5IMPA

Crystal structure of n299a aspergillus terreus aristolochene synthase complexed with (1s,8s,9ar)-1,9a-dimethyl-8-(prop-1-en-2-yl)decahydroquinolizin-5-ium
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
304
structure length
304
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGAELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Aristolochene synthase
publication title Probing the Role of Active Site Water in the Sesquiterpene Cyclization Reaction Catalyzed by Aristolochene Synthase.
pubmed doi rcsb
source organism Aspergillus terreus
total genus 132
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5impA00
3WJKA 1VG4A 5AELA 4QPFA 3SDQA 4KPDA 4NFKF 1WL0A 3N49F 5ILJA 3TS7A 3WEKA 3SAEA 4F62A 1N23A 2Z4VA 4K10A 3EGTA 4QXSF 5DJRF 3VJ9A 4LLSA 5DW7A 2QISA 1V4JA 4GP1A 5DJVF 5JUZF 5AHUB 2EWGA 4E1EA 3KRPB 2Z4YA 4LZ3A 5IL8A 1YQ7A 4MC8A 2F7MF 3N46F 3M0GA 3ICZA 2E95A 3P41A 2E93A 1WL2A 2VF6A 4KVDA 2E8TA 5C05A 5JV0F 3ACYA 3WCGA 1ZW5A 3NPRA 3M9UA 5DIQF 4OMGA 2Z7IA 3IPIA 4RXCA 2J5CA 4LFGA 5A0IA 3Q30A 5DJPF 1UBWA 5IMNA 1WMWA 4FP4A 5AFXA 2Z4ZA 2ZCRA 3G4DA 3PKOA 3ACWA 1UBYA 3SDTA 4H5DF 3LVSA 3P8LA 2E8WA 2H8OA 1DI1A 4N9UA 1DGPA 1UBVA 1N24A 1YV5A 2I19A 3TC1A 4KQSA 5JV2F 3WEHA 4DWGA 5B0MA 1YHLA 5DZ2A 3WSAA 5IK9A 5A0JA 3ICKA 5E8LA 4NFJF 3N5HF 4RXDA 3AQ0A 3ZOUA 2Z4WA 1HM4A 4H5EF 4JYXA 4KVIA 4GA3A 3QKCA 3ZMCA 1WL3A 1WL1A 1WKZA 4FJQA 5B0KA 5IM1A 3VJAA 2E94A 5IK6A 3WCDA 4LLTA 3ACXA 4NUAA 4LOBA 3WCHA 5DHKA 4NFIF 2Z50A 4JZXA 5ERNA 1WY0A 3V66A 3IBAA 1VG2A 3OACB 5IMIA 4OMHA 4KQ5A 5IK0A 5ILKA 3NF2A 4JXYA 4NKFA 5B0LA 4LTVA 1JFAA 2PS8A 4LA6A 2FORA 5ILZA 1V4EA 3ICNA 2E91A 4LUUA 2F89F 1HXCA 2Q9ZA 1HM7A 3LLWA 5A0KA 2J1PA 4MC0A 3WCBA 2OPMA 4P0VA 2ONHA 4DXJA 3EZ3A 2P1CA 4GAXA 4JXNA 3N0FA 3KB9A 4Q23A 4L2XF 2Z7HA 3LMDA 3TFNA 1KIZA 3TFVA 3LEEA 3WC9A 4DEMF 5IMPA 1YYUA 2Q9YA 4RXEA 3QQVA 5ILHA 2F8ZF 3RYWA 3DYFA 3LZ9A 5B02A 3ICMA 3N3DA 4LIXA 2AZJA 1N1BA 3KROA 1PS1A 3OACA 4N1ZF 3VJ8A 5AYPA 3V1VA 3RYEA 3N45F 3P8RA 5EATA 3LG5A 4E9ZA 3WCLA 3ZL6A 1YHKA 3ADZA 3OABA 2Z52A 5CG5A 4XQTF 5B03A 4LPHF 1EZFA 4WK5A 1YYRA 3VJCA 3WCEA 4KK2A 3CC9A 2OA6A 4XQRF 3V1XA 5I1UA 3N1WF 2DH4A 3WCCA 5DHIA 2AEKA 5B00A 2AETA 3WEFA 5HN9A 3M01A 5E8KA 1N22A 3OYRA 3RMGA 3WCAA 3NRIA 4P0WA 4NG6A 4RXAA 3M02A 4PVXF 4RYPA 2ZCQA 4XQSF 1VG3A 3KRAA 3KRCB 2PS4A 3WCJA 1FPSA 3KROB 3N3LF 3AQCB 5JA0F 3BNYA 5CG6A 4LPGF 1N1ZA 4LFVF 1V4HA 4F6VA 3S4JA 2E8VA 3N0GA 3W7FA 5IL3A 3G4FA 3M00A 4EA0A 3DYHA 2ZY1A 1JFGA 2J1OA 3OABB 2E90A 4KWDA 1HXGA 1N21A 4GP2A 4KPJA 3S9VA 3TFPA 3WJNA 3VJBA 2F8CF 3WEJA 3WEGA 3VJEA 2PS6A 5ILYA 4LZ0A 3EFQA 3LSNA 3WEIA 3WE9A 4KQUA 3N5JF 3VJDA 3KRFA 5ER8A 5DGMF 4LA5A 4LTZA 2AZKA 4F6XA 3WSBA 4NKEA 2ZEUA 5B0IA 4DZWA 4KVWA 3NPKA 4OKZA 5IVGA 4MC3A 3WJOA 3LJIA 3LOMA 3CP6A 3CKEA 2ONGA 2E4OA 3BNXA 5HNAA 3KRCA 3WCMA 4H5CF 3WCFA 2F9KF 3Q1OA 2Q80A 3KRAB 3PH7A 3ZCDA 2AZLA 4DWBA 5ERMA 5IKAA 5DGSF 5EAUA 1UBXA 4DHDA 4KFAA 4UMJA 4LFEA 4E9UA 4KUXA 2AELA 4EA1A 5JV1F 3LGKA 3KBKA 4P0XA 4RNQA 3PDEA 3AE0A 5KSXF 2Q58A 5EASA 5IKHA 3LDWA 3RBMA 2RAHA 2F92F 1N20A 2ZCOA 3P5RA 5E8HA 3APZA 3ZMBA 2ZEVA 5HN7A 3DYGA 1RTRA 4PVYF 1V4KA 4DI5A 2OPNA 3P5PA 3UCAA 2FTZA 5ILIA 1YHMA 3KRFB 4JVJF 2O1OA 3ASXA 1RQIA 3SDUA 2F94F 4OKMA 5B0JA 1YYQA 5ILDA 2PS7A 2PS5A 3ID0A 5H9DA 3KRPA 4KVYA 2Z4XA 1KIYA 4LXWA 1HXAA 4HD1A 4ZQ8A 4LZCA 5HN8A 2ZCSA 3N1VF 2E92A 3Q2ZA 3LGZB 4JZBA 4OGUA 3SDRA 4KKMA 1RQJA 3Q2QA 4EA2A 2E8XA 3LK5A 2E8UA 2OGDA 1YYSA 1VG6A 3MZVA 5IN8A 3N6KF 1VG7A 3MAVA 1HX9A 5EROA 1V4IA 3PYAA 3PYBA 1YYTA 5B01A 1YJ4A 2Z78A 3AQBB 3B7LA 3SDVA 3WCIA 5DGNF
chains in the Genus database with same CATH superfamily
3WJKA 1VG4A 5AELA 4QPFA 3SDQA 4KPDA 4NFKF 1WL0A 3N49F 5ILJA 3TS7A 3WEKA 3SAEA 4F62A 1N23A 2Z4VA 4K10A 3EGTA 4QXSF 5DJRF 3VJ9A 4LLSA 5DW7A 2QISA 1V4JA 4GP1A 5DJVF 5JUZF 5AHUB 2EWGA 4E1EA 3KRPB 2Z4YA 4LZ3A 5IL8A 1YQ7A 4MC8A 2F7MF 3N46F 3M0GA 3ICZA 2E95A 3P41A 2E93A 1WL2A 2VF6A 4KVDA 2E8TA 5C05A 5JV0F 3ACYA 3WCGA 1ZW5A 3NPRA 3M9UA 5DIQF 4OMGA 2Z7IA 3IPIA 4RXCA 2J5CA 4LFGA 5A0IA 3Q30A 5DJPF 1UBWA 5IMNA 1WMWA 4FP4A 5AFXA 2Z4ZA 2ZCRA 3G4DA 3PKOA 3ACWA 1UBYA 3SDTA 4H5DF 3LVSA 3P8LA 2E8WA 2H8OA 1DI1A 4N9UA 1DGPA 1UBVA 1N24A 1YV5A 2I19A 3TC1A 4KQSA 5JV2F 3WEHA 4DWGA 5B0MA 1YHLA 5DZ2A 3WSAA 5IK9A 5A0JA 3ICKA 5E8LA 4NFJF 3N5HF 4RXDA 3AQ0A 3ZOUA 2Z4WA 1HM4A 4H5EF 4JYXA 4KVIA 4GA3A 3QKCA 3ZMCA 1WL3A 1WL1A 1WKZA 4FJQA 5B0KA 5IM1A 3VJAA 2E94A 5IK6A 3WCDA 4LLTA 3ACXA 4NUAA 4LOBA 3WCHA 5DHKA 4NFIF 2Z50A 4JZXA 5ERNA 1WY0A 3V66A 3IBAA 1VG2A 3OACB 5IMIA 4OMHA 4KQ5A 5IK0A 5ILKA 3NF2A 4JXYA 4NKFA 5B0LA 4LTVA 1JFAA 2PS8A 4LA6A 2FORA 5ILZA 1V4EA 3ICNA 2E91A 4LUUA 2F89F 1HXCA 2Q9ZA 1HM7A 3LLWA 5A0KA 2J1PA 4MC0A 3WCBA 2OPMA 4P0VA 2ONHA 4DXJA 3EZ3A 2P1CA 4GAXA 4JXNA 3N0FA 3KB9A 4Q23A 4L2XF 2Z7HA 3LMDA 3TFNA 1KIZA 3TFVA 3LEEA 3WC9A 4DEMF 5IMPA 1YYUA 2Q9YA 4RXEA 3QQVA 5ILHA 2F8ZF 3RYWA 3DYFA 3LZ9A 5B02A 3ICMA 3N3DA 4LIXA 2AZJA 1N1BA 3KROA 1PS1A 3OACA 4N1ZF 3VJ8A 5AYPA 3V1VA 3RYEA 3N45F 3P8RA 5EATA 3LG5A 4E9ZA 3WCLA 3ZL6A 1YHKA 3ADZA 3OABA 2Z52A 5CG5A 4XQTF 5B03A 4LPHF 1EZFA 4WK5A 1YYRA 3VJCA 3WCEA 4KK2A 3CC9A 2OA6A 4XQRF 3V1XA 5I1UA 3N1WF 2DH4A 3WCCA 5DHIA 2AEKA 5B00A 2AETA 3WEFA 5HN9A 3M01A 5E8KA 1N22A 3OYRA 3RMGA 3WCAA 3NRIA 4P0WA 4NG6A 4RXAA 3M02A 4PVXF 4RYPA 2ZCQA 4XQSF 1VG3A 3KRAA 3KRCB 2PS4A 3WCJA 1FPSA 3KROB 3N3LF 3AQCB 5JA0F 3BNYA 5CG6A 4LPGF 1N1ZA 4LFVF 1V4HA 4F6VA 3S4JA 2E8VA 3N0GA 3W7FA 5IL3A 3G4FA 3M00A 4EA0A 3DYHA 2ZY1A 1JFGA 2J1OA 3OABB 2E90A 4KWDA 1HXGA 1N21A 4GP2A 4KPJA 3S9VA 3TFPA 3WJNA 3VJBA 2F8CF 3WEJA 3WEGA 3VJEA 2PS6A 5ILYA 4LZ0A 3EFQA 3LSNA 3WEIA 3WE9A 4KQUA 3N5JF 3VJDA 3KRFA 5ER8A 5DGMF 4LA5A 4LTZA 2AZKA 4F6XA 3WSBA 4NKEA 2ZEUA 5B0IA 4DZWA 4KVWA 3NPKA 4OKZA 5IVGA 4MC3A 3WJOA 3LJIA 3LOMA 3CP6A 3CKEA 2ONGA 2E4OA 3BNXA 5HNAA 3KRCA 3WCMA 4H5CF 3WCFA 2F9KF 3Q1OA 2Q80A 3KRAB 3PH7A 3ZCDA 2AZLA 4DWBA 5ERMA 5IKAA 5DGSF 5EAUA 1UBXA 4DHDA 4KFAA 4UMJA 4LFEA 4E9UA 4KUXA 2AELA 4EA1A 5JV1F 3LGKA 3KBKA 4P0XA 4RNQA 3PDEA 3AE0A 5KSXF 2Q58A 5EASA 5IKHA 3LDWA 3RBMA 2RAHA 2F92F 1N20A 2ZCOA 3P5RA 5E8HA 3APZA 3ZMBA 2ZEVA 5HN7A 3DYGA 1RTRA 4PVYF 1V4KA 4DI5A 2OPNA 3P5PA 3UCAA 2FTZA 5ILIA 1YHMA 3KRFB 4JVJF 2O1OA 3ASXA 1RQIA 3SDUA 2F94F 4OKMA 5B0JA 1YYQA 5ILDA 2PS7A 2PS5A 3ID0A 5H9DA 3KRPA 4KVYA 2Z4XA 1KIYA 4LXWA 1HXAA 4HD1A 4ZQ8A 4LZCA 5HN8A 2ZCSA 3N1VF 2E92A 3Q2ZA 3LGZB 4JZBA 4OGUA 3SDRA 4KKMA 1RQJA 3Q2QA 4EA2A 2E8XA 3LK5A 2E8UA 2OGDA 1YYSA 1VG6A 3MZVA 5IN8A 3N6KF 1VG7A 3MAVA 1HX9A 5EROA 1V4IA 3PYAA 3PYBA 1YYTA 5B01A 1YJ4A 2Z78A 3AQBB 3B7LA 3SDVA 3WCIA 5DGNF
chains in the Genus database with same CATH topology
3WJKA 1VG4A 5AELA 4QPFA 3SDQA 4KPDA 4NFKF 1WL0A 3N49F 5ILJA 3TS7A 3WEKA 3SAEA 4F62A 1N23A 2Z4VA 4K10A 3EGTA 4QXSF 5DJRF 3VJ9A 4LLSA 5DW7A 2QISA 1V4JA 4GP1A 5DJVF 5JUZF 5AHUB 2EWGA 4E1EA 3KRPB 2Z4YA 4LZ3A 5IL8A 1YQ7A 4MC8A 2F7MF 3N46F 3M0GA 3ICZA 2E95A 3P41A 2E93A 1WL2A 2VF6A 4KVDA 2E8TA 5C05A 5JV0F 3ACYA 3WCGA 1ZW5A 3NPRA 3M9UA 5DIQF 4OMGA 2Z7IA 3IPIA 4RXCA 2J5CA 4LFGA 5A0IA 3Q30A 5DJPF 1UBWA 5IMNA 1WMWA 4FP4A 5AFXA 2Z4ZA 2ZCRA 3G4DA 3PKOA 3ACWA 1UBYA 3SDTA 4H5DF 3LVSA 3P8LA 2E8WA 2H8OA 1DI1A 4N9UA 1DGPA 1UBVA 1N24A 1YV5A 2I19A 3TC1A 4KQSA 5JV2F 3WEHA 4DWGA 5B0MA 1YHLA 5DZ2A 3WSAA 5IK9A 5A0JA 3ICKA 5E8LA 4NFJF 3N5HF 4RXDA 3AQ0A 3ZOUA 2Z4WA 1HM4A 4H5EF 4JYXA 4KVIA 4GA3A 3QKCA 3ZMCA 1WL3A 1WL1A 1WKZA 4FJQA 5B0KA 5IM1A 3VJAA 2E94A 5IK6A 3WCDA 4LLTA 3ACXA 4NUAA 4LOBA 3WCHA 5DHKA 4NFIF 2Z50A 4JZXA 5ERNA 1WY0A 3V66A 3IBAA 1VG2A 3OACB 5IMIA 4OMHA 4KQ5A 5IK0A 5ILKA 3NF2A 4JXYA 4NKFA 5B0LA 4LTVA 1JFAA 2PS8A 4LA6A 2FORA 5ILZA 1V4EA 3ICNA 2E91A 4LUUA 2F89F 1HXCA 2Q9ZA 1HM7A 3LLWA 5A0KA 2J1PA 4MC0A 3WCBA 2OPMA 4P0VA 2ONHA 4DXJA 3EZ3A 2P1CA 4GAXA 4JXNA 3N0FA 3KB9A 4Q23A 4L2XF 2Z7HA 3LMDA 3TFNA 1KIZA 3TFVA 3LEEA 3WC9A 4DEMF 5IMPA 1YYUA 2Q9YA 4RXEA 3QQVA 5ILHA 2F8ZF 3RYWA 3DYFA 3LZ9A 5B02A 3ICMA 3N3DA 4LIXA 2AZJA 1N1BA 3KROA 1PS1A 3OACA 4N1ZF 3VJ8A 5AYPA 3V1VA 3RYEA 3N45F 3P8RA 5EATA 3LG5A 4E9ZA 3WCLA 3ZL6A 1YHKA 3ADZA 3OABA 2Z52A 5CG5A 4XQTF 5B03A 4LPHF 1EZFA 4WK5A 1YYRA 3VJCA 3WCEA 4KK2A 3CC9A 2OA6A 4XQRF 3V1XA 5I1UA 3N1WF 2DH4A 3WCCA 5DHIA 2AEKA 5B00A 2AETA 3WEFA 5HN9A 3M01A 5E8KA 1N22A 3OYRA 3RMGA 3WCAA 3NRIA 4P0WA 4NG6A 4RXAA 3M02A 4PVXF 4RYPA 2ZCQA 4XQSF 1VG3A 3KRAA 3KRCB 2PS4A 3WCJA 1FPSA 3KROB 3N3LF 3AQCB 5JA0F 3BNYA 5CG6A 4LPGF 1N1ZA 4LFVF 1V4HA 4F6VA 3S4JA 2E8VA 3N0GA 3W7FA 5IL3A 3G4FA 3M00A 4EA0A 3DYHA 2ZY1A 1JFGA 2J1OA 3OABB 2E90A 4KWDA 1HXGA 1N21A 4GP2A 4KPJA 3S9VA 3TFPA 3WJNA 3VJBA 2F8CF 3WEJA 3WEGA 3VJEA 2PS6A 5ILYA 4LZ0A 3EFQA 3LSNA 3WEIA 3WE9A 4KQUA 3N5JF 3VJDA 3KRFA 5ER8A 5DGMF 4LA5A 4LTZA 2AZKA 4F6XA 3WSBA 4NKEA 2ZEUA 5B0IA 4DZWA 4KVWA 3NPKA 4OKZA 5IVGA 4MC3A 3WJOA 3LJIA 3LOMA 3CP6A 3CKEA 2ONGA 2E4OA 3BNXA 5HNAA 3KRCA 3WCMA 4H5CF 3WCFA 2F9KF 3Q1OA 2Q80A 3KRAB 3PH7A 3ZCDA 2AZLA 4DWBA 5ERMA 5IKAA 5DGSF 5EAUA 1UBXA 4DHDA 4KFAA 4UMJA 4LFEA 4E9UA 4KUXA 2AELA 4EA1A 5JV1F 3LGKA 3KBKA 4P0XA 4RNQA 3PDEA 3AE0A 5KSXF 2Q58A 5EASA 5IKHA 3LDWA 3RBMA 2RAHA 2F92F 1N20A 2ZCOA 3P5RA 5E8HA 3APZA 3ZMBA 2ZEVA 5HN7A 3DYGA 1RTRA 4PVYF 1V4KA 4DI5A 2OPNA 3P5PA 3UCAA 2FTZA 5ILIA 1YHMA 3KRFB 4JVJF 2O1OA 3ASXA 1RQIA 3SDUA 2F94F 4OKMA 5B0JA 1YYQA 5ILDA 2PS7A 2PS5A 3ID0A 5H9DA 3KRPA 4KVYA 2Z4XA 1KIYA 4LXWA 1HXAA 4HD1A 4ZQ8A 4LZCA 5HN8A 2ZCSA 3N1VF 2E92A 3Q2ZA 3LGZB 4JZBA 4OGUA 3SDRA 4KKMA 1RQJA 3Q2QA 4EA2A 2E8XA 3LK5A 2E8UA 2OGDA 1YYSA 1VG6A 3MZVA 5IN8A 3N6KF 1VG7A 3MAVA 1HX9A 5EROA 1V4IA 3PYAA 3PYBA 1YYTA 5B01A 1YJ4A 2Z78A 3AQBB 3B7LA 3SDVA 3WCIA 5DGNF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WJK A;  1VG4 A;  5AEL A;  4QPF A;  3SDQ A;  4KPD A;  4NFK F;  1WL0 A;  3N49 F;  5ILJ A;  3TS7 A;  3WEK A;  3SAE A;  4F62 A;  1N23 A;  2Z4V A;  4K10 A;  3EGT A;  4QXS F;  5DJR F;  3VJ9 A;  4LLS A;  5DW7 A;  2QIS A;  1V4J A;  4GP1 A;  5DJV F;  5JUZ F;  5AHU B;  2EWG A;  4E1E A;  3KRP B;  2Z4Y A;  4LZ3 A;  5IL8 A;  1YQ7 A;  4MC8 A;  2F7M F;  3N46 F;  3M0G A;  3ICZ A;  2E95 A;  3P41 A;  2E93 A;  1WL2 A;  2VF6 A;  4KVD A;  2E8T A;  5C05 A;  5JV0 F;  3ACY A;  3WCG A;  1ZW5 A;  3NPR A;  3M9U A;  5DIQ F;  4OMG A;  2Z7I A;  3IPI A;  4RXC A;  2J5C A;  4LFG A;  5A0I A;  3Q30 A;  5DJP F;  1UBW A;  5IMN A;  1WMW A;  4FP4 A;  5AFX A;  2Z4Z A;  2ZCR A;  3G4D A;  3PKO A;  3ACW A;  1UBY A;  3SDT A;  4H5D F;  3LVS A;  3P8L A;  2E8W A;  2H8O A;  1DI1 A;  4N9U A;  1DGP A;  1UBV A;  1N24 A;  1YV5 A;  2I19 A;  3TC1 A;  4KQS A;  5JV2 F;  3WEH A;  4DWG A;  5B0M A;  1YHL A;  5DZ2 A;  3WSA A;  5IK9 A;  5A0J A;  3ICK A;  5E8L A;  4NFJ F;  3N5H F;  4RXD A;  3AQ0 A;  3ZOU A;  2Z4W A;  1HM4 A;  4H5E F;  4JYX A;  4KVI A;  4GA3 A;  3QKC A;  3ZMC A;  1WL3 A;  1WL1 A;  1WKZ A;  4FJQ A;  5B0K A;  5IM1 A;  3VJA A;  2E94 A;  5IK6 A;  3WCD A;  4LLT A;  3ACX A;  4NUA A;  4LOB A;  3WCH A;  5DHK A;  4NFI F;  2Z50 A;  4JZX A;  5ERN A;  1WY0 A;  3V66 A;  3IBA A;  1VG2 A;  3OAC B;  5IMI A;  4OMH A;  4KQ5 A;  5IK0 A;  5ILK A;  3NF2 A;  4JXY A;  4NKF A;  5B0L A;  4LTV A;  1JFA A;  2PS8 A;  4LA6 A;  2FOR A;  5ILZ A;  1V4E A;  3ICN A;  2E91 A;  4LUU A;  2F89 F;  1HXC A;  2Q9Z A;  1HM7 A;  3LLW A;  5A0K A;  2J1P A;  4MC0 A;  3WCB A;  2OPM A;  4P0V A;  2ONH A;  4DXJ A;  3EZ3 A;  2P1C A;  4GAX A;  4JXN A;  3N0F A;  3KB9 A;  4Q23 A;  4L2X F;  2Z7H A;  3LMD A;  3TFN A;  1KIZ A;  3TFV A;  3LEE A;  3WC9 A;  4DEM F;  5IMP A;  1YYU A;  2Q9Y A;  4RXE A;  3QQV A;  5ILH A;  2F8Z F;  3RYW A;  3DYF A;  3LZ9 A;  5B02 A;  3ICM A;  3N3D A;  4LIX A;  2AZJ A;  1N1B A;  3KRO A;  1PS1 A;  3OAC A;  4N1Z F;  3VJ8 A;  5AYP A;  3V1V A;  3RYE A;  3N45 F;  3P8R A;  5EAT A;  3LG5 A;  4E9Z A;  3WCL A;  3ZL6 A;  1YHK A;  3ADZ A;  3OAB A;  2Z52 A;  5CG5 A;  4XQT F;  5B03 A;  4LPH F;  1EZF A;  4WK5 A;  1YYR A;  3VJC A;  3WCE A;  4KK2 A;  3CC9 A;  2OA6 A;  4XQR F;  3V1X A;  5I1U A;  3N1W F;  2DH4 A;  3WCC A;  5DHI A;  2AEK A;  5B00 A;  2AET A;  3WEF A;  5HN9 A;  3M01 A;  5E8K A;  1N22 A;  3OYR A;  3RMG A;  3WCA A;  3NRI A;  4P0W A;  4NG6 A;  4RXA A;  3M02 A;  4PVX F;  4RYP A;  2ZCQ A;  4XQS F;  1VG3 A;  3KRA A;  3KRC B;  2PS4 A;  3WCJ A;  1FPS A;  3KRO B;  3N3L F;  3AQC B;  5JA0 F;  3BNY A;  5CG6 A;  4LPG F;  1N1Z A;  4LFV F;  1V4H A;  4F6V A;  3S4J A;  2E8V A;  3N0G A;  3W7F A;  5IL3 A;  3G4F A;  3M00 A;  4EA0 A;  3DYH A;  2ZY1 A;  1JFG A;  2J1O A;  3OAB B;  2E90 A;  4KWD A;  1HXG A;  1N21 A;  4GP2 A;  4KPJ A;  3S9V A;  3TFP A;  3WJN A;  3VJB A;  2F8C F;  3WEJ A;  3WEG A;  3VJE A;  2PS6 A;  5ILY A;  4LZ0 A;  3EFQ A;  3LSN A;  3WEI A;  3WE9 A;  4KQU A;  3N5J F;  3VJD A;  3KRF A;  5ER8 A;  5DGM F;  4LA5 A;  4LTZ A;  2AZK A;  4F6X A;  3WSB A;  4NKE A;  2ZEU A;  5B0I A;  4DZW A;  4KVW A;  3NPK A;  4OKZ A;  5IVG A;  4MC3 A;  3WJO A;  3LJI A;  3LOM A;  3CP6 A;  3CKE A;  2ONG A;  2E4O A;  3BNX A;  5HNA A;  3KRC A;  3WCM A;  4H5C F;  3WCF A;  2F9K F;  3Q1O A;  2Q80 A;  3KRA B;  3PH7 A;  3ZCD A;  2AZL A;  4DWB A;  5ERM A;  5IKA A;  5DGS F;  5EAU A;  1UBX A;  4DHD A;  4KFA A;  4UMJ A;  4LFE A;  4E9U A;  4KUX A;  2AEL A;  4EA1 A;  5JV1 F;  3LGK A;  3KBK A;  4P0X A;  4RNQ A;  3PDE A;  3AE0 A;  5KSX F;  2Q58 A;  5EAS A;  5IKH A;  3LDW A;  3RBM A;  2RAH A;  2F92 F;  1N20 A;  2ZCO A;  3P5R A;  5E8H A;  3APZ A;  3ZMB A;  2ZEV A;  5HN7 A;  3DYG A;  1RTR A;  4PVY F;  1V4K A;  4DI5 A;  2OPN A;  3P5P A;  3UCA A;  2FTZ A;  5ILI A;  1YHM A;  3KRF B;  4JVJ F;  2O1O A;  3ASX A;  1RQI A;  3SDU A;  2F94 F;  4OKM A;  5B0J A;  1YYQ A;  5ILD A;  2PS7 A;  2PS5 A;  3ID0 A;  5H9D A;  3KRP A;  4KVY A;  2Z4X A;  1KIY A;  4LXW A;  1HXA A;  4HD1 A;  4ZQ8 A;  4LZC A;  5HN8 A;  2ZCS A;  3N1V F;  2E92 A;  3Q2Z A;  3LGZ B;  4JZB A;  4OGU A;  3SDR A;  4KKM A;  1RQJ A;  3Q2Q A;  4EA2 A;  2E8X A;  3LK5 A;  2E8U A;  2OGD A;  1YYS A;  1VG6 A;  3MZV A;  5IN8 A;  3N6K F;  1VG7 A;  3MAV A;  1HX9 A;  5ERO A;  1V4I A;  3PYA A;  3PYB A;  1YYT A;  5B01 A;  1YJ4 A;  2Z78 A;  3AQB B;  3B7L A;  3SDV A;  3WCI A;  5DGN F; 
#chains in the Genus database with same CATH topology
 3WJK A;  1VG4 A;  5AEL A;  4QPF A;  3SDQ A;  4KPD A;  4NFK F;  1WL0 A;  3N49 F;  5ILJ A;  3TS7 A;  3WEK A;  3SAE A;  4F62 A;  1N23 A;  2Z4V A;  4K10 A;  3EGT A;  4QXS F;  5DJR F;  3VJ9 A;  4LLS A;  5DW7 A;  2QIS A;  1V4J A;  4GP1 A;  5DJV F;  5JUZ F;  5AHU B;  2EWG A;  4E1E A;  3KRP B;  2Z4Y A;  4LZ3 A;  5IL8 A;  1YQ7 A;  4MC8 A;  2F7M F;  3N46 F;  3M0G A;  3ICZ A;  2E95 A;  3P41 A;  2E93 A;  1WL2 A;  2VF6 A;  4KVD A;  2E8T A;  5C05 A;  5JV0 F;  3ACY A;  3WCG A;  1ZW5 A;  3NPR A;  3M9U A;  5DIQ F;  4OMG A;  2Z7I A;  3IPI A;  4RXC A;  2J5C A;  4LFG A;  5A0I A;  3Q30 A;  5DJP F;  1UBW A;  5IMN A;  1WMW A;  4FP4 A;  5AFX A;  2Z4Z A;  2ZCR A;  3G4D A;  3PKO A;  3ACW A;  1UBY A;  3SDT A;  4H5D F;  3LVS A;  3P8L A;  2E8W A;  2H8O A;  1DI1 A;  4N9U A;  1DGP A;  1UBV A;  1N24 A;  1YV5 A;  2I19 A;  3TC1 A;  4KQS A;  5JV2 F;  3WEH A;  4DWG A;  5B0M A;  1YHL A;  5DZ2 A;  3WSA A;  5IK9 A;  5A0J A;  3ICK A;  5E8L A;  4NFJ F;  3N5H F;  4RXD A;  3AQ0 A;  3ZOU A;  2Z4W A;  1HM4 A;  4H5E F;  4JYX A;  4KVI A;  4GA3 A;  3QKC A;  3ZMC A;  1WL3 A;  1WL1 A;  1WKZ A;  4FJQ A;  5B0K A;  5IM1 A;  3VJA A;  2E94 A;  5IK6 A;  3WCD A;  4LLT A;  3ACX A;  4NUA A;  4LOB A;  3WCH A;  5DHK A;  4NFI F;  2Z50 A;  4JZX A;  5ERN A;  1WY0 A;  3V66 A;  3IBA A;  1VG2 A;  3OAC B;  5IMI A;  4OMH A;  4KQ5 A;  5IK0 A;  5ILK A;  3NF2 A;  4JXY A;  4NKF A;  5B0L A;  4LTV A;  1JFA A;  2PS8 A;  4LA6 A;  2FOR A;  5ILZ A;  1V4E A;  3ICN A;  2E91 A;  4LUU A;  2F89 F;  1HXC A;  2Q9Z A;  1HM7 A;  3LLW A;  5A0K A;  2J1P A;  4MC0 A;  3WCB A;  2OPM A;  4P0V A;  2ONH A;  4DXJ A;  3EZ3 A;  2P1C A;  4GAX A;  4JXN A;  3N0F A;  3KB9 A;  4Q23 A;  4L2X F;  2Z7H A;  3LMD A;  3TFN A;  1KIZ A;  3TFV A;  3LEE A;  3WC9 A;  4DEM F;  5IMP A;  1YYU A;  2Q9Y A;  4RXE A;  3QQV A;  5ILH A;  2F8Z F;  3RYW A;  3DYF A;  3LZ9 A;  5B02 A;  3ICM A;  3N3D A;  4LIX A;  2AZJ A;  1N1B A;  3KRO A;  1PS1 A;  3OAC A;  4N1Z F;  3VJ8 A;  5AYP A;  3V1V A;  3RYE A;  3N45 F;  3P8R A;  5EAT A;  3LG5 A;  4E9Z A;  3WCL A;  3ZL6 A;  1YHK A;  3ADZ A;  3OAB A;  2Z52 A;  5CG5 A;  4XQT F;  5B03 A;  4LPH F;  1EZF A;  4WK5 A;  1YYR A;  3VJC A;  3WCE A;  4KK2 A;  3CC9 A;  2OA6 A;  4XQR F;  3V1X A;  5I1U A;  3N1W F;  2DH4 A;  3WCC A;  5DHI A;  2AEK A;  5B00 A;  2AET A;  3WEF A;  5HN9 A;  3M01 A;  5E8K A;  1N22 A;  3OYR A;  3RMG A;  3WCA A;  3NRI A;  4P0W A;  4NG6 A;  4RXA A;  3M02 A;  4PVX F;  4RYP A;  2ZCQ A;  4XQS F;  1VG3 A;  3KRA A;  3KRC B;  2PS4 A;  3WCJ A;  1FPS A;  3KRO B;  3N3L F;  3AQC B;  5JA0 F;  3BNY A;  5CG6 A;  4LPG F;  1N1Z A;  4LFV F;  1V4H A;  4F6V A;  3S4J A;  2E8V A;  3N0G A;  3W7F A;  5IL3 A;  3G4F A;  3M00 A;  4EA0 A;  3DYH A;  2ZY1 A;  1JFG A;  2J1O A;  3OAB B;  2E90 A;  4KWD A;  1HXG A;  1N21 A;  4GP2 A;  4KPJ A;  3S9V A;  3TFP A;  3WJN A;  3VJB A;  2F8C F;  3WEJ A;  3WEG A;  3VJE A;  2PS6 A;  5ILY A;  4LZ0 A;  3EFQ A;  3LSN A;  3WEI A;  3WE9 A;  4KQU A;  3N5J F;  3VJD A;  3KRF A;  5ER8 A;  5DGM F;  4LA5 A;  4LTZ A;  2AZK A;  4F6X A;  3WSB A;  4NKE A;  2ZEU A;  5B0I A;  4DZW A;  4KVW A;  3NPK A;  4OKZ A;  5IVG A;  4MC3 A;  3WJO A;  3LJI A;  3LOM A;  3CP6 A;  3CKE A;  2ONG A;  2E4O A;  3BNX A;  5HNA A;  3KRC A;  3WCM A;  4H5C F;  3WCF A;  2F9K F;  3Q1O A;  2Q80 A;  3KRA B;  3PH7 A;  3ZCD A;  2AZL A;  4DWB A;  5ERM A;  5IKA A;  5DGS F;  5EAU A;  1UBX A;  4DHD A;  4KFA A;  4UMJ A;  4LFE A;  4E9U A;  4KUX A;  2AEL A;  4EA1 A;  5JV1 F;  3LGK A;  3KBK A;  4P0X A;  4RNQ A;  3PDE A;  3AE0 A;  5KSX F;  2Q58 A;  5EAS A;  5IKH A;  3LDW A;  3RBM A;  2RAH A;  2F92 F;  1N20 A;  2ZCO A;  3P5R A;  5E8H A;  3APZ A;  3ZMB A;  2ZEV A;  5HN7 A;  3DYG A;  1RTR A;  4PVY F;  1V4K A;  4DI5 A;  2OPN A;  3P5P A;  3UCA A;  2FTZ A;  5ILI A;  1YHM A;  3KRF B;  4JVJ F;  2O1O A;  3ASX A;  1RQI A;  3SDU A;  2F94 F;  4OKM A;  5B0J A;  1YYQ A;  5ILD A;  2PS7 A;  2PS5 A;  3ID0 A;  5H9D A;  3KRP A;  4KVY A;  2Z4X A;  1KIY A;  4LXW A;  1HXA A;  4HD1 A;  4ZQ8 A;  4LZC A;  5HN8 A;  2ZCS A;  3N1V F;  2E92 A;  3Q2Z A;  3LGZ B;  4JZB A;  4OGU A;  3SDR A;  4KKM A;  1RQJ A;  3Q2Q A;  4EA2 A;  2E8X A;  3LK5 A;  2E8U A;  2OGD A;  1YYS A;  1VG6 A;  3MZV A;  5IN8 A;  3N6K F;  1VG7 A;  3MAV A;  1HX9 A;  5ERO A;  1V4I A;  3PYA A;  3PYB A;  1YYT A;  5B01 A;  1YJ4 A;  2Z78 A;  3AQB B;  3B7L A;  3SDV A;  3WCI A;  5DGN F; 
#chains in the Genus database with same CATH homology
 3WJK A;  1VG4 A;  5AEL A;  4QPF A;  3SDQ A;  4KPD A;  4NFK F;  1WL0 A;  3N49 F;  5ILJ A;  3TS7 A;  3WEK A;  3SAE A;  4F62 A;  1N23 A;  2Z4V A;  4K10 A;  3EGT A;  4QXS F;  5DJR F;  3VJ9 A;  4LLS A;  5DW7 A;  2QIS A;  1V4J A;  4GP1 A;  5DJV F;  5JUZ F;  5AHU B;  2EWG A;  4E1E A;  3KRP B;  2Z4Y A;  4LZ3 A;  5IL8 A;  1YQ7 A;  4MC8 A;  2F7M F;  3N46 F;  3M0G A;  3ICZ A;  2E95 A;  3P41 A;  2E93 A;  1WL2 A;  2VF6 A;  4KVD A;  2E8T A;  5C05 A;  5JV0 F;  3ACY A;  3WCG A;  1ZW5 A;  3NPR A;  3M9U A;  5DIQ F;  4OMG A;  2Z7I A;  3IPI A;  4RXC A;  2J5C A;  4LFG A;  5A0I A;  3Q30 A;  5DJP F;  1UBW A;  5IMN A;  1WMW A;  4FP4 A;  5AFX A;  2Z4Z A;  2ZCR A;  3G4D A;  3PKO A;  3ACW A;  1UBY A;  3SDT A;  4H5D F;  3LVS A;  3P8L A;  2E8W A;  2H8O A;  1DI1 A;  4N9U A;  1DGP A;  1UBV A;  1N24 A;  1YV5 A;  2I19 A;  3TC1 A;  4KQS A;  5JV2 F;  3WEH A;  4DWG A;  5B0M A;  1YHL A;  5DZ2 A;  3WSA A;  5IK9 A;  5A0J A;  3ICK A;  5E8L A;  4NFJ F;  3N5H F;  4RXD A;  3AQ0 A;  3ZOU A;  2Z4W A;  1HM4 A;  4H5E F;  4JYX A;  4KVI A;  4GA3 A;  3QKC A;  3ZMC A;  1WL3 A;  1WL1 A;  1WKZ A;  4FJQ A;  5B0K A;  5IM1 A;  3VJA A;  2E94 A;  5IK6 A;  3WCD A;  4LLT A;  3ACX A;  4NUA A;  4LOB A;  3WCH A;  5DHK A;  4NFI F;  2Z50 A;  4JZX A;  5ERN A;  1WY0 A;  3V66 A;  3IBA A;  1VG2 A;  3OAC B;  5IMI A;  4OMH A;  4KQ5 A;  5IK0 A;  5ILK A;  3NF2 A;  4JXY A;  4NKF A;  5B0L A;  4LTV A;  1JFA A;  2PS8 A;  4LA6 A;  2FOR A;  5ILZ A;  1V4E A;  3ICN A;  2E91 A;  4LUU A;  2F89 F;  1HXC A;  2Q9Z A;  1HM7 A;  3LLW A;  5A0K A;  2J1P A;  4MC0 A;  3WCB A;  2OPM A;  4P0V A;  2ONH A;  4DXJ A;  3EZ3 A;  2P1C A;  4GAX A;  4JXN A;  3N0F A;  3KB9 A;  4Q23 A;  4L2X F;  2Z7H A;  3LMD A;  3TFN A;  1KIZ A;  3TFV A;  3LEE A;  3WC9 A;  4DEM F;  5IMP A;  1YYU A;  2Q9Y A;  4RXE A;  3QQV A;  5ILH A;  2F8Z F;  3RYW A;  3DYF A;  3LZ9 A;  5B02 A;  3ICM A;  3N3D A;  4LIX A;  2AZJ A;  1N1B A;  3KRO A;  1PS1 A;  3OAC A;  4N1Z F;  3VJ8 A;  5AYP A;  3V1V A;  3RYE A;  3N45 F;  3P8R A;  5EAT A;  3LG5 A;  4E9Z A;  3WCL A;  3ZL6 A;  1YHK A;  3ADZ A;  3OAB A;  2Z52 A;  5CG5 A;  4XQT F;  5B03 A;  4LPH F;  1EZF A;  4WK5 A;  1YYR A;  3VJC A;  3WCE A;  4KK2 A;  3CC9 A;  2OA6 A;  4XQR F;  3V1X A;  5I1U A;  3N1W F;  2DH4 A;  3WCC A;  5DHI A;  2AEK A;  5B00 A;  2AET A;  3WEF A;  5HN9 A;  3M01 A;  5E8K A;  1N22 A;  3OYR A;  3RMG A;  3WCA A;  3NRI A;  4P0W A;  4NG6 A;  4RXA A;  3M02 A;  4PVX F;  4RYP A;  2ZCQ A;  4XQS F;  1VG3 A;  3KRA A;  3KRC B;  2PS4 A;  3WCJ A;  1FPS A;  3KRO B;  3N3L F;  3AQC B;  5JA0 F;  3BNY A;  5CG6 A;  4LPG F;  1N1Z A;  4LFV F;  1V4H A;  4F6V A;  3S4J A;  2E8V A;  3N0G A;  3W7F A;  5IL3 A;  3G4F A;  3M00 A;  4EA0 A;  3DYH A;  2ZY1 A;  1JFG A;  2J1O A;  3OAB B;  2E90 A;  4KWD A;  1HXG A;  1N21 A;  4GP2 A;  4KPJ A;  3S9V A;  3TFP A;  3WJN A;  3VJB A;  2F8C F;  3WEJ A;  3WEG A;  3VJE A;  2PS6 A;  5ILY A;  4LZ0 A;  3EFQ A;  3LSN A;  3WEI A;  3WE9 A;  4KQU A;  3N5J F;  3VJD A;  3KRF A;  5ER8 A;  5DGM F;  4LA5 A;  4LTZ A;  2AZK A;  4F6X A;  3WSB A;  4NKE A;  2ZEU A;  5B0I A;  4DZW A;  4KVW A;  3NPK A;  4OKZ A;  5IVG A;  4MC3 A;  3WJO A;  3LJI A;  3LOM A;  3CP6 A;  3CKE A;  2ONG A;  2E4O A;  3BNX A;  5HNA A;  3KRC A;  3WCM A;  4H5C F;  3WCF A;  2F9K F;  3Q1O A;  2Q80 A;  3KRA B;  3PH7 A;  3ZCD A;  2AZL A;  4DWB A;  5ERM A;  5IKA A;  5DGS F;  5EAU A;  1UBX A;  4DHD A;  4KFA A;  4UMJ A;  4LFE A;  4E9U A;  4KUX A;  2AEL A;  4EA1 A;  5JV1 F;  3LGK A;  3KBK A;  4P0X A;  4RNQ A;  3PDE A;  3AE0 A;  5KSX F;  2Q58 A;  5EAS A;  5IKH A;  3LDW A;  3RBM A;  2RAH A;  2F92 F;  1N20 A;  2ZCO A;  3P5R A;  5E8H A;  3APZ A;  3ZMB A;  2ZEV A;  5HN7 A;  3DYG A;  1RTR A;  4PVY F;  1V4K A;  4DI5 A;  2OPN A;  3P5P A;  3UCA A;  2FTZ A;  5ILI A;  1YHM A;  3KRF B;  4JVJ F;  2O1O A;  3ASX A;  1RQI A;  3SDU A;  2F94 F;  4OKM A;  5B0J A;  1YYQ A;  5ILD A;  2PS7 A;  2PS5 A;  3ID0 A;  5H9D A;  3KRP A;  4KVY A;  2Z4X A;  1KIY A;  4LXW A;  1HXA A;  4HD1 A;  4ZQ8 A;  4LZC A;  5HN8 A;  2ZCS A;  3N1V F;  2E92 A;  3Q2Z A;  3LGZ B;  4JZB A;  4OGU A;  3SDR A;  4KKM A;  1RQJ A;  3Q2Q A;  4EA2 A;  2E8X A;  3LK5 A;  2E8U A;  2OGD A;  1YYS A;  1VG6 A;  3MZV A;  5IN8 A;  3N6K F;  1VG7 A;  3MAV A;  1HX9 A;  5ERO A;  1V4I A;  3PYA A;  3PYB A;  1YYT A;  5B01 A;  1YJ4 A;  2Z78 A;  3AQB B;  3B7L A;  3SDV A;  3WCI A;  5DGN F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...