3RYE A;  3CP6 A;  1DI1 A;  4LTZ A;  3G4D A;  3OAB B;  2E93 A;  1KIZ A;  3M00 A;  5DW7 A;  5IL3 A;  4NFI F;  5JA0 F;  2I19 A;  3KRP A;  2OPN A;  3AQ0 A;  3KRF B;  3VJ8 A;  1HXA A;  4DXJ A;  5IKH A;  3N45 F;  2PS6 A;  4RXD A;  4E1E A;  3MZV A;  5B00 A;  3M9U A;  4GP1 A;  3VJA A;  1V4J A;  5ILH A;  4H5C F;  1WL3 A;  4KVI A;  3APZ A;  1N23 A;  4MC8 A;  4KQ5 A;  2E8T A;  3LDW A;  2ZCQ A;  3S4J A;  2E8X A;  3DYG A;  5E8K A;  1YYT A;  4PVY F;  4DHD A;  3N1V F;  5A0J A;  4RXC A;  3WCM A;  3V1X A;  2E4O A;  3TS7 A;  4LZ3 A;  4LPH F;  2AEK A;  4KPD A;  4KK2 A;  3WEK A;  3M0G A;  3ACW A;  5B0J A;  5HN8 A;  5I1U A;  3N6K F;  3EGT A;  3ZCD A;  4E9Z A;  2VF6 A;  3LEE A;  3WSB A;  3B7L A;  4QPF A;  3ASX A;  1RQJ A;  5DJR F;  1RTR A;  3KRA B;  3WE9 A;  3KRC A;  2OGD A;  5B03 A;  4GAX A;  4LUU A;  2E8W A;  5E8H A;  3M02 A;  4KKM A;  1UBX A;  4DEM F;  4LXW A;  3KB9 A;  2ZCS A;  5AEL A;  3N3L F;  2F7M F;  3WEI A;  5H9D A;  4L2X F;  1JFG A;  3P8L A;  3PYA A;  3WEH A;  1YHM A;  1VG3 A;  3AQB B;  5JV2 F;  3ICM A;  4OKZ A;  2ONH A;  5B02 A;  4ZQ8 A;  1V4I A;  1WL1 A;  3BNY A;  3KRO B;  4F6V A;  3MAV A;  3SDT A;  3LLW A;  5ILI A;  5E8L A;  5IK0 A;  3OAC A;  3N0G A;  1WL2 A;  1YQ7 A;  4LFG A;  2Z4W A;  5B0I A;  3EZ3 A;  4XQS F;  5IMP A;  4KUX A;  4UMJ A;  1HXC A;  3KRP B;  3WJK A;  3WCD A;  1HM4 A;  3QQV A;  3WEJ A;  5B0M A;  3WCB A;  5ILD A;  2OA6 A;  4NFJ F;  3ID0 A;  3V66 A;  2F8C F;  1YYU A;  3N5H F;  3CC9 A;  4JZX A;  5A0I A;  3WJO A;  5AFX A;  3EFQ A;  3ZOU A;  1V4E A;  1HM7 A;  4QXS F;  5ILY A;  3ZMB A;  2O1O A;  2E8U A;  2FTZ A;  5IMN A;  3M01 A;  3P8R A;  1UBW A;  1YJ4 A;  4NG6 A;  3LZ9 A;  3PKO A;  4OMH A;  2ZCO A;  4LLT A;  1WY0 A;  3VJB A;  2E91 A;  3PH7 A;  5CG6 A;  4LA5 A;  4EA0 A;  5ERN A;  3DYF A;  2Q80 A;  1N1Z A;  2F89 F;  5ERO A;  2F92 F;  1YYS A;  3LOM A;  3ACX A;  5HN7 A;  3PDE A;  3VJE A;  4P0W A;  1FPS A;  5CG5 A;  5ILJ A;  1HXG A;  4LOB A;  3LG5 A;  4DWG A;  2H8O A;  3WCF A;  4PVX F;  5B01 A;  2Z78 A;  4Q23 A;  3SDU A;  3ZL6 A;  2Q9Z A;  5DHK A;  3OYR A;  2Z4V A;  3VJ9 A;  3WCJ A;  5DIQ F;  1HX9 A;  3NRI A;  3KRC B;  4LLS A;  4DZW A;  3N49 F;  2AEL A;  1YYQ A;  3LK5 A;  2ZY1 A;  5IK6 A;  2DH4 A;  2F8Z F;  5JV0 F;  4MC0 A;  3ICN A;  4KVY A;  3DYH A;  3ZMC A;  3IPI A;  2J1O A;  1WMW A;  4P0X A;  3NPR A;  4JVJ F;  3S9V A;  5ER8 A;  5DGN F;  3P5P A;  1N1B A;  4WK5 A;  2Q9Y A;  3P5R A;  2E90 A;  1VG7 A;  2Q58 A;  3LVS A;  4RXE A;  1WL0 A;  4JYX A;  4LZ0 A;  1YYR A;  5HN9 A;  2AZL A;  2ZEV A;  4OMG A;  5IMI A;  3Q1O A;  2FOR A;  4RYP A;  1VG6 A;  5AYP A;  4GA3 A;  3OAC B;  1DGP A;  4KVD A;  5HNA A;  1V4H A;  4N1Z F;  3RYW A;  3LSN A;  4KQS A;  1YV5 A;  4LA6 A;  3TFP A;  3LJI A;  3W7F A;  2ZEU A;  1VG2 A;  3NF2 A;  4H5D F;  3OAB A;  4KFA A;  3KBK A;  4H5E F;  3ACY A;  1PS1 A;  2F94 F;  5EAT A;  4K10 A;  1EZF A;  3ADZ A;  2OPM A;  2Z7H A;  3TC1 A;  2AZJ A;  5IL8 A;  5DGM F;  4E9U A;  4MC3 A;  2J5C A;  3KRF A;  3NPK A;  5DGS F;  3WJN A;  4LPG F;  1KIY A;  5DJV F;  4LTV A;  3SDQ A;  3TFV A;  2AET A;  4JXY A;  5AHU B;  2J1P A;  3WSA A;  1YHL A;  1WKZ A;  4LIX A;  3BNX A;  3N5J F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...