2ZCSA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-700
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dehydrosqualene synthase
publication title A cholesterol biosynthesis inhibitor blocks Staphylococcus aureus virulence.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 118
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2007-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2zcsA00
3OACA 5B01A 3ACXA 4LTVA 2Q80A 3SDUA 3ACWA 5B03A 1DI1A 4LLSA 2AEKA 4EA1A 5CG5A 3Q30A 4JXNA 1HM7A 2ZCQA 3EFQA 3ID0A 4LOBA 4P0WA 5ILHA 3NPKA 1WKZA 3SDVA 4KVIA 2Q9YA 3APZA 3OABB 3P5RA 1YYRA 5B0JA 4DXJA 3CC9A 3ZCDA 5A0KA 3WCAA 2J5CA 3N6KF 3TFPA 1PS1A 4GA3A 3SAEA 2P1CA 4N1ZF 3M0GA 1HXGA 4F6VA 3AQBB 3SDTA 2O1OA 4UMJA 2F92F 4DHDA 3DYHA 3LDWA 3QKCA 5B0LA 4KVYA 3M9UA 1HXAA 3RMGA 3KRPA 3CP6A 5HN7A 3WCCA 3Q2ZA 3WCDA 2J1OA 4LA5A 3Q2QA 2Z4VA 2E8WA 2E90A 2Z4WA 1WL1A 4OKZA 3VJCA 3VJAA 3PDEA 4P0VA 2AELA 2E4OA 5AYPA 3N0GA 2Z52A 1VG3A 4KQ5A 5DJVF 2VF6A 3P5PA 3WCBA 5ILIA 3KB9A 5H9DA 3TC1A 4DZWA 3WCLA 4E9ZA 4NG6A 3IBAA 3V1XA 1V4KA 2E8XA 3SDRA 4N9UA 4LA6A 4KUXA 5IMIA 5AFXA 5EROA 5IKHA 3AQCB 4DWBA 3LSNA 2J1PA 5DHIA 3VJ8A 1KIZA 4KVWA 3LLWA 5E8LA 2Z4ZA 4RXDA 3KRAA 5AELA 3WJKA 3LGKA 1YHKA 3ICMA 1WMWA 3S9VA 3BNXA 5DJPF 4HD1A 5B0IA 3ASXA 5B02A 4JZXA 3OABA 5E8HA 3KRFB 2E92A 3V1VA 1N20A 3N0FA 5B0KA 3VJBA 4KK2A 5HN8A 3N3LF 4LXWA 5ILYA 3WCHA 2OPNA 3WJNA 1RTRA 5ERNA 3VJEA 3WCJA 3RBMA 3ICZA 4QXSF 5IL3A 2Z4YA 2AZKA 4L2XF 3UCAA 2ZCRA 3VJ9A 4H5DF 4NFJF 3WEFA 1RQIA 5HN9A 3NRIA 3N5JF 1VG7A 1VG4A 4KQUA 4H5EF 3LZ9A 2E95A 5DGMF 1VG2A 2Z7HA 4FP4A 4GAXA 4LZ0A 3WJOA 3N1VF 4RXEA 3G4DA 1WL2A 1YV5A 4DEMF 1ZW5A 1DGPA 5EAUA 3WSAA 5ERMA 3LVSA 2Z78A 3M00A 5ILKA 4PVYF 3TFVA 2E8TA 1JFAA 5CG6A 5AHUB 5DIQF 4QPFA 5HNAA 5A0IA 3WCEA 4RXCA 3N46F 5A0JA 4NUAA 5IM1A 2H8OA 2AZJA 3LGZB 3M02A 2Z7IA 1N1ZA 4KPDA 4JVJF 4NFIF 4PVXF 2PS4A 4Q23A 3S4JA 4LUUA 3OYRA 3WCMA 3WSBA 3WEIA 2PS5A 2OA6A 1UBYA 2Z4XA 5DJRF 4MC0A 3P41A 5DGSF 5IMPA 2E8UA 4LTZA 1HX9A 2ZEVA 4KFAA 1KIYA 4OGUA 5IKAA 2ZCOA 2OPMA 3MAVA 4KWDA 3WEKA 5ILDA 5IMNA 4F62A 3RYWA 4XQTF 5JV2F 5ILJA 1V4JA 1HM4A 3LG5A 3KROB 4LLTA 1V4EA 3WC9A 1YHMA 2Z50A 3KBKA 4MC8A 4RXAA 3WCGA 3ZMCA 2F9KF 2ZEUA 5KSXF 2ZY1A 3KRCB 3ICNA 4KKMA 4RNQA 5JV0F 1YYQA 1YQ7A 3PH7A 4P0XA 2F89F 4K10A 3NF2A 3LJIA 3WEHA 3WEGA 2F94F 4NFKF 3NPRA 4NKFA 2FTZA 5IK9A 1V4IA 2Q9ZA 4GP1A 1UBVA 5B0MA 4KPJA 4LIXA 4F6XA 2DH4A 4LFVF 5EATA 4RYPA 4KQSA 1RQJA 4WK5A 3BNYA 3TFNA 3ZL6A 4LPHF 5IK6A 1YYUA 5IN8A 1FPSA 1V4HA 2F8CF 4LZCA 4JXYA 3QQVA 3VJDA 1YYTA 1WY0A 5JA0F 2ZCSA 5EASA 4OMGA 1UBWA 4NKEA 5IK0A 3W7FA 3KRAB 3N3DA 3N5HF 3WCFA 2F8ZF 5DZ2A 4DWGA 1N24A 2F7MF 5DHKA 3TS7A 4E1EA 5C05A 3N1WF 5E8KA 4JZBA 3KROA 3KRCA 4H5CF 4E9UA 5IVGA 3WE9A 3AQ0A 3ZMBA 3WEJA 3DYGA 2ONHA 1YYSA 4OKMA 2EWGA 3KRFA 4DI5A 3PKOA 4FJQA 4MC3A 3Q1OA 3G4FA 3OACB 2E93A 1N21A 4LZ3A 4ZQ8A 2AETA 2AZLA 5JV1F 3EGTA 3ACYA 3AE0A 3N49F 4LFEA 2RAHA 1WL0A 2E8VA 4EA0A 4XQSF 1UBXA 4OMHA 3V66A 1VG6A 3ICKA 3SDQA 3LMDA 3DYFA 3ZOUA 3N45F 3LOMA 3M01A 1JFGA 1N1BA 5I1UA 3LK5A 3WCIA 2FORA 3EZ3A 5DGNF 2QISA 3P8RA 1N23A 5IL8A 4LFGA 2PS7A 2OGDA 3IPIA 3LEEA 2PS8A 3P8LA 3B7LA 1N22A 3KRPB 4GP2A 2Q58A 3ADZA 3MZVA 1EZFA 4JYXA 5ER8A 3CKEA 5ILZA 5DW7A 1YHLA 1YJ4A 4EA2A 3PYAA 3PYBA 5JUZF 4KVDA 2E91A 3RYEA 4LPGF 4XQRF 2ONGA 5B00A 2I19A 2PS6A 1WL3A 1HXCA 2E94A
chains in the Genus database with same CATH superfamily
3OACA 5B01A 3ACXA 4LTVA 2Q80A 3SDUA 3ACWA 5B03A 1DI1A 4LLSA 2AEKA 4EA1A 5CG5A 3Q30A 4JXNA 1HM7A 2ZCQA 3EFQA 3ID0A 4LOBA 4P0WA 5ILHA 3NPKA 1WKZA 3SDVA 4KVIA 2Q9YA 3APZA 3OABB 3P5RA 1YYRA 5B0JA 4DXJA 3CC9A 3ZCDA 5A0KA 3WCAA 2J5CA 3N6KF 3TFPA 1PS1A 4GA3A 3SAEA 2P1CA 4N1ZF 3M0GA 1HXGA 4F6VA 3AQBB 3SDTA 2O1OA 4UMJA 2F92F 4DHDA 3DYHA 3LDWA 3QKCA 5B0LA 4KVYA 3M9UA 1HXAA 3RMGA 3KRPA 3CP6A 5HN7A 3WCCA 3Q2ZA 3WCDA 2J1OA 4LA5A 3Q2QA 2Z4VA 2E8WA 2E90A 2Z4WA 1WL1A 4OKZA 3VJCA 3VJAA 3PDEA 4P0VA 2AELA 2E4OA 5AYPA 3N0GA 2Z52A 1VG3A 4KQ5A 5DJVF 2VF6A 3P5PA 3WCBA 5ILIA 3KB9A 5H9DA 3TC1A 4DZWA 3WCLA 4E9ZA 4NG6A 3IBAA 3V1XA 1V4KA 2E8XA 3SDRA 4N9UA 4LA6A 4KUXA 5IMIA 5AFXA 5EROA 5IKHA 3AQCB 4DWBA 3LSNA 2J1PA 5DHIA 3VJ8A 1KIZA 4KVWA 3LLWA 5E8LA 2Z4ZA 4RXDA 3KRAA 5AELA 3WJKA 3LGKA 1YHKA 3ICMA 1WMWA 3S9VA 3BNXA 5DJPF 4HD1A 5B0IA 3ASXA 5B02A 4JZXA 3OABA 5E8HA 3KRFB 2E92A 3V1VA 1N20A 3N0FA 5B0KA 3VJBA 4KK2A 5HN8A 3N3LF 4LXWA 5ILYA 3WCHA 2OPNA 3WJNA 1RTRA 5ERNA 3VJEA 3WCJA 3RBMA 3ICZA 4QXSF 5IL3A 2Z4YA 2AZKA 4L2XF 3UCAA 2ZCRA 3VJ9A 4H5DF 4NFJF 3WEFA 1RQIA 5HN9A 3NRIA 3N5JF 1VG7A 1VG4A 4KQUA 4H5EF 3LZ9A 2E95A 5DGMF 1VG2A 2Z7HA 4FP4A 4GAXA 4LZ0A 3WJOA 3N1VF 4RXEA 3G4DA 1WL2A 1YV5A 4DEMF 1ZW5A 1DGPA 5EAUA 3WSAA 5ERMA 3LVSA 2Z78A 3M00A 5ILKA 4PVYF 3TFVA 2E8TA 1JFAA 5CG6A 5AHUB 5DIQF 4QPFA 5HNAA 5A0IA 3WCEA 4RXCA 3N46F 5A0JA 4NUAA 5IM1A 2H8OA 2AZJA 3LGZB 3M02A 2Z7IA 1N1ZA 4KPDA 4JVJF 4NFIF 4PVXF 2PS4A 4Q23A 3S4JA 4LUUA 3OYRA 3WCMA 3WSBA 3WEIA 2PS5A 2OA6A 1UBYA 2Z4XA 5DJRF 4MC0A 3P41A 5DGSF 5IMPA 2E8UA 4LTZA 1HX9A 2ZEVA 4KFAA 1KIYA 4OGUA 5IKAA 2ZCOA 2OPMA 3MAVA 4KWDA 3WEKA 5ILDA 5IMNA 4F62A 3RYWA 4XQTF 5JV2F 5ILJA 1V4JA 1HM4A 3LG5A 3KROB 4LLTA 1V4EA 3WC9A 1YHMA 2Z50A 3KBKA 4MC8A 4RXAA 3WCGA 3ZMCA 2F9KF 2ZEUA 5KSXF 2ZY1A 3KRCB 3ICNA 4KKMA 4RNQA 5JV0F 1YYQA 1YQ7A 3PH7A 4P0XA 2F89F 4K10A 3NF2A 3LJIA 3WEHA 3WEGA 2F94F 4NFKF 3NPRA 4NKFA 2FTZA 5IK9A 1V4IA 2Q9ZA 4GP1A 1UBVA 5B0MA 4KPJA 4LIXA 4F6XA 2DH4A 4LFVF 5EATA 4RYPA 4KQSA 1RQJA 4WK5A 3BNYA 3TFNA 3ZL6A 4LPHF 5IK6A 1YYUA 5IN8A 1FPSA 1V4HA 2F8CF 4LZCA 4JXYA 3QQVA 3VJDA 1YYTA 1WY0A 5JA0F 2ZCSA 5EASA 4OMGA 1UBWA 4NKEA 5IK0A 3W7FA 3KRAB 3N3DA 3N5HF 3WCFA 2F8ZF 5DZ2A 4DWGA 1N24A 2F7MF 5DHKA 3TS7A 4E1EA 5C05A 3N1WF 5E8KA 4JZBA 3KROA 3KRCA 4H5CF 4E9UA 5IVGA 3WE9A 3AQ0A 3ZMBA 3WEJA 3DYGA 2ONHA 1YYSA 4OKMA 2EWGA 3KRFA 4DI5A 3PKOA 4FJQA 4MC3A 3Q1OA 3G4FA 3OACB 2E93A 1N21A 4LZ3A 4ZQ8A 2AETA 2AZLA 5JV1F 3EGTA 3ACYA 3AE0A 3N49F 4LFEA 2RAHA 1WL0A 2E8VA 4EA0A 4XQSF 1UBXA 4OMHA 3V66A 1VG6A 3ICKA 3SDQA 3LMDA 3DYFA 3ZOUA 3N45F 3LOMA 3M01A 1JFGA 1N1BA 5I1UA 3LK5A 3WCIA 2FORA 3EZ3A 5DGNF 2QISA 3P8RA 1N23A 5IL8A 4LFGA 2PS7A 2OGDA 3IPIA 3LEEA 2PS8A 3P8LA 3B7LA 1N22A 3KRPB 4GP2A 2Q58A 3ADZA 3MZVA 1EZFA 4JYXA 5ER8A 3CKEA 5ILZA 5DW7A 1YHLA 1YJ4A 4EA2A 3PYAA 3PYBA 5JUZF 4KVDA 2E91A 3RYEA 4LPGF 4XQRF 2ONGA 5B00A 2I19A 2PS6A 1WL3A 1HXCA 2E94A
chains in the Genus database with same CATH topology
3OACA 5B01A 3ACXA 4LTVA 2Q80A 3SDUA 3ACWA 5B03A 1DI1A 4LLSA 2AEKA 4EA1A 5CG5A 3Q30A 4JXNA 1HM7A 2ZCQA 3EFQA 3ID0A 4LOBA 4P0WA 5ILHA 3NPKA 1WKZA 3SDVA 4KVIA 2Q9YA 3APZA 3OABB 3P5RA 1YYRA 5B0JA 4DXJA 3CC9A 3ZCDA 5A0KA 3WCAA 2J5CA 3N6KF 3TFPA 1PS1A 4GA3A 3SAEA 2P1CA 4N1ZF 3M0GA 1HXGA 4F6VA 3AQBB 3SDTA 2O1OA 4UMJA 2F92F 4DHDA 3DYHA 3LDWA 3QKCA 5B0LA 4KVYA 3M9UA 1HXAA 3RMGA 3KRPA 3CP6A 5HN7A 3WCCA 3Q2ZA 3WCDA 2J1OA 4LA5A 3Q2QA 2Z4VA 2E8WA 2E90A 2Z4WA 1WL1A 4OKZA 3VJCA 3VJAA 3PDEA 4P0VA 2AELA 2E4OA 5AYPA 3N0GA 2Z52A 1VG3A 4KQ5A 5DJVF 2VF6A 3P5PA 3WCBA 5ILIA 3KB9A 5H9DA 3TC1A 4DZWA 3WCLA 4E9ZA 4NG6A 3IBAA 3V1XA 1V4KA 2E8XA 3SDRA 4N9UA 4LA6A 4KUXA 5IMIA 5AFXA 5EROA 5IKHA 3AQCB 4DWBA 3LSNA 2J1PA 5DHIA 3VJ8A 1KIZA 4KVWA 3LLWA 5E8LA 2Z4ZA 4RXDA 3KRAA 5AELA 3WJKA 3LGKA 1YHKA 3ICMA 1WMWA 3S9VA 3BNXA 5DJPF 4HD1A 5B0IA 3ASXA 5B02A 4JZXA 3OABA 5E8HA 3KRFB 2E92A 3V1VA 1N20A 3N0FA 5B0KA 3VJBA 4KK2A 5HN8A 3N3LF 4LXWA 5ILYA 3WCHA 2OPNA 3WJNA 1RTRA 5ERNA 3VJEA 3WCJA 3RBMA 3ICZA 4QXSF 5IL3A 2Z4YA 2AZKA 4L2XF 3UCAA 2ZCRA 3VJ9A 4H5DF 4NFJF 3WEFA 1RQIA 5HN9A 3NRIA 3N5JF 1VG7A 1VG4A 4KQUA 4H5EF 3LZ9A 2E95A 5DGMF 1VG2A 2Z7HA 4FP4A 4GAXA 4LZ0A 3WJOA 3N1VF 4RXEA 3G4DA 1WL2A 1YV5A 4DEMF 1ZW5A 1DGPA 5EAUA 3WSAA 5ERMA 3LVSA 2Z78A 3M00A 5ILKA 4PVYF 3TFVA 2E8TA 1JFAA 5CG6A 5AHUB 5DIQF 4QPFA 5HNAA 5A0IA 3WCEA 4RXCA 3N46F 5A0JA 4NUAA 5IM1A 2H8OA 2AZJA 3LGZB 3M02A 2Z7IA 1N1ZA 4KPDA 4JVJF 4NFIF 4PVXF 2PS4A 4Q23A 3S4JA 4LUUA 3OYRA 3WCMA 3WSBA 3WEIA 2PS5A 2OA6A 1UBYA 2Z4XA 5DJRF 4MC0A 3P41A 5DGSF 5IMPA 2E8UA 4LTZA 1HX9A 2ZEVA 4KFAA 1KIYA 4OGUA 5IKAA 2ZCOA 2OPMA 3MAVA 4KWDA 3WEKA 5ILDA 5IMNA 4F62A 3RYWA 4XQTF 5JV2F 5ILJA 1V4JA 1HM4A 3LG5A 3KROB 4LLTA 1V4EA 3WC9A 1YHMA 2Z50A 3KBKA 4MC8A 4RXAA 3WCGA 3ZMCA 2F9KF 2ZEUA 5KSXF 2ZY1A 3KRCB 3ICNA 4KKMA 4RNQA 5JV0F 1YYQA 1YQ7A 3PH7A 4P0XA 2F89F 4K10A 3NF2A 3LJIA 3WEHA 3WEGA 2F94F 4NFKF 3NPRA 4NKFA 2FTZA 5IK9A 1V4IA 2Q9ZA 4GP1A 1UBVA 5B0MA 4KPJA 4LIXA 4F6XA 2DH4A 4LFVF 5EATA 4RYPA 4KQSA 1RQJA 4WK5A 3BNYA 3TFNA 3ZL6A 4LPHF 5IK6A 1YYUA 5IN8A 1FPSA 1V4HA 2F8CF 4LZCA 4JXYA 3QQVA 3VJDA 1YYTA 1WY0A 5JA0F 2ZCSA 5EASA 4OMGA 1UBWA 4NKEA 5IK0A 3W7FA 3KRAB 3N3DA 3N5HF 3WCFA 2F8ZF 5DZ2A 4DWGA 1N24A 2F7MF 5DHKA 3TS7A 4E1EA 5C05A 3N1WF 5E8KA 4JZBA 3KROA 3KRCA 4H5CF 4E9UA 5IVGA 3WE9A 3AQ0A 3ZMBA 3WEJA 3DYGA 2ONHA 1YYSA 4OKMA 2EWGA 3KRFA 4DI5A 3PKOA 4FJQA 4MC3A 3Q1OA 3G4FA 3OACB 2E93A 1N21A 4LZ3A 4ZQ8A 2AETA 2AZLA 5JV1F 3EGTA 3ACYA 3AE0A 3N49F 4LFEA 2RAHA 1WL0A 2E8VA 4EA0A 4XQSF 1UBXA 4OMHA 3V66A 1VG6A 3ICKA 3SDQA 3LMDA 3DYFA 3ZOUA 3N45F 3LOMA 3M01A 1JFGA 1N1BA 5I1UA 3LK5A 3WCIA 2FORA 3EZ3A 5DGNF 2QISA 3P8RA 1N23A 5IL8A 4LFGA 2PS7A 2OGDA 3IPIA 3LEEA 2PS8A 3P8LA 3B7LA 1N22A 3KRPB 4GP2A 2Q58A 3ADZA 3MZVA 1EZFA 4JYXA 5ER8A 3CKEA 5ILZA 5DW7A 1YHLA 1YJ4A 4EA2A 3PYAA 3PYBA 5JUZF 4KVDA 2E91A 3RYEA 4LPGF 4XQRF 2ONGA 5B00A 2I19A 2PS6A 1WL3A 1HXCA 2E94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OAC A;  5B01 A;  3ACX A;  4LTV A;  2Q80 A;  3SDU A;  3ACW A;  5B03 A;  1DI1 A;  4LLS A;  2AEK A;  4EA1 A;  5CG5 A;  3Q30 A;  4JXN A;  1HM7 A;  2ZCQ A;  3EFQ A;  3ID0 A;  4LOB A;  4P0W A;  5ILH A;  3NPK A;  1WKZ A;  3SDV A;  4KVI A;  2Q9Y A;  3APZ A;  3OAB B;  3P5R A;  1YYR A;  5B0J A;  4DXJ A;  3CC9 A;  3ZCD A;  5A0K A;  3WCA A;  2J5C A;  3N6K F;  3TFP A;  1PS1 A;  4GA3 A;  3SAE A;  2P1C A;  4N1Z F;  3M0G A;  1HXG A;  4F6V A;  3AQB B;  3SDT A;  2O1O A;  4UMJ A;  2F92 F;  4DHD A;  3DYH A;  3LDW A;  3QKC A;  5B0L A;  4KVY A;  3M9U A;  1HXA A;  3RMG A;  3KRP A;  3CP6 A;  5HN7 A;  3WCC A;  3Q2Z A;  3WCD A;  2J1O A;  4LA5 A;  3Q2Q A;  2Z4V A;  2E8W A;  2E90 A;  2Z4W A;  1WL1 A;  4OKZ A;  3VJC A;  3VJA A;  3PDE A;  4P0V A;  2AEL A;  2E4O A;  5AYP A;  3N0G A;  2Z52 A;  1VG3 A;  4KQ5 A;  5DJV F;  2VF6 A;  3P5P A;  3WCB A;  5ILI A;  3KB9 A;  5H9D A;  3TC1 A;  4DZW A;  3WCL A;  4E9Z A;  4NG6 A;  3IBA A;  3V1X A;  1V4K A;  2E8X A;  3SDR A;  4N9U A;  4LA6 A;  4KUX A;  5IMI A;  5AFX A;  5ERO A;  5IKH A;  3AQC B;  4DWB A;  3LSN A;  2J1P A;  5DHI A;  3VJ8 A;  1KIZ A;  4KVW A;  3LLW A;  5E8L A;  2Z4Z A;  4RXD A;  3KRA A;  5AEL A;  3WJK A;  3LGK A;  1YHK A;  3ICM A;  1WMW A;  3S9V A;  3BNX A;  5DJP F;  4HD1 A;  5B0I A;  3ASX A;  5B02 A;  4JZX A;  3OAB A;  5E8H A;  3KRF B;  2E92 A;  3V1V A;  1N20 A;  3N0F A;  5B0K A;  3VJB A;  4KK2 A;  5HN8 A;  3N3L F;  4LXW A;  5ILY A;  3WCH A;  2OPN A;  3WJN A;  1RTR A;  5ERN A;  3VJE A;  3WCJ A;  3RBM A;  3ICZ A;  4QXS F;  5IL3 A;  2Z4Y A;  2AZK A;  4L2X F;  3UCA A;  2ZCR A;  3VJ9 A;  4H5D F;  4NFJ F;  3WEF A;  1RQI A;  5HN9 A;  3NRI A;  3N5J F;  1VG7 A;  1VG4 A;  4KQU A;  4H5E F;  3LZ9 A;  2E95 A;  5DGM F;  1VG2 A;  2Z7H A;  4FP4 A;  4GAX A;  4LZ0 A;  3WJO A;  3N1V F;  4RXE A;  3G4D A;  1WL2 A;  1YV5 A;  4DEM F;  1ZW5 A;  1DGP A;  5EAU A;  3WSA A;  5ERM A;  3LVS A;  2Z78 A;  3M00 A;  5ILK A;  4PVY F;  3TFV A;  2E8T A;  1JFA A;  5CG6 A;  5AHU B;  5DIQ F;  4QPF A;  5HNA A;  5A0I A;  3WCE A;  4RXC A;  3N46 F;  5A0J A;  4NUA A;  5IM1 A;  2H8O A;  2AZJ A;  3LGZ B;  3M02 A;  2Z7I A;  1N1Z A;  4KPD A;  4JVJ F;  4NFI F;  4PVX F;  2PS4 A;  4Q23 A;  3S4J A;  4LUU A;  3OYR A;  3WCM A;  3WSB A;  3WEI A;  2PS5 A;  2OA6 A;  1UBY A;  2Z4X A;  5DJR F;  4MC0 A;  3P41 A;  5DGS F;  5IMP A;  2E8U A;  4LTZ A;  1HX9 A;  2ZEV A;  4KFA A;  1KIY A;  4OGU A;  5IKA A;  2ZCO A;  2OPM A;  3MAV A;  4KWD A;  3WEK A;  5ILD A;  5IMN A;  4F62 A;  3RYW A;  4XQT F;  5JV2 F;  5ILJ A;  1V4J A;  1HM4 A;  3LG5 A;  3KRO B;  4LLT A;  1V4E A;  3WC9 A;  1YHM A;  2Z50 A;  3KBK A;  4MC8 A;  4RXA A;  3WCG A;  3ZMC A;  2F9K F;  2ZEU A;  5KSX F;  2ZY1 A;  3KRC B;  3ICN A;  4KKM A;  4RNQ A;  5JV0 F;  1YYQ A;  1YQ7 A;  3PH7 A;  4P0X A;  2F89 F;  4K10 A;  3NF2 A;  3LJI A;  3WEH A;  3WEG A;  2F94 F;  4NFK F;  3NPR A;  4NKF A;  2FTZ A;  5IK9 A;  1V4I A;  2Q9Z A;  4GP1 A;  1UBV A;  5B0M A;  4KPJ A;  4LIX A;  4F6X A;  2DH4 A;  4LFV F;  5EAT A;  4RYP A;  4KQS A;  1RQJ A;  4WK5 A;  3BNY A;  3TFN A;  3ZL6 A;  4LPH F;  5IK6 A;  1YYU A;  5IN8 A;  1FPS A;  1V4H A;  2F8C F;  4LZC A;  4JXY A;  3QQV A;  3VJD A;  1YYT A;  1WY0 A;  5JA0 F;  2ZCS A;  5EAS A;  4OMG A;  1UBW A;  4NKE A;  5IK0 A;  3W7F A;  3KRA B;  3N3D A;  3N5H F;  3WCF A;  2F8Z F;  5DZ2 A;  4DWG A;  1N24 A;  2F7M F;  5DHK A;  3TS7 A;  4E1E A;  5C05 A;  3N1W F;  5E8K A;  4JZB A;  3KRO A;  3KRC A;  4H5C F;  4E9U A;  5IVG A;  3WE9 A;  3AQ0 A;  3ZMB A;  3WEJ A;  3DYG A;  2ONH A;  1YYS A;  4OKM A;  2EWG A;  3KRF A;  4DI5 A;  3PKO A;  4FJQ A;  4MC3 A;  3Q1O A;  3G4F A;  3OAC B;  2E93 A;  1N21 A;  4LZ3 A;  4ZQ8 A;  2AET A;  2AZL A;  5JV1 F;  3EGT A;  3ACY A;  3AE0 A;  3N49 F;  4LFE A;  2RAH A;  1WL0 A;  2E8V A;  4EA0 A;  4XQS F;  1UBX A;  4OMH A;  3V66 A;  1VG6 A;  3ICK A;  3SDQ A;  3LMD A;  3DYF A;  3ZOU A;  3N45 F;  3LOM A;  3M01 A;  1JFG A;  1N1B A;  5I1U A;  3LK5 A;  3WCI A;  2FOR A;  3EZ3 A;  5DGN F;  2QIS A;  3P8R A;  1N23 A;  5IL8 A;  4LFG A;  2PS7 A;  2OGD A;  3IPI A;  3LEE A;  2PS8 A;  3P8L A;  3B7L A;  1N22 A;  3KRP B;  4GP2 A;  2Q58 A;  3ADZ A;  3MZV A;  1EZF A;  4JYX A;  5ER8 A;  3CKE A;  5ILZ A;  5DW7 A;  1YHL A;  1YJ4 A;  4EA2 A;  3PYA A;  3PYB A;  5JUZ F;  4KVD A;  2E91 A;  3RYE A;  4LPG F;  4XQR F;  2ONG A;  5B00 A;  2I19 A;  2PS6 A;  1WL3 A;  1HXC A;  2E94 A; 
#chains in the Genus database with same CATH topology
 3OAC A;  5B01 A;  3ACX A;  4LTV A;  2Q80 A;  3SDU A;  3ACW A;  5B03 A;  1DI1 A;  4LLS A;  2AEK A;  4EA1 A;  5CG5 A;  3Q30 A;  4JXN A;  1HM7 A;  2ZCQ A;  3EFQ A;  3ID0 A;  4LOB A;  4P0W A;  5ILH A;  3NPK A;  1WKZ A;  3SDV A;  4KVI A;  2Q9Y A;  3APZ A;  3OAB B;  3P5R A;  1YYR A;  5B0J A;  4DXJ A;  3CC9 A;  3ZCD A;  5A0K A;  3WCA A;  2J5C A;  3N6K F;  3TFP A;  1PS1 A;  4GA3 A;  3SAE A;  2P1C A;  4N1Z F;  3M0G A;  1HXG A;  4F6V A;  3AQB B;  3SDT A;  2O1O A;  4UMJ A;  2F92 F;  4DHD A;  3DYH A;  3LDW A;  3QKC A;  5B0L A;  4KVY A;  3M9U A;  1HXA A;  3RMG A;  3KRP A;  3CP6 A;  5HN7 A;  3WCC A;  3Q2Z A;  3WCD A;  2J1O A;  4LA5 A;  3Q2Q A;  2Z4V A;  2E8W A;  2E90 A;  2Z4W A;  1WL1 A;  4OKZ A;  3VJC A;  3VJA A;  3PDE A;  4P0V A;  2AEL A;  2E4O A;  5AYP A;  3N0G A;  2Z52 A;  1VG3 A;  4KQ5 A;  5DJV F;  2VF6 A;  3P5P A;  3WCB A;  5ILI A;  3KB9 A;  5H9D A;  3TC1 A;  4DZW A;  3WCL A;  4E9Z A;  4NG6 A;  3IBA A;  3V1X A;  1V4K A;  2E8X A;  3SDR A;  4N9U A;  4LA6 A;  4KUX A;  5IMI A;  5AFX A;  5ERO A;  5IKH A;  3AQC B;  4DWB A;  3LSN A;  2J1P A;  5DHI A;  3VJ8 A;  1KIZ A;  4KVW A;  3LLW A;  5E8L A;  2Z4Z A;  4RXD A;  3KRA A;  5AEL A;  3WJK A;  3LGK A;  1YHK A;  3ICM A;  1WMW A;  3S9V A;  3BNX A;  5DJP F;  4HD1 A;  5B0I A;  3ASX A;  5B02 A;  4JZX A;  3OAB A;  5E8H A;  3KRF B;  2E92 A;  3V1V A;  1N20 A;  3N0F A;  5B0K A;  3VJB A;  4KK2 A;  5HN8 A;  3N3L F;  4LXW A;  5ILY A;  3WCH A;  2OPN A;  3WJN A;  1RTR A;  5ERN A;  3VJE A;  3WCJ A;  3RBM A;  3ICZ A;  4QXS F;  5IL3 A;  2Z4Y A;  2AZK A;  4L2X F;  3UCA A;  2ZCR A;  3VJ9 A;  4H5D F;  4NFJ F;  3WEF A;  1RQI A;  5HN9 A;  3NRI A;  3N5J F;  1VG7 A;  1VG4 A;  4KQU A;  4H5E F;  3LZ9 A;  2E95 A;  5DGM F;  1VG2 A;  2Z7H A;  4FP4 A;  4GAX A;  4LZ0 A;  3WJO A;  3N1V F;  4RXE A;  3G4D A;  1WL2 A;  1YV5 A;  4DEM F;  1ZW5 A;  1DGP A;  5EAU A;  3WSA A;  5ERM A;  3LVS A;  2Z78 A;  3M00 A;  5ILK A;  4PVY F;  3TFV A;  2E8T A;  1JFA A;  5CG6 A;  5AHU B;  5DIQ F;  4QPF A;  5HNA A;  5A0I A;  3WCE A;  4RXC A;  3N46 F;  5A0J A;  4NUA A;  5IM1 A;  2H8O A;  2AZJ A;  3LGZ B;  3M02 A;  2Z7I A;  1N1Z A;  4KPD A;  4JVJ F;  4NFI F;  4PVX F;  2PS4 A;  4Q23 A;  3S4J A;  4LUU A;  3OYR A;  3WCM A;  3WSB A;  3WEI A;  2PS5 A;  2OA6 A;  1UBY A;  2Z4X A;  5DJR F;  4MC0 A;  3P41 A;  5DGS F;  5IMP A;  2E8U A;  4LTZ A;  1HX9 A;  2ZEV A;  4KFA A;  1KIY A;  4OGU A;  5IKA A;  2ZCO A;  2OPM A;  3MAV A;  4KWD A;  3WEK A;  5ILD A;  5IMN A;  4F62 A;  3RYW A;  4XQT F;  5JV2 F;  5ILJ A;  1V4J A;  1HM4 A;  3LG5 A;  3KRO B;  4LLT A;  1V4E A;  3WC9 A;  1YHM A;  2Z50 A;  3KBK A;  4MC8 A;  4RXA A;  3WCG A;  3ZMC A;  2F9K F;  2ZEU A;  5KSX F;  2ZY1 A;  3KRC B;  3ICN A;  4KKM A;  4RNQ A;  5JV0 F;  1YYQ A;  1YQ7 A;  3PH7 A;  4P0X A;  2F89 F;  4K10 A;  3NF2 A;  3LJI A;  3WEH A;  3WEG A;  2F94 F;  4NFK F;  3NPR A;  4NKF A;  2FTZ A;  5IK9 A;  1V4I A;  2Q9Z A;  4GP1 A;  1UBV A;  5B0M A;  4KPJ A;  4LIX A;  4F6X A;  2DH4 A;  4LFV F;  5EAT A;  4RYP A;  4KQS A;  1RQJ A;  4WK5 A;  3BNY A;  3TFN A;  3ZL6 A;  4LPH F;  5IK6 A;  1YYU A;  5IN8 A;  1FPS A;  1V4H A;  2F8C F;  4LZC A;  4JXY A;  3QQV A;  3VJD A;  1YYT A;  1WY0 A;  5JA0 F;  2ZCS A;  5EAS A;  4OMG A;  1UBW A;  4NKE A;  5IK0 A;  3W7F A;  3KRA B;  3N3D A;  3N5H F;  3WCF A;  2F8Z F;  5DZ2 A;  4DWG A;  1N24 A;  2F7M F;  5DHK A;  3TS7 A;  4E1E A;  5C05 A;  3N1W F;  5E8K A;  4JZB A;  3KRO A;  3KRC A;  4H5C F;  4E9U A;  5IVG A;  3WE9 A;  3AQ0 A;  3ZMB A;  3WEJ A;  3DYG A;  2ONH A;  1YYS A;  4OKM A;  2EWG A;  3KRF A;  4DI5 A;  3PKO A;  4FJQ A;  4MC3 A;  3Q1O A;  3G4F A;  3OAC B;  2E93 A;  1N21 A;  4LZ3 A;  4ZQ8 A;  2AET A;  2AZL A;  5JV1 F;  3EGT A;  3ACY A;  3AE0 A;  3N49 F;  4LFE A;  2RAH A;  1WL0 A;  2E8V A;  4EA0 A;  4XQS F;  1UBX A;  4OMH A;  3V66 A;  1VG6 A;  3ICK A;  3SDQ A;  3LMD A;  3DYF A;  3ZOU A;  3N45 F;  3LOM A;  3M01 A;  1JFG A;  1N1B A;  5I1U A;  3LK5 A;  3WCI A;  2FOR A;  3EZ3 A;  5DGN F;  2QIS A;  3P8R A;  1N23 A;  5IL8 A;  4LFG A;  2PS7 A;  2OGD A;  3IPI A;  3LEE A;  2PS8 A;  3P8L A;  3B7L A;  1N22 A;  3KRP B;  4GP2 A;  2Q58 A;  3ADZ A;  3MZV A;  1EZF A;  4JYX A;  5ER8 A;  3CKE A;  5ILZ A;  5DW7 A;  1YHL A;  1YJ4 A;  4EA2 A;  3PYA A;  3PYB A;  5JUZ F;  4KVD A;  2E91 A;  3RYE A;  4LPG F;  4XQR F;  2ONG A;  5B00 A;  2I19 A;  2PS6 A;  1WL3 A;  1HXC A;  2E94 A; 
#chains in the Genus database with same CATH homology
 3OAC A;  5B01 A;  3ACX A;  4LTV A;  2Q80 A;  3SDU A;  3ACW A;  5B03 A;  1DI1 A;  4LLS A;  2AEK A;  4EA1 A;  5CG5 A;  3Q30 A;  4JXN A;  1HM7 A;  2ZCQ A;  3EFQ A;  3ID0 A;  4LOB A;  4P0W A;  5ILH A;  3NPK A;  1WKZ A;  3SDV A;  4KVI A;  2Q9Y A;  3APZ A;  3OAB B;  3P5R A;  1YYR A;  5B0J A;  4DXJ A;  3CC9 A;  3ZCD A;  5A0K A;  3WCA A;  2J5C A;  3N6K F;  3TFP A;  1PS1 A;  4GA3 A;  3SAE A;  2P1C A;  4N1Z F;  3M0G A;  1HXG A;  4F6V A;  3AQB B;  3SDT A;  2O1O A;  4UMJ A;  2F92 F;  4DHD A;  3DYH A;  3LDW A;  3QKC A;  5B0L A;  4KVY A;  3M9U A;  1HXA A;  3RMG A;  3KRP A;  3CP6 A;  5HN7 A;  3WCC A;  3Q2Z A;  3WCD A;  2J1O A;  4LA5 A;  3Q2Q A;  2Z4V A;  2E8W A;  2E90 A;  2Z4W A;  1WL1 A;  4OKZ A;  3VJC A;  3VJA A;  3PDE A;  4P0V A;  2AEL A;  2E4O A;  5AYP A;  3N0G A;  2Z52 A;  1VG3 A;  4KQ5 A;  5DJV F;  2VF6 A;  3P5P A;  3WCB A;  5ILI A;  3KB9 A;  5H9D A;  3TC1 A;  4DZW A;  3WCL A;  4E9Z A;  4NG6 A;  3IBA A;  3V1X A;  1V4K A;  2E8X A;  3SDR A;  4N9U A;  4LA6 A;  4KUX A;  5IMI A;  5AFX A;  5ERO A;  5IKH A;  3AQC B;  4DWB A;  3LSN A;  2J1P A;  5DHI A;  3VJ8 A;  1KIZ A;  4KVW A;  3LLW A;  5E8L A;  2Z4Z A;  4RXD A;  3KRA A;  5AEL A;  3WJK A;  3LGK A;  1YHK A;  3ICM A;  1WMW A;  3S9V A;  3BNX A;  5DJP F;  4HD1 A;  5B0I A;  3ASX A;  5B02 A;  4JZX A;  3OAB A;  5E8H A;  3KRF B;  2E92 A;  3V1V A;  1N20 A;  3N0F A;  5B0K A;  3VJB A;  4KK2 A;  5HN8 A;  3N3L F;  4LXW A;  5ILY A;  3WCH A;  2OPN A;  3WJN A;  1RTR A;  5ERN A;  3VJE A;  3WCJ A;  3RBM A;  3ICZ A;  4QXS F;  5IL3 A;  2Z4Y A;  2AZK A;  4L2X F;  3UCA A;  2ZCR A;  3VJ9 A;  4H5D F;  4NFJ F;  3WEF A;  1RQI A;  5HN9 A;  3NRI A;  3N5J F;  1VG7 A;  1VG4 A;  4KQU A;  4H5E F;  3LZ9 A;  2E95 A;  5DGM F;  1VG2 A;  2Z7H A;  4FP4 A;  4GAX A;  4LZ0 A;  3WJO A;  3N1V F;  4RXE A;  3G4D A;  1WL2 A;  1YV5 A;  4DEM F;  1ZW5 A;  1DGP A;  5EAU A;  3WSA A;  5ERM A;  3LVS A;  2Z78 A;  3M00 A;  5ILK A;  4PVY F;  3TFV A;  2E8T A;  1JFA A;  5CG6 A;  5AHU B;  5DIQ F;  4QPF A;  5HNA A;  5A0I A;  3WCE A;  4RXC A;  3N46 F;  5A0J A;  4NUA A;  5IM1 A;  2H8O A;  2AZJ A;  3LGZ B;  3M02 A;  2Z7I A;  1N1Z A;  4KPD A;  4JVJ F;  4NFI F;  4PVX F;  2PS4 A;  4Q23 A;  3S4J A;  4LUU A;  3OYR A;  3WCM A;  3WSB A;  3WEI A;  2PS5 A;  2OA6 A;  1UBY A;  2Z4X A;  5DJR F;  4MC0 A;  3P41 A;  5DGS F;  5IMP A;  2E8U A;  4LTZ A;  1HX9 A;  2ZEV A;  4KFA A;  1KIY A;  4OGU A;  5IKA A;  2ZCO A;  2OPM A;  3MAV A;  4KWD A;  3WEK A;  5ILD A;  5IMN A;  4F62 A;  3RYW A;  4XQT F;  5JV2 F;  5ILJ A;  1V4J A;  1HM4 A;  3LG5 A;  3KRO B;  4LLT A;  1V4E A;  3WC9 A;  1YHM A;  2Z50 A;  3KBK A;  4MC8 A;  4RXA A;  3WCG A;  3ZMC A;  2F9K F;  2ZEU A;  5KSX F;  2ZY1 A;  3KRC B;  3ICN A;  4KKM A;  4RNQ A;  5JV0 F;  1YYQ A;  1YQ7 A;  3PH7 A;  4P0X A;  2F89 F;  4K10 A;  3NF2 A;  3LJI A;  3WEH A;  3WEG A;  2F94 F;  4NFK F;  3NPR A;  4NKF A;  2FTZ A;  5IK9 A;  1V4I A;  2Q9Z A;  4GP1 A;  1UBV A;  5B0M A;  4KPJ A;  4LIX A;  4F6X A;  2DH4 A;  4LFV F;  5EAT A;  4RYP A;  4KQS A;  1RQJ A;  4WK5 A;  3BNY A;  3TFN A;  3ZL6 A;  4LPH F;  5IK6 A;  1YYU A;  5IN8 A;  1FPS A;  1V4H A;  2F8C F;  4LZC A;  4JXY A;  3QQV A;  3VJD A;  1YYT A;  1WY0 A;  5JA0 F;  2ZCS A;  5EAS A;  4OMG A;  1UBW A;  4NKE A;  5IK0 A;  3W7F A;  3KRA B;  3N3D A;  3N5H F;  3WCF A;  2F8Z F;  5DZ2 A;  4DWG A;  1N24 A;  2F7M F;  5DHK A;  3TS7 A;  4E1E A;  5C05 A;  3N1W F;  5E8K A;  4JZB A;  3KRO A;  3KRC A;  4H5C F;  4E9U A;  5IVG A;  3WE9 A;  3AQ0 A;  3ZMB A;  3WEJ A;  3DYG A;  2ONH A;  1YYS A;  4OKM A;  2EWG A;  3KRF A;  4DI5 A;  3PKO A;  4FJQ A;  4MC3 A;  3Q1O A;  3G4F A;  3OAC B;  2E93 A;  1N21 A;  4LZ3 A;  4ZQ8 A;  2AET A;  2AZL A;  5JV1 F;  3EGT A;  3ACY A;  3AE0 A;  3N49 F;  4LFE A;  2RAH A;  1WL0 A;  2E8V A;  4EA0 A;  4XQS F;  1UBX A;  4OMH A;  3V66 A;  1VG6 A;  3ICK A;  3SDQ A;  3LMD A;  3DYF A;  3ZOU A;  3N45 F;  3LOM A;  3M01 A;  1JFG A;  1N1B A;  5I1U A;  3LK5 A;  3WCI A;  2FOR A;  3EZ3 A;  5DGN F;  2QIS A;  3P8R A;  1N23 A;  5IL8 A;  4LFG A;  2PS7 A;  2OGD A;  3IPI A;  3LEE A;  2PS8 A;  3P8L A;  3B7L A;  1N22 A;  3KRP B;  4GP2 A;  2Q58 A;  3ADZ A;  3MZV A;  1EZF A;  4JYX A;  5ER8 A;  3CKE A;  5ILZ A;  5DW7 A;  1YHL A;  1YJ4 A;  4EA2 A;  3PYA A;  3PYB A;  5JUZ F;  4KVD A;  2E91 A;  3RYE A;  4LPG F;  4XQR F;  2ONG A;  5B00 A;  2I19 A;  2PS6 A;  1WL3 A;  1HXC A;  2E94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...