5IMPA

Crystal structure of n299a aspergillus terreus aristolochene synthase complexed with (1s,8s,9ar)-1,9a-dimethyl-8-(prop-1-en-2-yl)decahydroquinolizin-5-ium
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
304
structure length
304
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGAELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aristolochene synthase
publication title Probing the Role of Active Site Water in the Sesquiterpene Cyclization Reaction Catalyzed by Aristolochene Synthase.
pubmed doi rcsb
source organism Aspergillus terreus
molecule tags Lyase/lyase inhibitor
total genus 132
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5impA00
4HD1A 4GP2A 4KQ5A 3S9VA 4OGUA 3VJBA 5ILYA 2PS4A 1PS1A 4FJQA 1N21A 3ICKA 5AYPA 5A0IA 4UMJA 4OMGA 2FTZA 4LTZA 3N49F 3KRAA 4ZQ8A 3WCFA 2F8CF 4LZ0A 5B00A 4KVIA 4GP1A 4LFEA 5ERNA 4LPGF 3WCCA 4F6XA 1YHLA 1WL3A 3N0GA 4EA0A 2J5CA 5AHUB 2E93A 4JYXA 3DYHA 3P8RA 5DZ2A 3W7FA 3WEKA 4L2XF 1UBXA 3TS7A 4LZCA 5DGNF 3WSAA 4NG6A 1HXCA 2Z7HA 5DIQF 5ILKA 3WJNA 4E9UA 5ILDA 2Q58A 3CP6A 2E8TA 3M02A 2F94F 2Z4YA 4PVXF 3VJ9A 4KVYA 2PS5A 3OACA 4KPDA 3P41A 3IBAA 3ZL6A 4FP4A 4P0VA 3M9UA 3N6KF 3KB9A 1EZFA 2Z4WA 2E4OA 2ZCSA 5B0JA 2DH4A 3Q2QA 3CC9A 4KWDA 2Z4VA 1YHKA 2OGDA 5IK0A 1RQJA 3KROA 5DJRF 1WL1A 1YHMA 3LEEA 3LJIA 2E91A 1WY0A 2F8ZF 2I19A 2P1CA 3LOMA 5IN8A 5IMNA 3S4JA 3EFQA 3P8LA 4MC8A 3WC9A 3OYRA 4KKMA 4LTVA 2F89F 1WL2A 3RYEA 3DYGA 3V1XA 4KQUA 2H8OA 2F92F 3KRCA 2ZCRA 3OABA 2Z4ZA 2AETA 2PS8A 2RAHA 4H5DF 3N5JF 4DHDA 1WMWA 3CKEA 5DHIA 4NUAA 3SAEA 2E92A 3V66A 3ZOUA 1YYQA 5IL3A 3VJ8A 3LK5A 3PH7A 3WCGA 4MC0A 3PDEA 4E1EA 3WCHA 1V4IA 5IVGA 4F62A 2ZEUA 3M0GA 2Q9ZA 5IKAA 1YV5A 1N23A 3N46F 4LZ3A 3VJEA 1N22A 1VG2A 1YYTA 5ILJA 5ILZA 3NPRA 3VJDA 3TFPA 5JV2F 2E8WA 4NFIF 2AZJA 2Z7IA 3KRFB 4JVJF 3SDQA 2AZLA 3BNXA 1YYSA 2E8XA 5ILIA 5DJVF 3VJCA 5IMPA 3M01A 3M00A 3G4DA 2ZY1A 1UBVA 4H5EF 4KK2A 4DZWA 5CG5A 4JXYA 4KFAA 3QQVA 4WK5A 2ONHA 5CG6A 4MC3A 4OKZA 3EZ3A 3WJOA 4GAXA 5C05A 3LLWA 1HM7A 4DI5A 4LUUA 4KUXA 5IMIA 3AQBB 2ZCQA 3Q30A 5EAUA 4LLTA 3QKCA 1FPSA 2AEKA 2E94A 2Z52A 5A0KA 4RXEA 5B0MA 5JA0F 3WCAA 3OACB 3WCEA 4P0XA 4LIXA 3KRPB 3ACYA 3RYWA 3N45F 2OPNA 4LA5A 2E90A 2F9KF 3SDUA 3KBKA 3TFNA 3WEGA 4OKMA 4LOBA 4E9ZA 1V4EA 2ZEVA 2J1OA 4Q23A 1YQ7A 3TFVA 3SDRA 3AE0A 3WSBA 5IM1A 3ASXA 4NFJF 3SDTA 3ICNA 3NPKA 3ZMCA 3B7LA 3Q2ZA 4NFKF 3DYFA 3KROB 3PKOA 1V4JA 5DJPF 1JFGA 3BNYA 3ICZA 5AELA 2J1PA 3ZMBA 4N9UA 4LLSA 2AZKA 4XQRF 5ILHA 4EA1A 1HM4A 1VG7A 4XQSF 2OA6A 3SDVA 4JZXA 1DGPA 2EWGA 1N20A 3KRCB 3WEJA 3OABB 5HN8A 4KPJA 3LGZB 1ZW5A 3LMDA 3VJAA 4K10A 4KVDA 1YYUA 1N1BA 5EASA 2E8VA 1VG6A 5EATA 3LGKA 5HN7A 5HNAA 3P5RA 2Z78A 3ZCDA 3N5HF 4RNQA 5IK6A 4KVWA 3WCMA 1KIZA 3WEIA 5B03A 4GA3A 3KRAB 1UBWA 3P5PA 3WCDA 1UBYA 4P0WA 3N1WF 3WE9A 2E8UA 3KRFA 5A0JA 4JZBA 4PVYF 4LFGA 2E95A 5DGSF 5JV0F 1RQIA 4QPFA 5I1UA 1N1ZA 4H5CF 4QXSF 3NRIA 3AQCB 1HXAA 3V1VA 1YJ4A 2AELA 5IL8A 5EROA 5B02A 4KQSA 2Z4XA 3ACWA 4RXDA 3ADZA 1VG4A 2PS6A 3PYBA 4NKFA 3ID0A 2OPMA 4NKEA 4LPHF 1RTRA 5B0LA 3WCIA 4EA2A 3N3LF 3WCBA 3LG5A 3LZ9A 3N3DA 1WL0A 3N0FA 3LVSA 3UCAA 1JFAA 3IPIA 4RXCA 2FORA 3RBMA 5HN9A 3KRPA 5IKHA 1WKZA 5H9DA 1V4HA 2F7MF 3Q1OA 3G4FA 2ONGA 4XQTF 5ERMA 2ZCOA 1HXGA 3LSNA 4DXJA 3LDWA 3WJKA 5DW7A 3WCJA 5B0KA 4LFVF 4RXAA 4DWGA 3MAVA 4F6VA 1YYRA 3ICMA 1N24A 1V4KA 5JV1F 4N1ZF 3PYAA 2PS7A 3AQ0A 1KIYA 3EGTA 3RMGA 4RYPA 5E8HA 5E8LA 4LXWA 1DI1A 3MZVA 4LA6A 3N1VF 2Q80A 5AFXA 3ACXA 3NF2A 2Z50A 3APZA 4JXNA 1HX9A 5E8KA 3TC1A 5DGMF 5B01A 3WCLA 5B0IA 4DEMF 3WEHA 4OMHA 2QISA 5ER8A 2O1OA 2Q9YA 3WEFA 5JUZF 5DHKA 5IK9A 2VF6A 5KSXF 1VG3A 4DWBA
chains in the Genus database with same CATH superfamily
4HD1A 4GP2A 4KQ5A 3S9VA 4OGUA 3VJBA 5ILYA 2PS4A 1PS1A 4FJQA 1N21A 3ICKA 5AYPA 5A0IA 4UMJA 4OMGA 2FTZA 4LTZA 3N49F 3KRAA 4ZQ8A 3WCFA 2F8CF 4LZ0A 5B00A 4KVIA 4GP1A 4LFEA 5ERNA 4LPGF 3WCCA 4F6XA 1YHLA 1WL3A 3N0GA 4EA0A 2J5CA 5AHUB 2E93A 4JYXA 3DYHA 3P8RA 5DZ2A 3W7FA 3WEKA 4L2XF 1UBXA 3TS7A 4LZCA 5DGNF 3WSAA 4NG6A 1HXCA 2Z7HA 5DIQF 5ILKA 3WJNA 4E9UA 5ILDA 2Q58A 3CP6A 2E8TA 3M02A 2F94F 2Z4YA 4PVXF 3VJ9A 4KVYA 2PS5A 3OACA 4KPDA 3P41A 3IBAA 3ZL6A 4FP4A 4P0VA 3M9UA 3N6KF 3KB9A 1EZFA 2Z4WA 2E4OA 2ZCSA 5B0JA 2DH4A 3Q2QA 3CC9A 4KWDA 2Z4VA 1YHKA 2OGDA 5IK0A 1RQJA 3KROA 5DJRF 1WL1A 1YHMA 3LEEA 3LJIA 2E91A 1WY0A 2F8ZF 2I19A 2P1CA 3LOMA 5IN8A 5IMNA 3S4JA 3EFQA 3P8LA 4MC8A 3WC9A 3OYRA 4KKMA 4LTVA 2F89F 1WL2A 3RYEA 3DYGA 3V1XA 4KQUA 2H8OA 2F92F 3KRCA 2ZCRA 3OABA 2Z4ZA 2AETA 2PS8A 2RAHA 4H5DF 3N5JF 4DHDA 1WMWA 3CKEA 5DHIA 4NUAA 3SAEA 2E92A 3V66A 3ZOUA 1YYQA 5IL3A 3VJ8A 3LK5A 3PH7A 3WCGA 4MC0A 3PDEA 4E1EA 3WCHA 1V4IA 5IVGA 4F62A 2ZEUA 3M0GA 2Q9ZA 5IKAA 1YV5A 1N23A 3N46F 4LZ3A 3VJEA 1N22A 1VG2A 1YYTA 5ILJA 5ILZA 3NPRA 3VJDA 3TFPA 5JV2F 2E8WA 4NFIF 2AZJA 2Z7IA 3KRFB 4JVJF 3SDQA 2AZLA 3BNXA 1YYSA 2E8XA 5ILIA 5DJVF 3VJCA 5IMPA 3M01A 3M00A 3G4DA 2ZY1A 1UBVA 4H5EF 4KK2A 4DZWA 5CG5A 4JXYA 4KFAA 3QQVA 4WK5A 2ONHA 5CG6A 4MC3A 4OKZA 3EZ3A 3WJOA 4GAXA 5C05A 3LLWA 1HM7A 4DI5A 4LUUA 4KUXA 5IMIA 3AQBB 2ZCQA 3Q30A 5EAUA 4LLTA 3QKCA 1FPSA 2AEKA 2E94A 2Z52A 5A0KA 4RXEA 5B0MA 5JA0F 3WCAA 3OACB 3WCEA 4P0XA 4LIXA 3KRPB 3ACYA 3RYWA 3N45F 2OPNA 4LA5A 2E90A 2F9KF 3SDUA 3KBKA 3TFNA 3WEGA 4OKMA 4LOBA 4E9ZA 1V4EA 2ZEVA 2J1OA 4Q23A 1YQ7A 3TFVA 3SDRA 3AE0A 3WSBA 5IM1A 3ASXA 4NFJF 3SDTA 3ICNA 3NPKA 3ZMCA 3B7LA 3Q2ZA 4NFKF 3DYFA 3KROB 3PKOA 1V4JA 5DJPF 1JFGA 3BNYA 3ICZA 5AELA 2J1PA 3ZMBA 4N9UA 4LLSA 2AZKA 4XQRF 5ILHA 4EA1A 1HM4A 1VG7A 4XQSF 2OA6A 3SDVA 4JZXA 1DGPA 2EWGA 1N20A 3KRCB 3WEJA 3OABB 5HN8A 4KPJA 3LGZB 1ZW5A 3LMDA 3VJAA 4K10A 4KVDA 1YYUA 1N1BA 5EASA 2E8VA 1VG6A 5EATA 3LGKA 5HN7A 5HNAA 3P5RA 2Z78A 3ZCDA 3N5HF 4RNQA 5IK6A 4KVWA 3WCMA 1KIZA 3WEIA 5B03A 4GA3A 3KRAB 1UBWA 3P5PA 3WCDA 1UBYA 4P0WA 3N1WF 3WE9A 2E8UA 3KRFA 5A0JA 4JZBA 4PVYF 4LFGA 2E95A 5DGSF 5JV0F 1RQIA 4QPFA 5I1UA 1N1ZA 4H5CF 4QXSF 3NRIA 3AQCB 1HXAA 3V1VA 1YJ4A 2AELA 5IL8A 5EROA 5B02A 4KQSA 2Z4XA 3ACWA 4RXDA 3ADZA 1VG4A 2PS6A 3PYBA 4NKFA 3ID0A 2OPMA 4NKEA 4LPHF 1RTRA 5B0LA 3WCIA 4EA2A 3N3LF 3WCBA 3LG5A 3LZ9A 3N3DA 1WL0A 3N0FA 3LVSA 3UCAA 1JFAA 3IPIA 4RXCA 2FORA 3RBMA 5HN9A 3KRPA 5IKHA 1WKZA 5H9DA 1V4HA 2F7MF 3Q1OA 3G4FA 2ONGA 4XQTF 5ERMA 2ZCOA 1HXGA 3LSNA 4DXJA 3LDWA 3WJKA 5DW7A 3WCJA 5B0KA 4LFVF 4RXAA 4DWGA 3MAVA 4F6VA 1YYRA 3ICMA 1N24A 1V4KA 5JV1F 4N1ZF 3PYAA 2PS7A 3AQ0A 1KIYA 3EGTA 3RMGA 4RYPA 5E8HA 5E8LA 4LXWA 1DI1A 3MZVA 4LA6A 3N1VF 2Q80A 5AFXA 3ACXA 3NF2A 2Z50A 3APZA 4JXNA 1HX9A 5E8KA 3TC1A 5DGMF 5B01A 3WCLA 5B0IA 4DEMF 3WEHA 4OMHA 2QISA 5ER8A 2O1OA 2Q9YA 3WEFA 5JUZF 5DHKA 5IK9A 2VF6A 5KSXF 1VG3A 4DWBA
chains in the Genus database with same CATH topology
4HD1A 4GP2A 4KQ5A 3S9VA 4OGUA 3VJBA 5ILYA 2PS4A 1PS1A 4FJQA 1N21A 3ICKA 5AYPA 5A0IA 4UMJA 4OMGA 2FTZA 4LTZA 3N49F 3KRAA 4ZQ8A 3WCFA 2F8CF 4LZ0A 5B00A 4KVIA 4GP1A 4LFEA 5ERNA 4LPGF 3WCCA 4F6XA 1YHLA 1WL3A 3N0GA 4EA0A 2J5CA 5AHUB 2E93A 4JYXA 3DYHA 3P8RA 5DZ2A 3W7FA 3WEKA 4L2XF 1UBXA 3TS7A 4LZCA 5DGNF 3WSAA 4NG6A 1HXCA 2Z7HA 5DIQF 5ILKA 3WJNA 4E9UA 5ILDA 2Q58A 3CP6A 2E8TA 3M02A 2F94F 2Z4YA 4PVXF 3VJ9A 4KVYA 2PS5A 3OACA 4KPDA 3P41A 3IBAA 3ZL6A 4FP4A 4P0VA 3M9UA 3N6KF 3KB9A 1EZFA 2Z4WA 2E4OA 2ZCSA 5B0JA 2DH4A 3Q2QA 3CC9A 4KWDA 2Z4VA 1YHKA 2OGDA 5IK0A 1RQJA 3KROA 5DJRF 1WL1A 1YHMA 3LEEA 3LJIA 2E91A 1WY0A 2F8ZF 2I19A 2P1CA 3LOMA 5IN8A 5IMNA 3S4JA 3EFQA 3P8LA 4MC8A 3WC9A 3OYRA 4KKMA 4LTVA 2F89F 1WL2A 3RYEA 3DYGA 3V1XA 4KQUA 2H8OA 2F92F 3KRCA 2ZCRA 3OABA 2Z4ZA 2AETA 2PS8A 2RAHA 4H5DF 3N5JF 4DHDA 1WMWA 3CKEA 5DHIA 4NUAA 3SAEA 2E92A 3V66A 3ZOUA 1YYQA 5IL3A 3VJ8A 3LK5A 3PH7A 3WCGA 4MC0A 3PDEA 4E1EA 3WCHA 1V4IA 5IVGA 4F62A 2ZEUA 3M0GA 2Q9ZA 5IKAA 1YV5A 1N23A 3N46F 4LZ3A 3VJEA 1N22A 1VG2A 1YYTA 5ILJA 5ILZA 3NPRA 3VJDA 3TFPA 5JV2F 2E8WA 4NFIF 2AZJA 2Z7IA 3KRFB 4JVJF 3SDQA 2AZLA 3BNXA 1YYSA 2E8XA 5ILIA 5DJVF 3VJCA 5IMPA 3M01A 3M00A 3G4DA 2ZY1A 1UBVA 4H5EF 4KK2A 4DZWA 5CG5A 4JXYA 4KFAA 3QQVA 4WK5A 2ONHA 5CG6A 4MC3A 4OKZA 3EZ3A 3WJOA 4GAXA 5C05A 3LLWA 1HM7A 4DI5A 4LUUA 4KUXA 5IMIA 3AQBB 2ZCQA 3Q30A 5EAUA 4LLTA 3QKCA 1FPSA 2AEKA 2E94A 2Z52A 5A0KA 4RXEA 5B0MA 5JA0F 3WCAA 3OACB 3WCEA 4P0XA 4LIXA 3KRPB 3ACYA 3RYWA 3N45F 2OPNA 4LA5A 2E90A 2F9KF 3SDUA 3KBKA 3TFNA 3WEGA 4OKMA 4LOBA 4E9ZA 1V4EA 2ZEVA 2J1OA 4Q23A 1YQ7A 3TFVA 3SDRA 3AE0A 3WSBA 5IM1A 3ASXA 4NFJF 3SDTA 3ICNA 3NPKA 3ZMCA 3B7LA 3Q2ZA 4NFKF 3DYFA 3KROB 3PKOA 1V4JA 5DJPF 1JFGA 3BNYA 3ICZA 5AELA 2J1PA 3ZMBA 4N9UA 4LLSA 2AZKA 4XQRF 5ILHA 4EA1A 1HM4A 1VG7A 4XQSF 2OA6A 3SDVA 4JZXA 1DGPA 2EWGA 1N20A 3KRCB 3WEJA 3OABB 5HN8A 4KPJA 3LGZB 1ZW5A 3LMDA 3VJAA 4K10A 4KVDA 1YYUA 1N1BA 5EASA 2E8VA 1VG6A 5EATA 3LGKA 5HN7A 5HNAA 3P5RA 2Z78A 3ZCDA 3N5HF 4RNQA 5IK6A 4KVWA 3WCMA 1KIZA 3WEIA 5B03A 4GA3A 3KRAB 1UBWA 3P5PA 3WCDA 1UBYA 4P0WA 3N1WF 3WE9A 2E8UA 3KRFA 5A0JA 4JZBA 4PVYF 4LFGA 2E95A 5DGSF 5JV0F 1RQIA 4QPFA 5I1UA 1N1ZA 4H5CF 4QXSF 3NRIA 3AQCB 1HXAA 3V1VA 1YJ4A 2AELA 5IL8A 5EROA 5B02A 4KQSA 2Z4XA 3ACWA 4RXDA 3ADZA 1VG4A 2PS6A 3PYBA 4NKFA 3ID0A 2OPMA 4NKEA 4LPHF 1RTRA 5B0LA 3WCIA 4EA2A 3N3LF 3WCBA 3LG5A 3LZ9A 3N3DA 1WL0A 3N0FA 3LVSA 3UCAA 1JFAA 3IPIA 4RXCA 2FORA 3RBMA 5HN9A 3KRPA 5IKHA 1WKZA 5H9DA 1V4HA 2F7MF 3Q1OA 3G4FA 2ONGA 4XQTF 5ERMA 2ZCOA 1HXGA 3LSNA 4DXJA 3LDWA 3WJKA 5DW7A 3WCJA 5B0KA 4LFVF 4RXAA 4DWGA 3MAVA 4F6VA 1YYRA 3ICMA 1N24A 1V4KA 5JV1F 4N1ZF 3PYAA 2PS7A 3AQ0A 1KIYA 3EGTA 3RMGA 4RYPA 5E8HA 5E8LA 4LXWA 1DI1A 3MZVA 4LA6A 3N1VF 2Q80A 5AFXA 3ACXA 3NF2A 2Z50A 3APZA 4JXNA 1HX9A 5E8KA 3TC1A 5DGMF 5B01A 3WCLA 5B0IA 4DEMF 3WEHA 4OMHA 2QISA 5ER8A 2O1OA 2Q9YA 3WEFA 5JUZF 5DHKA 5IK9A 2VF6A 5KSXF 1VG3A 4DWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HD1 A;  4GP2 A;  4KQ5 A;  3S9V A;  4OGU A;  3VJB A;  5ILY A;  2PS4 A;  1PS1 A;  4FJQ A;  1N21 A;  3ICK A;  5AYP A;  5A0I A;  4UMJ A;  4OMG A;  2FTZ A;  4LTZ A;  3N49 F;  3KRA A;  4ZQ8 A;  3WCF A;  2F8C F;  4LZ0 A;  5B00 A;  4KVI A;  4GP1 A;  4LFE A;  5ERN A;  4LPG F;  3WCC A;  4F6X A;  1YHL A;  1WL3 A;  3N0G A;  4EA0 A;  2J5C A;  5AHU B;  2E93 A;  4JYX A;  3DYH A;  3P8R A;  5DZ2 A;  3W7F A;  3WEK A;  4L2X F;  1UBX A;  3TS7 A;  4LZC A;  5DGN F;  3WSA A;  4NG6 A;  1HXC A;  2Z7H A;  5DIQ F;  5ILK A;  3WJN A;  4E9U A;  5ILD A;  2Q58 A;  3CP6 A;  2E8T A;  3M02 A;  2F94 F;  2Z4Y A;  4PVX F;  3VJ9 A;  4KVY A;  2PS5 A;  3OAC A;  4KPD A;  3P41 A;  3IBA A;  3ZL6 A;  4FP4 A;  4P0V A;  3M9U A;  3N6K F;  3KB9 A;  1EZF A;  2Z4W A;  2E4O A;  2ZCS A;  5B0J A;  2DH4 A;  3Q2Q A;  3CC9 A;  4KWD A;  2Z4V A;  1YHK A;  2OGD A;  5IK0 A;  1RQJ A;  3KRO A;  5DJR F;  1WL1 A;  1YHM A;  3LEE A;  3LJI A;  2E91 A;  1WY0 A;  2F8Z F;  2I19 A;  2P1C A;  3LOM A;  5IN8 A;  5IMN A;  3S4J A;  3EFQ A;  3P8L A;  4MC8 A;  3WC9 A;  3OYR A;  4KKM A;  4LTV A;  2F89 F;  1WL2 A;  3RYE A;  3DYG A;  3V1X A;  4KQU A;  2H8O A;  2F92 F;  3KRC A;  2ZCR A;  3OAB A;  2Z4Z A;  2AET A;  2PS8 A;  2RAH A;  4H5D F;  3N5J F;  4DHD A;  1WMW A;  3CKE A;  5DHI A;  4NUA A;  3SAE A;  2E92 A;  3V66 A;  3ZOU A;  1YYQ A;  5IL3 A;  3VJ8 A;  3LK5 A;  3PH7 A;  3WCG A;  4MC0 A;  3PDE A;  4E1E A;  3WCH A;  1V4I A;  5IVG A;  4F62 A;  2ZEU A;  3M0G A;  2Q9Z A;  5IKA A;  1YV5 A;  1N23 A;  3N46 F;  4LZ3 A;  3VJE A;  1N22 A;  1VG2 A;  1YYT A;  5ILJ A;  5ILZ A;  3NPR A;  3VJD A;  3TFP A;  5JV2 F;  2E8W A;  4NFI F;  2AZJ A;  2Z7I A;  3KRF B;  4JVJ F;  3SDQ A;  2AZL A;  3BNX A;  1YYS A;  2E8X A;  5ILI A;  5DJV F;  3VJC A;  5IMP A;  3M01 A;  3M00 A;  3G4D A;  2ZY1 A;  1UBV A;  4H5E F;  4KK2 A;  4DZW A;  5CG5 A;  4JXY A;  4KFA A;  3QQV A;  4WK5 A;  2ONH A;  5CG6 A;  4MC3 A;  4OKZ A;  3EZ3 A;  3WJO A;  4GAX A;  5C05 A;  3LLW A;  1HM7 A;  4DI5 A;  4LUU A;  4KUX A;  5IMI A;  3AQB B;  2ZCQ A;  3Q30 A;  5EAU A;  4LLT A;  3QKC A;  1FPS A;  2AEK A;  2E94 A;  2Z52 A;  5A0K A;  4RXE A;  5B0M A;  5JA0 F;  3WCA A;  3OAC B;  3WCE A;  4P0X A;  4LIX A;  3KRP B;  3ACY A;  3RYW A;  3N45 F;  2OPN A;  4LA5 A;  2E90 A;  2F9K F;  3SDU A;  3KBK A;  3TFN A;  3WEG A;  4OKM A;  4LOB A;  4E9Z A;  1V4E A;  2ZEV A;  2J1O A;  4Q23 A;  1YQ7 A;  3TFV A;  3SDR A;  3AE0 A;  3WSB A;  5IM1 A;  3ASX A;  4NFJ F;  3SDT A;  3ICN A;  3NPK A;  3ZMC A;  3B7L A;  3Q2Z A;  4NFK F;  3DYF A;  3KRO B;  3PKO A;  1V4J A;  5DJP F;  1JFG A;  3BNY A;  3ICZ A;  5AEL A;  2J1P A;  3ZMB A;  4N9U A;  4LLS A;  2AZK A;  4XQR F;  5ILH A;  4EA1 A;  1HM4 A;  1VG7 A;  4XQS F;  2OA6 A;  3SDV A;  4JZX A;  1DGP A;  2EWG A;  1N20 A;  3KRC B;  3WEJ A;  3OAB B;  5HN8 A;  4KPJ A;  3LGZ B;  1ZW5 A;  3LMD A;  3VJA A;  4K10 A;  4KVD A;  1YYU A;  1N1B A;  5EAS A;  2E8V A;  1VG6 A;  5EAT A;  3LGK A;  5HN7 A;  5HNA A;  3P5R A;  2Z78 A;  3ZCD A;  3N5H F;  4RNQ A;  5IK6 A;  4KVW A;  3WCM A;  1KIZ A;  3WEI A;  5B03 A;  4GA3 A;  3KRA B;  1UBW A;  3P5P A;  3WCD A;  1UBY A;  4P0W A;  3N1W F;  3WE9 A;  2E8U A;  3KRF A;  5A0J A;  4JZB A;  4PVY F;  4LFG A;  2E95 A;  5DGS F;  5JV0 F;  1RQI A;  4QPF A;  5I1U A;  1N1Z A;  4H5C F;  4QXS F;  3NRI A;  3AQC B;  1HXA A;  3V1V A;  1YJ4 A;  2AEL A;  5IL8 A;  5ERO A;  5B02 A;  4KQS A;  2Z4X A;  3ACW A;  4RXD A;  3ADZ A;  1VG4 A;  2PS6 A;  3PYB A;  4NKF A;  3ID0 A;  2OPM A;  4NKE A;  4LPH F;  1RTR A;  5B0L A;  3WCI A;  4EA2 A;  3N3L F;  3WCB A;  3LG5 A;  3LZ9 A;  3N3D A;  1WL0 A;  3N0F A;  3LVS A;  3UCA A;  1JFA A;  3IPI A;  4RXC A;  2FOR A;  3RBM A;  5HN9 A;  3KRP A;  5IKH A;  1WKZ A;  5H9D A;  1V4H A;  2F7M F;  3Q1O A;  3G4F A;  2ONG A;  4XQT F;  5ERM A;  2ZCO A;  1HXG A;  3LSN A;  4DXJ A;  3LDW A;  3WJK A;  5DW7 A;  3WCJ A;  5B0K A;  4LFV F;  4RXA A;  4DWG A;  3MAV A;  4F6V A;  1YYR A;  3ICM A;  1N24 A;  1V4K A;  5JV1 F;  4N1Z F;  3PYA A;  2PS7 A;  3AQ0 A;  1KIY A;  3EGT A;  3RMG A;  4RYP A;  5E8H A;  5E8L A;  4LXW A;  1DI1 A;  3MZV A;  4LA6 A;  3N1V F;  2Q80 A;  5AFX A;  3ACX A;  3NF2 A;  2Z50 A;  3APZ A;  4JXN A;  1HX9 A;  5E8K A;  3TC1 A;  5DGM F;  5B01 A;  3WCL A;  5B0I A;  4DEM F;  3WEH A;  4OMH A;  2QIS A;  5ER8 A;  2O1O A;  2Q9Y A;  3WEF A;  5JUZ F;  5DHK A;  5IK9 A;  2VF6 A;  5KSX F;  1VG3 A;  4DWB A; 
#chains in the Genus database with same CATH topology
 4HD1 A;  4GP2 A;  4KQ5 A;  3S9V A;  4OGU A;  3VJB A;  5ILY A;  2PS4 A;  1PS1 A;  4FJQ A;  1N21 A;  3ICK A;  5AYP A;  5A0I A;  4UMJ A;  4OMG A;  2FTZ A;  4LTZ A;  3N49 F;  3KRA A;  4ZQ8 A;  3WCF A;  2F8C F;  4LZ0 A;  5B00 A;  4KVI A;  4GP1 A;  4LFE A;  5ERN A;  4LPG F;  3WCC A;  4F6X A;  1YHL A;  1WL3 A;  3N0G A;  4EA0 A;  2J5C A;  5AHU B;  2E93 A;  4JYX A;  3DYH A;  3P8R A;  5DZ2 A;  3W7F A;  3WEK A;  4L2X F;  1UBX A;  3TS7 A;  4LZC A;  5DGN F;  3WSA A;  4NG6 A;  1HXC A;  2Z7H A;  5DIQ F;  5ILK A;  3WJN A;  4E9U A;  5ILD A;  2Q58 A;  3CP6 A;  2E8T A;  3M02 A;  2F94 F;  2Z4Y A;  4PVX F;  3VJ9 A;  4KVY A;  2PS5 A;  3OAC A;  4KPD A;  3P41 A;  3IBA A;  3ZL6 A;  4FP4 A;  4P0V A;  3M9U A;  3N6K F;  3KB9 A;  1EZF A;  2Z4W A;  2E4O A;  2ZCS A;  5B0J A;  2DH4 A;  3Q2Q A;  3CC9 A;  4KWD A;  2Z4V A;  1YHK A;  2OGD A;  5IK0 A;  1RQJ A;  3KRO A;  5DJR F;  1WL1 A;  1YHM A;  3LEE A;  3LJI A;  2E91 A;  1WY0 A;  2F8Z F;  2I19 A;  2P1C A;  3LOM A;  5IN8 A;  5IMN A;  3S4J A;  3EFQ A;  3P8L A;  4MC8 A;  3WC9 A;  3OYR A;  4KKM A;  4LTV A;  2F89 F;  1WL2 A;  3RYE A;  3DYG A;  3V1X A;  4KQU A;  2H8O A;  2F92 F;  3KRC A;  2ZCR A;  3OAB A;  2Z4Z A;  2AET A;  2PS8 A;  2RAH A;  4H5D F;  3N5J F;  4DHD A;  1WMW A;  3CKE A;  5DHI A;  4NUA A;  3SAE A;  2E92 A;  3V66 A;  3ZOU A;  1YYQ A;  5IL3 A;  3VJ8 A;  3LK5 A;  3PH7 A;  3WCG A;  4MC0 A;  3PDE A;  4E1E A;  3WCH A;  1V4I A;  5IVG A;  4F62 A;  2ZEU A;  3M0G A;  2Q9Z A;  5IKA A;  1YV5 A;  1N23 A;  3N46 F;  4LZ3 A;  3VJE A;  1N22 A;  1VG2 A;  1YYT A;  5ILJ A;  5ILZ A;  3NPR A;  3VJD A;  3TFP A;  5JV2 F;  2E8W A;  4NFI F;  2AZJ A;  2Z7I A;  3KRF B;  4JVJ F;  3SDQ A;  2AZL A;  3BNX A;  1YYS A;  2E8X A;  5ILI A;  5DJV F;  3VJC A;  5IMP A;  3M01 A;  3M00 A;  3G4D A;  2ZY1 A;  1UBV A;  4H5E F;  4KK2 A;  4DZW A;  5CG5 A;  4JXY A;  4KFA A;  3QQV A;  4WK5 A;  2ONH A;  5CG6 A;  4MC3 A;  4OKZ A;  3EZ3 A;  3WJO A;  4GAX A;  5C05 A;  3LLW A;  1HM7 A;  4DI5 A;  4LUU A;  4KUX A;  5IMI A;  3AQB B;  2ZCQ A;  3Q30 A;  5EAU A;  4LLT A;  3QKC A;  1FPS A;  2AEK A;  2E94 A;  2Z52 A;  5A0K A;  4RXE A;  5B0M A;  5JA0 F;  3WCA A;  3OAC B;  3WCE A;  4P0X A;  4LIX A;  3KRP B;  3ACY A;  3RYW A;  3N45 F;  2OPN A;  4LA5 A;  2E90 A;  2F9K F;  3SDU A;  3KBK A;  3TFN A;  3WEG A;  4OKM A;  4LOB A;  4E9Z A;  1V4E A;  2ZEV A;  2J1O A;  4Q23 A;  1YQ7 A;  3TFV A;  3SDR A;  3AE0 A;  3WSB A;  5IM1 A;  3ASX A;  4NFJ F;  3SDT A;  3ICN A;  3NPK A;  3ZMC A;  3B7L A;  3Q2Z A;  4NFK F;  3DYF A;  3KRO B;  3PKO A;  1V4J A;  5DJP F;  1JFG A;  3BNY A;  3ICZ A;  5AEL A;  2J1P A;  3ZMB A;  4N9U A;  4LLS A;  2AZK A;  4XQR F;  5ILH A;  4EA1 A;  1HM4 A;  1VG7 A;  4XQS F;  2OA6 A;  3SDV A;  4JZX A;  1DGP A;  2EWG A;  1N20 A;  3KRC B;  3WEJ A;  3OAB B;  5HN8 A;  4KPJ A;  3LGZ B;  1ZW5 A;  3LMD A;  3VJA A;  4K10 A;  4KVD A;  1YYU A;  1N1B A;  5EAS A;  2E8V A;  1VG6 A;  5EAT A;  3LGK A;  5HN7 A;  5HNA A;  3P5R A;  2Z78 A;  3ZCD A;  3N5H F;  4RNQ A;  5IK6 A;  4KVW A;  3WCM A;  1KIZ A;  3WEI A;  5B03 A;  4GA3 A;  3KRA B;  1UBW A;  3P5P A;  3WCD A;  1UBY A;  4P0W A;  3N1W F;  3WE9 A;  2E8U A;  3KRF A;  5A0J A;  4JZB A;  4PVY F;  4LFG A;  2E95 A;  5DGS F;  5JV0 F;  1RQI A;  4QPF A;  5I1U A;  1N1Z A;  4H5C F;  4QXS F;  3NRI A;  3AQC B;  1HXA A;  3V1V A;  1YJ4 A;  2AEL A;  5IL8 A;  5ERO A;  5B02 A;  4KQS A;  2Z4X A;  3ACW A;  4RXD A;  3ADZ A;  1VG4 A;  2PS6 A;  3PYB A;  4NKF A;  3ID0 A;  2OPM A;  4NKE A;  4LPH F;  1RTR A;  5B0L A;  3WCI A;  4EA2 A;  3N3L F;  3WCB A;  3LG5 A;  3LZ9 A;  3N3D A;  1WL0 A;  3N0F A;  3LVS A;  3UCA A;  1JFA A;  3IPI A;  4RXC A;  2FOR A;  3RBM A;  5HN9 A;  3KRP A;  5IKH A;  1WKZ A;  5H9D A;  1V4H A;  2F7M F;  3Q1O A;  3G4F A;  2ONG A;  4XQT F;  5ERM A;  2ZCO A;  1HXG A;  3LSN A;  4DXJ A;  3LDW A;  3WJK A;  5DW7 A;  3WCJ A;  5B0K A;  4LFV F;  4RXA A;  4DWG A;  3MAV A;  4F6V A;  1YYR A;  3ICM A;  1N24 A;  1V4K A;  5JV1 F;  4N1Z F;  3PYA A;  2PS7 A;  3AQ0 A;  1KIY A;  3EGT A;  3RMG A;  4RYP A;  5E8H A;  5E8L A;  4LXW A;  1DI1 A;  3MZV A;  4LA6 A;  3N1V F;  2Q80 A;  5AFX A;  3ACX A;  3NF2 A;  2Z50 A;  3APZ A;  4JXN A;  1HX9 A;  5E8K A;  3TC1 A;  5DGM F;  5B01 A;  3WCL A;  5B0I A;  4DEM F;  3WEH A;  4OMH A;  2QIS A;  5ER8 A;  2O1O A;  2Q9Y A;  3WEF A;  5JUZ F;  5DHK A;  5IK9 A;  2VF6 A;  5KSX F;  1VG3 A;  4DWB A; 
#chains in the Genus database with same CATH homology
 4HD1 A;  4GP2 A;  4KQ5 A;  3S9V A;  4OGU A;  3VJB A;  5ILY A;  2PS4 A;  1PS1 A;  4FJQ A;  1N21 A;  3ICK A;  5AYP A;  5A0I A;  4UMJ A;  4OMG A;  2FTZ A;  4LTZ A;  3N49 F;  3KRA A;  4ZQ8 A;  3WCF A;  2F8C F;  4LZ0 A;  5B00 A;  4KVI A;  4GP1 A;  4LFE A;  5ERN A;  4LPG F;  3WCC A;  4F6X A;  1YHL A;  1WL3 A;  3N0G A;  4EA0 A;  2J5C A;  5AHU B;  2E93 A;  4JYX A;  3DYH A;  3P8R A;  5DZ2 A;  3W7F A;  3WEK A;  4L2X F;  1UBX A;  3TS7 A;  4LZC A;  5DGN F;  3WSA A;  4NG6 A;  1HXC A;  2Z7H A;  5DIQ F;  5ILK A;  3WJN A;  4E9U A;  5ILD A;  2Q58 A;  3CP6 A;  2E8T A;  3M02 A;  2F94 F;  2Z4Y A;  4PVX F;  3VJ9 A;  4KVY A;  2PS5 A;  3OAC A;  4KPD A;  3P41 A;  3IBA A;  3ZL6 A;  4FP4 A;  4P0V A;  3M9U A;  3N6K F;  3KB9 A;  1EZF A;  2Z4W A;  2E4O A;  2ZCS A;  5B0J A;  2DH4 A;  3Q2Q A;  3CC9 A;  4KWD A;  2Z4V A;  1YHK A;  2OGD A;  5IK0 A;  1RQJ A;  3KRO A;  5DJR F;  1WL1 A;  1YHM A;  3LEE A;  3LJI A;  2E91 A;  1WY0 A;  2F8Z F;  2I19 A;  2P1C A;  3LOM A;  5IN8 A;  5IMN A;  3S4J A;  3EFQ A;  3P8L A;  4MC8 A;  3WC9 A;  3OYR A;  4KKM A;  4LTV A;  2F89 F;  1WL2 A;  3RYE A;  3DYG A;  3V1X A;  4KQU A;  2H8O A;  2F92 F;  3KRC A;  2ZCR A;  3OAB A;  2Z4Z A;  2AET A;  2PS8 A;  2RAH A;  4H5D F;  3N5J F;  4DHD A;  1WMW A;  3CKE A;  5DHI A;  4NUA A;  3SAE A;  2E92 A;  3V66 A;  3ZOU A;  1YYQ A;  5IL3 A;  3VJ8 A;  3LK5 A;  3PH7 A;  3WCG A;  4MC0 A;  3PDE A;  4E1E A;  3WCH A;  1V4I A;  5IVG A;  4F62 A;  2ZEU A;  3M0G A;  2Q9Z A;  5IKA A;  1YV5 A;  1N23 A;  3N46 F;  4LZ3 A;  3VJE A;  1N22 A;  1VG2 A;  1YYT A;  5ILJ A;  5ILZ A;  3NPR A;  3VJD A;  3TFP A;  5JV2 F;  2E8W A;  4NFI F;  2AZJ A;  2Z7I A;  3KRF B;  4JVJ F;  3SDQ A;  2AZL A;  3BNX A;  1YYS A;  2E8X A;  5ILI A;  5DJV F;  3VJC A;  5IMP A;  3M01 A;  3M00 A;  3G4D A;  2ZY1 A;  1UBV A;  4H5E F;  4KK2 A;  4DZW A;  5CG5 A;  4JXY A;  4KFA A;  3QQV A;  4WK5 A;  2ONH A;  5CG6 A;  4MC3 A;  4OKZ A;  3EZ3 A;  3WJO A;  4GAX A;  5C05 A;  3LLW A;  1HM7 A;  4DI5 A;  4LUU A;  4KUX A;  5IMI A;  3AQB B;  2ZCQ A;  3Q30 A;  5EAU A;  4LLT A;  3QKC A;  1FPS A;  2AEK A;  2E94 A;  2Z52 A;  5A0K A;  4RXE A;  5B0M A;  5JA0 F;  3WCA A;  3OAC B;  3WCE A;  4P0X A;  4LIX A;  3KRP B;  3ACY A;  3RYW A;  3N45 F;  2OPN A;  4LA5 A;  2E90 A;  2F9K F;  3SDU A;  3KBK A;  3TFN A;  3WEG A;  4OKM A;  4LOB A;  4E9Z A;  1V4E A;  2ZEV A;  2J1O A;  4Q23 A;  1YQ7 A;  3TFV A;  3SDR A;  3AE0 A;  3WSB A;  5IM1 A;  3ASX A;  4NFJ F;  3SDT A;  3ICN A;  3NPK A;  3ZMC A;  3B7L A;  3Q2Z A;  4NFK F;  3DYF A;  3KRO B;  3PKO A;  1V4J A;  5DJP F;  1JFG A;  3BNY A;  3ICZ A;  5AEL A;  2J1P A;  3ZMB A;  4N9U A;  4LLS A;  2AZK A;  4XQR F;  5ILH A;  4EA1 A;  1HM4 A;  1VG7 A;  4XQS F;  2OA6 A;  3SDV A;  4JZX A;  1DGP A;  2EWG A;  1N20 A;  3KRC B;  3WEJ A;  3OAB B;  5HN8 A;  4KPJ A;  3LGZ B;  1ZW5 A;  3LMD A;  3VJA A;  4K10 A;  4KVD A;  1YYU A;  1N1B A;  5EAS A;  2E8V A;  1VG6 A;  5EAT A;  3LGK A;  5HN7 A;  5HNA A;  3P5R A;  2Z78 A;  3ZCD A;  3N5H F;  4RNQ A;  5IK6 A;  4KVW A;  3WCM A;  1KIZ A;  3WEI A;  5B03 A;  4GA3 A;  3KRA B;  1UBW A;  3P5P A;  3WCD A;  1UBY A;  4P0W A;  3N1W F;  3WE9 A;  2E8U A;  3KRF A;  5A0J A;  4JZB A;  4PVY F;  4LFG A;  2E95 A;  5DGS F;  5JV0 F;  1RQI A;  4QPF A;  5I1U A;  1N1Z A;  4H5C F;  4QXS F;  3NRI A;  3AQC B;  1HXA A;  3V1V A;  1YJ4 A;  2AEL A;  5IL8 A;  5ERO A;  5B02 A;  4KQS A;  2Z4X A;  3ACW A;  4RXD A;  3ADZ A;  1VG4 A;  2PS6 A;  3PYB A;  4NKF A;  3ID0 A;  2OPM A;  4NKE A;  4LPH F;  1RTR A;  5B0L A;  3WCI A;  4EA2 A;  3N3L F;  3WCB A;  3LG5 A;  3LZ9 A;  3N3D A;  1WL0 A;  3N0F A;  3LVS A;  3UCA A;  1JFA A;  3IPI A;  4RXC A;  2FOR A;  3RBM A;  5HN9 A;  3KRP A;  5IKH A;  1WKZ A;  5H9D A;  1V4H A;  2F7M F;  3Q1O A;  3G4F A;  2ONG A;  4XQT F;  5ERM A;  2ZCO A;  1HXG A;  3LSN A;  4DXJ A;  3LDW A;  3WJK A;  5DW7 A;  3WCJ A;  5B0K A;  4LFV F;  4RXA A;  4DWG A;  3MAV A;  4F6V A;  1YYR A;  3ICM A;  1N24 A;  1V4K A;  5JV1 F;  4N1Z F;  3PYA A;  2PS7 A;  3AQ0 A;  1KIY A;  3EGT A;  3RMG A;  4RYP A;  5E8H A;  5E8L A;  4LXW A;  1DI1 A;  3MZV A;  4LA6 A;  3N1V F;  2Q80 A;  5AFX A;  3ACX A;  3NF2 A;  2Z50 A;  3APZ A;  4JXN A;  1HX9 A;  5E8K A;  3TC1 A;  5DGM F;  5B01 A;  3WCL A;  5B0I A;  4DEM F;  3WEH A;  4OMH A;  2QIS A;  5ER8 A;  2O1O A;  2Q9Y A;  3WEF A;  5JUZ F;  5DHK A;  5IK9 A;  2VF6 A;  5KSX F;  1VG3 A;  4DWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...