3LJIA

Crystal structure of putative geranyltranstransferase from pseudomonas fluorescens pf-5
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
292
structure length
272
Chain Sequence
SLTAYQASSQARVDAAMHTLFTAPSPELARLYEAMRYSVMNGGKRVRPLLAYAACEALGGKPEQANGAACAVELIHAYSLVHDDLPAMDDDDLRRGQPTTHKAFDEACAILAGDGLQSLAFSALLDPALSDASAEIRLRMVTTLAQAAGPAGMVGGQAIDLGSVGLKLDQQALEYMHRHKTGALIEASVILGALASGRAEKGELKALQTYAQAIGLAFQVQDDILDPTYPALLGLAAAKEYALELRDQALHALRPFDAAAEPLRELARYIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title CRYSTAL STRUCTURE OF putative geranyltranstransferase from Pseudomonas fluorescens Pf-5
rcsb
source organism Pseudomonas fluorescens
total genus 95
structure length 272
sequence length 292
ec nomenclature
pdb deposition date 2010-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3ljiA00
2E8WA 1YHLA 3S4JA 3ACXA 4H5EF 2E94A 3PDEA 5JA0F 5H9DA 1YHKA 2F8ZF 3LG5A 4F6XA 5B00A 1V4IA 5AYPA 3ADZA 2ZEUA 2F7MF 1HM7A 2OA6A 4MC3A 3SDTA 2H8OA 1WL1A 5ILJA 3N3DA 4RXAA 3ACYA 5DIQF 2E92A 4LXWA 3LOMA 3N5JF 5E8KA 4LPHF 3WEGA 3WCFA 3ZMCA 1WL2A 2ZCOA 3KB9A 3WCAA 5DHIA 4DWGA 3PKOA 5ERNA 3WEJA 3CKEA 1ZW5A 2Z7IA 4FJQA 5IMNA 5DGMF 4E1EA 4RXEA 3LSNA 4N1ZF 4EA0A 4DWBA 1YHMA 1UBVA 1HXAA 5IMPA 3WCDA 3ZCDA 1YYUA 3ID0A 1YYTA 4DHDA 3ICZA 3BNXA 4KUXA 3P8LA 2AZLA 4KQSA 2PS8A 3WCBA 5I1UA 4DZWA 5A0KA 4XQTF 4ZQ8A 3P8RA 1WMWA 3TFPA 4N9UA 4RXCA 3WC9A 4OKMA 4MC0A 3N1VF 4JZXA 2Z50A 3WCCA 5B03A 1HXCA 2ONHA 5JV0F 3V1XA 5CG6A 1WKZA 3RMGA 4JXNA 3WCIA 4HD1A 4LA5A 2E93A 3ICMA 3SAEA 3LMDA 1N24A 3AQCB 4QPFA 3VJDA 3MAVA 4KPDA 5B0JA 5IKAA 3VJCA 2PS7A 3ASXA 3EZ3A 3ICKA 1VG3A 3PH7A 2Q58A 2Z78A 4PVYF 5ILIA 3OACB 4H5DF 4KVDA 2Z4VA 4EA2A 3PYBA 3ZMBA 3N49F 3KRPA 3Q30A 4OKZA 5AFXA 3KROB 3SDUA 3WJKA 3M9UA 3KRAA 4KWDA 3OABB 1N21A 4LIXA 4WK5A 4LUUA 3LLWA 3LVSA 1V4EA 2E8UA 2Z4XA 5ILYA 2E90A 2F89F 2Z4YA 3N6KF 2VF6A 5DGSF 4GA3A 3BNYA 2Z4ZA 4F62A 2F9KF 2AZJA 3WSAA 4GP2A 5DW7A 3LDWA 3RYWA 3DYFA 3NPKA 2FTZA 5ILZA 5IMIA 2E4OA 2F94F 3IBAA 2PS5A 4JVJF 4LTZA 1VG6A 3WEHA 2Z7HA 2RAHA 4NKEA 5IM1A 3Q2ZA 3M01A 1V4KA 3ZL6A 4FP4A 5JUZF 3KRFB 1UBWA 4OMHA 3SDVA 5IL8A 1VG7A 3TS7A 3AE0A 4GAXA 4LOBA 4JYXA 2QISA 5ER8A 4RXDA 4QXSF 2AEKA 3EGTA 1RQJA 1PS1A 4XQSF 1DGPA 3VJEA 1HM4A 5IK9A 3APZA 1HXGA 5A0IA 4LFVF 4LPGF 4KKMA 5ILDA 4Q23A 2Q80A 1N1BA 5DZ2A 3V66A 4XQRF 4NKFA 5ILHA 5HNAA 3N1WF 5B0LA 2E91A 2OPMA 4E9UA 3VJ9A 3WCGA 3EFQA 5IN8A 3CC9A 1YYSA 1DI1A 3LJIA 2ZEVA 5IK6A 4K10A 3VJAA 2AELA 1JFAA 1N23A 5B01A 4OMGA 4PVXF 3TFNA 3ZOUA 2E8TA 1KIZA 4KQ5A 3PYAA 5IK0A 4P0WA 4LLSA 4KK2A 5EAUA 1VG2A 3Q2QA 4KVWA 3KRCB 5DHKA 2PS4A 5JV2F 2PS6A 5AELA 2E8XA 2J1PA 5B02A 4UMJA 3S9VA 4RNQA 2F92F 4LZ3A 3NF2A 3AQ0A 5B0MA 5E8HA 4DEMF 2ZCQA 3LK5A 5EASA 5ERMA 2P1CA 3NRIA 3M00A 2Q9YA 2AETA 3WCLA 2ZCSA 1YYRA 1WL0A 1EZFA 3M02A 4KFAA 3P41A 3RBMA 3N0FA 1FPSA 5HN8A 5HN7A 3N0GA 3TC1A 1N20A 3CP6A 2ONGA 3OACA 4DXJA 4KPJA 4NG6A 5DJPF 5CG5A 4NUAA 5IL3A 4H5CF 3KBKA 4L2XF 5EROA 2E95A 2E8VA 3ICNA 4LFEA 3KROA 2EWGA 3W7FA 1UBYA 2J1OA 2AZKA 3OABA 5DJRF 3Q1OA 4LLTA 5AHUB 3N46F 5KSXF 2OPNA 2Z52A 1UBXA 3G4DA 3N3LF 4LZ0A 1V4JA 3LGZB 4LZCA 3WCEA 4LA6A 1WL3A 4GP1A 1RQIA 3WCJA 5E8LA 5EATA 4OGUA 5DJVF 3UCAA 5ILKA 4KVIA 5HN9A 1HX9A 3VJ8A 2ZCRA 1JFGA 3P5PA 2ZY1A 2J5CA 3B7LA 3RYEA 5A0JA 3LZ9A 2FORA 1YJ4A 3VJBA 3WCHA 2I19A 3DYGA 3KRFA 3QQVA 3WJNA 5DGNF 1VG4A 4MC8A 5B0KA 3ACWA 3WJOA 3M0GA 4LTVA 3DYHA 3WEKA 4LFGA 1KIYA 3WEFA 4P0VA 3NPRA 3N5HF 3WSBA 1WY0A 3N45F 4NFIF 2F8CF 3IPIA 3KRPB 3SDQA 5IKHA 4F6VA 4KVYA 3P5RA 4P0XA 3KRAB 1YYQA 4KQUA 3AQBB 2DH4A 4JZBA 3MZVA 3V1VA 3LEEA 3OYRA 3G4FA 2OGDA 3TFVA 1N1ZA 1YV5A 2Q9ZA 4E9ZA 4NFKF 5JV1F 4JXYA 2Z4WA 3LGKA 3WE9A 5B0IA 1RTRA 3WEIA 4NFJF 5IVGA 2O1OA 1V4HA 4EA1A 1N22A 3QKCA 3SDRA 1YQ7A 4DI5A 4RYPA 3WCMA 5C05A 3KRCA
chains in the Genus database with same CATH superfamily
2E8WA 1YHLA 3S4JA 3ACXA 4H5EF 2E94A 3PDEA 5JA0F 5H9DA 1YHKA 2F8ZF 3LG5A 4F6XA 5B00A 1V4IA 5AYPA 3ADZA 2ZEUA 2F7MF 1HM7A 2OA6A 4MC3A 3SDTA 2H8OA 1WL1A 5ILJA 3N3DA 4RXAA 3ACYA 5DIQF 2E92A 4LXWA 3LOMA 3N5JF 5E8KA 4LPHF 3WEGA 3WCFA 3ZMCA 1WL2A 2ZCOA 3KB9A 3WCAA 5DHIA 4DWGA 3PKOA 5ERNA 3WEJA 3CKEA 1ZW5A 2Z7IA 4FJQA 5IMNA 5DGMF 4E1EA 4RXEA 3LSNA 4N1ZF 4EA0A 4DWBA 1YHMA 1UBVA 1HXAA 5IMPA 3WCDA 3ZCDA 1YYUA 3ID0A 1YYTA 4DHDA 3ICZA 3BNXA 4KUXA 3P8LA 2AZLA 4KQSA 2PS8A 3WCBA 5I1UA 4DZWA 5A0KA 4XQTF 4ZQ8A 3P8RA 1WMWA 3TFPA 4N9UA 4RXCA 3WC9A 4OKMA 4MC0A 3N1VF 4JZXA 2Z50A 3WCCA 5B03A 1HXCA 2ONHA 5JV0F 3V1XA 5CG6A 1WKZA 3RMGA 4JXNA 3WCIA 4HD1A 4LA5A 2E93A 3ICMA 3SAEA 3LMDA 1N24A 3AQCB 4QPFA 3VJDA 3MAVA 4KPDA 5B0JA 5IKAA 3VJCA 2PS7A 3ASXA 3EZ3A 3ICKA 1VG3A 3PH7A 2Q58A 2Z78A 4PVYF 5ILIA 3OACB 4H5DF 4KVDA 2Z4VA 4EA2A 3PYBA 3ZMBA 3N49F 3KRPA 3Q30A 4OKZA 5AFXA 3KROB 3SDUA 3WJKA 3M9UA 3KRAA 4KWDA 3OABB 1N21A 4LIXA 4WK5A 4LUUA 3LLWA 3LVSA 1V4EA 2E8UA 2Z4XA 5ILYA 2E90A 2F89F 2Z4YA 3N6KF 2VF6A 5DGSF 4GA3A 3BNYA 2Z4ZA 4F62A 2F9KF 2AZJA 3WSAA 4GP2A 5DW7A 3LDWA 3RYWA 3DYFA 3NPKA 2FTZA 5ILZA 5IMIA 2E4OA 2F94F 3IBAA 2PS5A 4JVJF 4LTZA 1VG6A 3WEHA 2Z7HA 2RAHA 4NKEA 5IM1A 3Q2ZA 3M01A 1V4KA 3ZL6A 4FP4A 5JUZF 3KRFB 1UBWA 4OMHA 3SDVA 5IL8A 1VG7A 3TS7A 3AE0A 4GAXA 4LOBA 4JYXA 2QISA 5ER8A 4RXDA 4QXSF 2AEKA 3EGTA 1RQJA 1PS1A 4XQSF 1DGPA 3VJEA 1HM4A 5IK9A 3APZA 1HXGA 5A0IA 4LFVF 4LPGF 4KKMA 5ILDA 4Q23A 2Q80A 1N1BA 5DZ2A 3V66A 4XQRF 4NKFA 5ILHA 5HNAA 3N1WF 5B0LA 2E91A 2OPMA 4E9UA 3VJ9A 3WCGA 3EFQA 5IN8A 3CC9A 1YYSA 1DI1A 3LJIA 2ZEVA 5IK6A 4K10A 3VJAA 2AELA 1JFAA 1N23A 5B01A 4OMGA 4PVXF 3TFNA 3ZOUA 2E8TA 1KIZA 4KQ5A 3PYAA 5IK0A 4P0WA 4LLSA 4KK2A 5EAUA 1VG2A 3Q2QA 4KVWA 3KRCB 5DHKA 2PS4A 5JV2F 2PS6A 5AELA 2E8XA 2J1PA 5B02A 4UMJA 3S9VA 4RNQA 2F92F 4LZ3A 3NF2A 3AQ0A 5B0MA 5E8HA 4DEMF 2ZCQA 3LK5A 5EASA 5ERMA 2P1CA 3NRIA 3M00A 2Q9YA 2AETA 3WCLA 2ZCSA 1YYRA 1WL0A 1EZFA 3M02A 4KFAA 3P41A 3RBMA 3N0FA 1FPSA 5HN8A 5HN7A 3N0GA 3TC1A 1N20A 3CP6A 2ONGA 3OACA 4DXJA 4KPJA 4NG6A 5DJPF 5CG5A 4NUAA 5IL3A 4H5CF 3KBKA 4L2XF 5EROA 2E95A 2E8VA 3ICNA 4LFEA 3KROA 2EWGA 3W7FA 1UBYA 2J1OA 2AZKA 3OABA 5DJRF 3Q1OA 4LLTA 5AHUB 3N46F 5KSXF 2OPNA 2Z52A 1UBXA 3G4DA 3N3LF 4LZ0A 1V4JA 3LGZB 4LZCA 3WCEA 4LA6A 1WL3A 4GP1A 1RQIA 3WCJA 5E8LA 5EATA 4OGUA 5DJVF 3UCAA 5ILKA 4KVIA 5HN9A 1HX9A 3VJ8A 2ZCRA 1JFGA 3P5PA 2ZY1A 2J5CA 3B7LA 3RYEA 5A0JA 3LZ9A 2FORA 1YJ4A 3VJBA 3WCHA 2I19A 3DYGA 3KRFA 3QQVA 3WJNA 5DGNF 1VG4A 4MC8A 5B0KA 3ACWA 3WJOA 3M0GA 4LTVA 3DYHA 3WEKA 4LFGA 1KIYA 3WEFA 4P0VA 3NPRA 3N5HF 3WSBA 1WY0A 3N45F 4NFIF 2F8CF 3IPIA 3KRPB 3SDQA 5IKHA 4F6VA 4KVYA 3P5RA 4P0XA 3KRAB 1YYQA 4KQUA 3AQBB 2DH4A 4JZBA 3MZVA 3V1VA 3LEEA 3OYRA 3G4FA 2OGDA 3TFVA 1N1ZA 1YV5A 2Q9ZA 4E9ZA 4NFKF 5JV1F 4JXYA 2Z4WA 3LGKA 3WE9A 5B0IA 1RTRA 3WEIA 4NFJF 5IVGA 2O1OA 1V4HA 4EA1A 1N22A 3QKCA 3SDRA 1YQ7A 4DI5A 4RYPA 3WCMA 5C05A 3KRCA
chains in the Genus database with same CATH topology
2E8WA 1YHLA 3S4JA 3ACXA 4H5EF 2E94A 3PDEA 5JA0F 5H9DA 1YHKA 2F8ZF 3LG5A 4F6XA 5B00A 1V4IA 5AYPA 3ADZA 2ZEUA 2F7MF 1HM7A 2OA6A 4MC3A 3SDTA 2H8OA 1WL1A 5ILJA 3N3DA 4RXAA 3ACYA 5DIQF 2E92A 4LXWA 3LOMA 3N5JF 5E8KA 4LPHF 3WEGA 3WCFA 3ZMCA 1WL2A 2ZCOA 3KB9A 3WCAA 5DHIA 4DWGA 3PKOA 5ERNA 3WEJA 3CKEA 1ZW5A 2Z7IA 4FJQA 5IMNA 5DGMF 4E1EA 4RXEA 3LSNA 4N1ZF 4EA0A 4DWBA 1YHMA 1UBVA 1HXAA 5IMPA 3WCDA 3ZCDA 1YYUA 3ID0A 1YYTA 4DHDA 3ICZA 3BNXA 4KUXA 3P8LA 2AZLA 4KQSA 2PS8A 3WCBA 5I1UA 4DZWA 5A0KA 4XQTF 4ZQ8A 3P8RA 1WMWA 3TFPA 4N9UA 4RXCA 3WC9A 4OKMA 4MC0A 3N1VF 4JZXA 2Z50A 3WCCA 5B03A 1HXCA 2ONHA 5JV0F 3V1XA 5CG6A 1WKZA 3RMGA 4JXNA 3WCIA 4HD1A 4LA5A 2E93A 3ICMA 3SAEA 3LMDA 1N24A 3AQCB 4QPFA 3VJDA 3MAVA 4KPDA 5B0JA 5IKAA 3VJCA 2PS7A 3ASXA 3EZ3A 3ICKA 1VG3A 3PH7A 2Q58A 2Z78A 4PVYF 5ILIA 3OACB 4H5DF 4KVDA 2Z4VA 4EA2A 3PYBA 3ZMBA 3N49F 3KRPA 3Q30A 4OKZA 5AFXA 3KROB 3SDUA 3WJKA 3M9UA 3KRAA 4KWDA 3OABB 1N21A 4LIXA 4WK5A 4LUUA 3LLWA 3LVSA 1V4EA 2E8UA 2Z4XA 5ILYA 2E90A 2F89F 2Z4YA 3N6KF 2VF6A 5DGSF 4GA3A 3BNYA 2Z4ZA 4F62A 2F9KF 2AZJA 3WSAA 4GP2A 5DW7A 3LDWA 3RYWA 3DYFA 3NPKA 2FTZA 5ILZA 5IMIA 2E4OA 2F94F 3IBAA 2PS5A 4JVJF 4LTZA 1VG6A 3WEHA 2Z7HA 2RAHA 4NKEA 5IM1A 3Q2ZA 3M01A 1V4KA 3ZL6A 4FP4A 5JUZF 3KRFB 1UBWA 4OMHA 3SDVA 5IL8A 1VG7A 3TS7A 3AE0A 4GAXA 4LOBA 4JYXA 2QISA 5ER8A 4RXDA 4QXSF 2AEKA 3EGTA 1RQJA 1PS1A 4XQSF 1DGPA 3VJEA 1HM4A 5IK9A 3APZA 1HXGA 5A0IA 4LFVF 4LPGF 4KKMA 5ILDA 4Q23A 2Q80A 1N1BA 5DZ2A 3V66A 4XQRF 4NKFA 5ILHA 5HNAA 3N1WF 5B0LA 2E91A 2OPMA 4E9UA 3VJ9A 3WCGA 3EFQA 5IN8A 3CC9A 1YYSA 1DI1A 3LJIA 2ZEVA 5IK6A 4K10A 3VJAA 2AELA 1JFAA 1N23A 5B01A 4OMGA 4PVXF 3TFNA 3ZOUA 2E8TA 1KIZA 4KQ5A 3PYAA 5IK0A 4P0WA 4LLSA 4KK2A 5EAUA 1VG2A 3Q2QA 4KVWA 3KRCB 5DHKA 2PS4A 5JV2F 2PS6A 5AELA 2E8XA 2J1PA 5B02A 4UMJA 3S9VA 4RNQA 2F92F 4LZ3A 3NF2A 3AQ0A 5B0MA 5E8HA 4DEMF 2ZCQA 3LK5A 5EASA 5ERMA 2P1CA 3NRIA 3M00A 2Q9YA 2AETA 3WCLA 2ZCSA 1YYRA 1WL0A 1EZFA 3M02A 4KFAA 3P41A 3RBMA 3N0FA 1FPSA 5HN8A 5HN7A 3N0GA 3TC1A 1N20A 3CP6A 2ONGA 3OACA 4DXJA 4KPJA 4NG6A 5DJPF 5CG5A 4NUAA 5IL3A 4H5CF 3KBKA 4L2XF 5EROA 2E95A 2E8VA 3ICNA 4LFEA 3KROA 2EWGA 3W7FA 1UBYA 2J1OA 2AZKA 3OABA 5DJRF 3Q1OA 4LLTA 5AHUB 3N46F 5KSXF 2OPNA 2Z52A 1UBXA 3G4DA 3N3LF 4LZ0A 1V4JA 3LGZB 4LZCA 3WCEA 4LA6A 1WL3A 4GP1A 1RQIA 3WCJA 5E8LA 5EATA 4OGUA 5DJVF 3UCAA 5ILKA 4KVIA 5HN9A 1HX9A 3VJ8A 2ZCRA 1JFGA 3P5PA 2ZY1A 2J5CA 3B7LA 3RYEA 5A0JA 3LZ9A 2FORA 1YJ4A 3VJBA 3WCHA 2I19A 3DYGA 3KRFA 3QQVA 3WJNA 5DGNF 1VG4A 4MC8A 5B0KA 3ACWA 3WJOA 3M0GA 4LTVA 3DYHA 3WEKA 4LFGA 1KIYA 3WEFA 4P0VA 3NPRA 3N5HF 3WSBA 1WY0A 3N45F 4NFIF 2F8CF 3IPIA 3KRPB 3SDQA 5IKHA 4F6VA 4KVYA 3P5RA 4P0XA 3KRAB 1YYQA 4KQUA 3AQBB 2DH4A 4JZBA 3MZVA 3V1VA 3LEEA 3OYRA 3G4FA 2OGDA 3TFVA 1N1ZA 1YV5A 2Q9ZA 4E9ZA 4NFKF 5JV1F 4JXYA 2Z4WA 3LGKA 3WE9A 5B0IA 1RTRA 3WEIA 4NFJF 5IVGA 2O1OA 1V4HA 4EA1A 1N22A 3QKCA 3SDRA 1YQ7A 4DI5A 4RYPA 3WCMA 5C05A 3KRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8W A;  1YHL A;  3S4J A;  3ACX A;  4H5E F;  2E94 A;  3PDE A;  5JA0 F;  5H9D A;  1YHK A;  2F8Z F;  3LG5 A;  4F6X A;  5B00 A;  1V4I A;  5AYP A;  3ADZ A;  2ZEU A;  2F7M F;  1HM7 A;  2OA6 A;  4MC3 A;  3SDT A;  2H8O A;  1WL1 A;  5ILJ A;  3N3D A;  4RXA A;  3ACY A;  5DIQ F;  2E92 A;  4LXW A;  3LOM A;  3N5J F;  5E8K A;  4LPH F;  3WEG A;  3WCF A;  3ZMC A;  1WL2 A;  2ZCO A;  3KB9 A;  3WCA A;  5DHI A;  4DWG A;  3PKO A;  5ERN A;  3WEJ A;  3CKE A;  1ZW5 A;  2Z7I A;  4FJQ A;  5IMN A;  5DGM F;  4E1E A;  4RXE A;  3LSN A;  4N1Z F;  4EA0 A;  4DWB A;  1YHM A;  1UBV A;  1HXA A;  5IMP A;  3WCD A;  3ZCD A;  1YYU A;  3ID0 A;  1YYT A;  4DHD A;  3ICZ A;  3BNX A;  4KUX A;  3P8L A;  2AZL A;  4KQS A;  2PS8 A;  3WCB A;  5I1U A;  4DZW A;  5A0K A;  4XQT F;  4ZQ8 A;  3P8R A;  1WMW A;  3TFP A;  4N9U A;  4RXC A;  3WC9 A;  4OKM A;  4MC0 A;  3N1V F;  4JZX A;  2Z50 A;  3WCC A;  5B03 A;  1HXC A;  2ONH A;  5JV0 F;  3V1X A;  5CG6 A;  1WKZ A;  3RMG A;  4JXN A;  3WCI A;  4HD1 A;  4LA5 A;  2E93 A;  3ICM A;  3SAE A;  3LMD A;  1N24 A;  3AQC B;  4QPF A;  3VJD A;  3MAV A;  4KPD A;  5B0J A;  5IKA A;  3VJC A;  2PS7 A;  3ASX A;  3EZ3 A;  3ICK A;  1VG3 A;  3PH7 A;  2Q58 A;  2Z78 A;  4PVY F;  5ILI A;  3OAC B;  4H5D F;  4KVD A;  2Z4V A;  4EA2 A;  3PYB A;  3ZMB A;  3N49 F;  3KRP A;  3Q30 A;  4OKZ A;  5AFX A;  3KRO B;  3SDU A;  3WJK A;  3M9U A;  3KRA A;  4KWD A;  3OAB B;  1N21 A;  4LIX A;  4WK5 A;  4LUU A;  3LLW A;  3LVS A;  1V4E A;  2E8U A;  2Z4X A;  5ILY A;  2E90 A;  2F89 F;  2Z4Y A;  3N6K F;  2VF6 A;  5DGS F;  4GA3 A;  3BNY A;  2Z4Z A;  4F62 A;  2F9K F;  2AZJ A;  3WSA A;  4GP2 A;  5DW7 A;  3LDW A;  3RYW A;  3DYF A;  3NPK A;  2FTZ A;  5ILZ A;  5IMI A;  2E4O A;  2F94 F;  3IBA A;  2PS5 A;  4JVJ F;  4LTZ A;  1VG6 A;  3WEH A;  2Z7H A;  2RAH A;  4NKE A;  5IM1 A;  3Q2Z A;  3M01 A;  1V4K A;  3ZL6 A;  4FP4 A;  5JUZ F;  3KRF B;  1UBW A;  4OMH A;  3SDV A;  5IL8 A;  1VG7 A;  3TS7 A;  3AE0 A;  4GAX A;  4LOB A;  4JYX A;  2QIS A;  5ER8 A;  4RXD A;  4QXS F;  2AEK A;  3EGT A;  1RQJ A;  1PS1 A;  4XQS F;  1DGP A;  3VJE A;  1HM4 A;  5IK9 A;  3APZ A;  1HXG A;  5A0I A;  4LFV F;  4LPG F;  4KKM A;  5ILD A;  4Q23 A;  2Q80 A;  1N1B A;  5DZ2 A;  3V66 A;  4XQR F;  4NKF A;  5ILH A;  5HNA A;  3N1W F;  5B0L A;  2E91 A;  2OPM A;  4E9U A;  3VJ9 A;  3WCG A;  3EFQ A;  5IN8 A;  3CC9 A;  1YYS A;  1DI1 A;  3LJI A;  2ZEV A;  5IK6 A;  4K10 A;  3VJA A;  2AEL A;  1JFA A;  1N23 A;  5B01 A;  4OMG A;  4PVX F;  3TFN A;  3ZOU A;  2E8T A;  1KIZ A;  4KQ5 A;  3PYA A;  5IK0 A;  4P0W A;  4LLS A;  4KK2 A;  5EAU A;  1VG2 A;  3Q2Q A;  4KVW A;  3KRC B;  5DHK A;  2PS4 A;  5JV2 F;  2PS6 A;  5AEL A;  2E8X A;  2J1P A;  5B02 A;  4UMJ A;  3S9V A;  4RNQ A;  2F92 F;  4LZ3 A;  3NF2 A;  3AQ0 A;  5B0M A;  5E8H A;  4DEM F;  2ZCQ A;  3LK5 A;  5EAS A;  5ERM A;  2P1C A;  3NRI A;  3M00 A;  2Q9Y A;  2AET A;  3WCL A;  2ZCS A;  1YYR A;  1WL0 A;  1EZF A;  3M02 A;  4KFA A;  3P41 A;  3RBM A;  3N0F A;  1FPS A;  5HN8 A;  5HN7 A;  3N0G A;  3TC1 A;  1N20 A;  3CP6 A;  2ONG A;  3OAC A;  4DXJ A;  4KPJ A;  4NG6 A;  5DJP F;  5CG5 A;  4NUA A;  5IL3 A;  4H5C F;  3KBK A;  4L2X F;  5ERO A;  2E95 A;  2E8V A;  3ICN A;  4LFE A;  3KRO A;  2EWG A;  3W7F A;  1UBY A;  2J1O A;  2AZK A;  3OAB A;  5DJR F;  3Q1O A;  4LLT A;  5AHU B;  3N46 F;  5KSX F;  2OPN A;  2Z52 A;  1UBX A;  3G4D A;  3N3L F;  4LZ0 A;  1V4J A;  3LGZ B;  4LZC A;  3WCE A;  4LA6 A;  1WL3 A;  4GP1 A;  1RQI A;  3WCJ A;  5E8L A;  5EAT A;  4OGU A;  5DJV F;  3UCA A;  5ILK A;  4KVI A;  5HN9 A;  1HX9 A;  3VJ8 A;  2ZCR A;  1JFG A;  3P5P A;  2ZY1 A;  2J5C A;  3B7L A;  3RYE A;  5A0J A;  3LZ9 A;  2FOR A;  1YJ4 A;  3VJB A;  3WCH A;  2I19 A;  3DYG A;  3KRF A;  3QQV A;  3WJN A;  5DGN F;  1VG4 A;  4MC8 A;  5B0K A;  3ACW A;  3WJO A;  3M0G A;  4LTV A;  3DYH A;  3WEK A;  4LFG A;  1KIY A;  3WEF A;  4P0V A;  3NPR A;  3N5H F;  3WSB A;  1WY0 A;  3N45 F;  4NFI F;  2F8C F;  3IPI A;  3KRP B;  3SDQ A;  5IKH A;  4F6V A;  4KVY A;  3P5R A;  4P0X A;  3KRA B;  1YYQ A;  4KQU A;  3AQB B;  2DH4 A;  4JZB A;  3MZV A;  3V1V A;  3LEE A;  3OYR A;  3G4F A;  2OGD A;  3TFV A;  1N1Z A;  1YV5 A;  2Q9Z A;  4E9Z A;  4NFK F;  5JV1 F;  4JXY A;  2Z4W A;  3LGK A;  3WE9 A;  5B0I A;  1RTR A;  3WEI A;  4NFJ F;  5IVG A;  2O1O A;  1V4H A;  4EA1 A;  1N22 A;  3QKC A;  3SDR A;  1YQ7 A;  4DI5 A;  4RYP A;  3WCM A;  5C05 A;  3KRC A; 
#chains in the Genus database with same CATH topology
 2E8W A;  1YHL A;  3S4J A;  3ACX A;  4H5E F;  2E94 A;  3PDE A;  5JA0 F;  5H9D A;  1YHK A;  2F8Z F;  3LG5 A;  4F6X A;  5B00 A;  1V4I A;  5AYP A;  3ADZ A;  2ZEU A;  2F7M F;  1HM7 A;  2OA6 A;  4MC3 A;  3SDT A;  2H8O A;  1WL1 A;  5ILJ A;  3N3D A;  4RXA A;  3ACY A;  5DIQ F;  2E92 A;  4LXW A;  3LOM A;  3N5J F;  5E8K A;  4LPH F;  3WEG A;  3WCF A;  3ZMC A;  1WL2 A;  2ZCO A;  3KB9 A;  3WCA A;  5DHI A;  4DWG A;  3PKO A;  5ERN A;  3WEJ A;  3CKE A;  1ZW5 A;  2Z7I A;  4FJQ A;  5IMN A;  5DGM F;  4E1E A;  4RXE A;  3LSN A;  4N1Z F;  4EA0 A;  4DWB A;  1YHM A;  1UBV A;  1HXA A;  5IMP A;  3WCD A;  3ZCD A;  1YYU A;  3ID0 A;  1YYT A;  4DHD A;  3ICZ A;  3BNX A;  4KUX A;  3P8L A;  2AZL A;  4KQS A;  2PS8 A;  3WCB A;  5I1U A;  4DZW A;  5A0K A;  4XQT F;  4ZQ8 A;  3P8R A;  1WMW A;  3TFP A;  4N9U A;  4RXC A;  3WC9 A;  4OKM A;  4MC0 A;  3N1V F;  4JZX A;  2Z50 A;  3WCC A;  5B03 A;  1HXC A;  2ONH A;  5JV0 F;  3V1X A;  5CG6 A;  1WKZ A;  3RMG A;  4JXN A;  3WCI A;  4HD1 A;  4LA5 A;  2E93 A;  3ICM A;  3SAE A;  3LMD A;  1N24 A;  3AQC B;  4QPF A;  3VJD A;  3MAV A;  4KPD A;  5B0J A;  5IKA A;  3VJC A;  2PS7 A;  3ASX A;  3EZ3 A;  3ICK A;  1VG3 A;  3PH7 A;  2Q58 A;  2Z78 A;  4PVY F;  5ILI A;  3OAC B;  4H5D F;  4KVD A;  2Z4V A;  4EA2 A;  3PYB A;  3ZMB A;  3N49 F;  3KRP A;  3Q30 A;  4OKZ A;  5AFX A;  3KRO B;  3SDU A;  3WJK A;  3M9U A;  3KRA A;  4KWD A;  3OAB B;  1N21 A;  4LIX A;  4WK5 A;  4LUU A;  3LLW A;  3LVS A;  1V4E A;  2E8U A;  2Z4X A;  5ILY A;  2E90 A;  2F89 F;  2Z4Y A;  3N6K F;  2VF6 A;  5DGS F;  4GA3 A;  3BNY A;  2Z4Z A;  4F62 A;  2F9K F;  2AZJ A;  3WSA A;  4GP2 A;  5DW7 A;  3LDW A;  3RYW A;  3DYF A;  3NPK A;  2FTZ A;  5ILZ A;  5IMI A;  2E4O A;  2F94 F;  3IBA A;  2PS5 A;  4JVJ F;  4LTZ A;  1VG6 A;  3WEH A;  2Z7H A;  2RAH A;  4NKE A;  5IM1 A;  3Q2Z A;  3M01 A;  1V4K A;  3ZL6 A;  4FP4 A;  5JUZ F;  3KRF B;  1UBW A;  4OMH A;  3SDV A;  5IL8 A;  1VG7 A;  3TS7 A;  3AE0 A;  4GAX A;  4LOB A;  4JYX A;  2QIS A;  5ER8 A;  4RXD A;  4QXS F;  2AEK A;  3EGT A;  1RQJ A;  1PS1 A;  4XQS F;  1DGP A;  3VJE A;  1HM4 A;  5IK9 A;  3APZ A;  1HXG A;  5A0I A;  4LFV F;  4LPG F;  4KKM A;  5ILD A;  4Q23 A;  2Q80 A;  1N1B A;  5DZ2 A;  3V66 A;  4XQR F;  4NKF A;  5ILH A;  5HNA A;  3N1W F;  5B0L A;  2E91 A;  2OPM A;  4E9U A;  3VJ9 A;  3WCG A;  3EFQ A;  5IN8 A;  3CC9 A;  1YYS A;  1DI1 A;  3LJI A;  2ZEV A;  5IK6 A;  4K10 A;  3VJA A;  2AEL A;  1JFA A;  1N23 A;  5B01 A;  4OMG A;  4PVX F;  3TFN A;  3ZOU A;  2E8T A;  1KIZ A;  4KQ5 A;  3PYA A;  5IK0 A;  4P0W A;  4LLS A;  4KK2 A;  5EAU A;  1VG2 A;  3Q2Q A;  4KVW A;  3KRC B;  5DHK A;  2PS4 A;  5JV2 F;  2PS6 A;  5AEL A;  2E8X A;  2J1P A;  5B02 A;  4UMJ A;  3S9V A;  4RNQ A;  2F92 F;  4LZ3 A;  3NF2 A;  3AQ0 A;  5B0M A;  5E8H A;  4DEM F;  2ZCQ A;  3LK5 A;  5EAS A;  5ERM A;  2P1C A;  3NRI A;  3M00 A;  2Q9Y A;  2AET A;  3WCL A;  2ZCS A;  1YYR A;  1WL0 A;  1EZF A;  3M02 A;  4KFA A;  3P41 A;  3RBM A;  3N0F A;  1FPS A;  5HN8 A;  5HN7 A;  3N0G A;  3TC1 A;  1N20 A;  3CP6 A;  2ONG A;  3OAC A;  4DXJ A;  4KPJ A;  4NG6 A;  5DJP F;  5CG5 A;  4NUA A;  5IL3 A;  4H5C F;  3KBK A;  4L2X F;  5ERO A;  2E95 A;  2E8V A;  3ICN A;  4LFE A;  3KRO A;  2EWG A;  3W7F A;  1UBY A;  2J1O A;  2AZK A;  3OAB A;  5DJR F;  3Q1O A;  4LLT A;  5AHU B;  3N46 F;  5KSX F;  2OPN A;  2Z52 A;  1UBX A;  3G4D A;  3N3L F;  4LZ0 A;  1V4J A;  3LGZ B;  4LZC A;  3WCE A;  4LA6 A;  1WL3 A;  4GP1 A;  1RQI A;  3WCJ A;  5E8L A;  5EAT A;  4OGU A;  5DJV F;  3UCA A;  5ILK A;  4KVI A;  5HN9 A;  1HX9 A;  3VJ8 A;  2ZCR A;  1JFG A;  3P5P A;  2ZY1 A;  2J5C A;  3B7L A;  3RYE A;  5A0J A;  3LZ9 A;  2FOR A;  1YJ4 A;  3VJB A;  3WCH A;  2I19 A;  3DYG A;  3KRF A;  3QQV A;  3WJN A;  5DGN F;  1VG4 A;  4MC8 A;  5B0K A;  3ACW A;  3WJO A;  3M0G A;  4LTV A;  3DYH A;  3WEK A;  4LFG A;  1KIY A;  3WEF A;  4P0V A;  3NPR A;  3N5H F;  3WSB A;  1WY0 A;  3N45 F;  4NFI F;  2F8C F;  3IPI A;  3KRP B;  3SDQ A;  5IKH A;  4F6V A;  4KVY A;  3P5R A;  4P0X A;  3KRA B;  1YYQ A;  4KQU A;  3AQB B;  2DH4 A;  4JZB A;  3MZV A;  3V1V A;  3LEE A;  3OYR A;  3G4F A;  2OGD A;  3TFV A;  1N1Z A;  1YV5 A;  2Q9Z A;  4E9Z A;  4NFK F;  5JV1 F;  4JXY A;  2Z4W A;  3LGK A;  3WE9 A;  5B0I A;  1RTR A;  3WEI A;  4NFJ F;  5IVG A;  2O1O A;  1V4H A;  4EA1 A;  1N22 A;  3QKC A;  3SDR A;  1YQ7 A;  4DI5 A;  4RYP A;  3WCM A;  5C05 A;  3KRC A; 
#chains in the Genus database with same CATH homology
 2E8W A;  1YHL A;  3S4J A;  3ACX A;  4H5E F;  2E94 A;  3PDE A;  5JA0 F;  5H9D A;  1YHK A;  2F8Z F;  3LG5 A;  4F6X A;  5B00 A;  1V4I A;  5AYP A;  3ADZ A;  2ZEU A;  2F7M F;  1HM7 A;  2OA6 A;  4MC3 A;  3SDT A;  2H8O A;  1WL1 A;  5ILJ A;  3N3D A;  4RXA A;  3ACY A;  5DIQ F;  2E92 A;  4LXW A;  3LOM A;  3N5J F;  5E8K A;  4LPH F;  3WEG A;  3WCF A;  3ZMC A;  1WL2 A;  2ZCO A;  3KB9 A;  3WCA A;  5DHI A;  4DWG A;  3PKO A;  5ERN A;  3WEJ A;  3CKE A;  1ZW5 A;  2Z7I A;  4FJQ A;  5IMN A;  5DGM F;  4E1E A;  4RXE A;  3LSN A;  4N1Z F;  4EA0 A;  4DWB A;  1YHM A;  1UBV A;  1HXA A;  5IMP A;  3WCD A;  3ZCD A;  1YYU A;  3ID0 A;  1YYT A;  4DHD A;  3ICZ A;  3BNX A;  4KUX A;  3P8L A;  2AZL A;  4KQS A;  2PS8 A;  3WCB A;  5I1U A;  4DZW A;  5A0K A;  4XQT F;  4ZQ8 A;  3P8R A;  1WMW A;  3TFP A;  4N9U A;  4RXC A;  3WC9 A;  4OKM A;  4MC0 A;  3N1V F;  4JZX A;  2Z50 A;  3WCC A;  5B03 A;  1HXC A;  2ONH A;  5JV0 F;  3V1X A;  5CG6 A;  1WKZ A;  3RMG A;  4JXN A;  3WCI A;  4HD1 A;  4LA5 A;  2E93 A;  3ICM A;  3SAE A;  3LMD A;  1N24 A;  3AQC B;  4QPF A;  3VJD A;  3MAV A;  4KPD A;  5B0J A;  5IKA A;  3VJC A;  2PS7 A;  3ASX A;  3EZ3 A;  3ICK A;  1VG3 A;  3PH7 A;  2Q58 A;  2Z78 A;  4PVY F;  5ILI A;  3OAC B;  4H5D F;  4KVD A;  2Z4V A;  4EA2 A;  3PYB A;  3ZMB A;  3N49 F;  3KRP A;  3Q30 A;  4OKZ A;  5AFX A;  3KRO B;  3SDU A;  3WJK A;  3M9U A;  3KRA A;  4KWD A;  3OAB B;  1N21 A;  4LIX A;  4WK5 A;  4LUU A;  3LLW A;  3LVS A;  1V4E A;  2E8U A;  2Z4X A;  5ILY A;  2E90 A;  2F89 F;  2Z4Y A;  3N6K F;  2VF6 A;  5DGS F;  4GA3 A;  3BNY A;  2Z4Z A;  4F62 A;  2F9K F;  2AZJ A;  3WSA A;  4GP2 A;  5DW7 A;  3LDW A;  3RYW A;  3DYF A;  3NPK A;  2FTZ A;  5ILZ A;  5IMI A;  2E4O A;  2F94 F;  3IBA A;  2PS5 A;  4JVJ F;  4LTZ A;  1VG6 A;  3WEH A;  2Z7H A;  2RAH A;  4NKE A;  5IM1 A;  3Q2Z A;  3M01 A;  1V4K A;  3ZL6 A;  4FP4 A;  5JUZ F;  3KRF B;  1UBW A;  4OMH A;  3SDV A;  5IL8 A;  1VG7 A;  3TS7 A;  3AE0 A;  4GAX A;  4LOB A;  4JYX A;  2QIS A;  5ER8 A;  4RXD A;  4QXS F;  2AEK A;  3EGT A;  1RQJ A;  1PS1 A;  4XQS F;  1DGP A;  3VJE A;  1HM4 A;  5IK9 A;  3APZ A;  1HXG A;  5A0I A;  4LFV F;  4LPG F;  4KKM A;  5ILD A;  4Q23 A;  2Q80 A;  1N1B A;  5DZ2 A;  3V66 A;  4XQR F;  4NKF A;  5ILH A;  5HNA A;  3N1W F;  5B0L A;  2E91 A;  2OPM A;  4E9U A;  3VJ9 A;  3WCG A;  3EFQ A;  5IN8 A;  3CC9 A;  1YYS A;  1DI1 A;  3LJI A;  2ZEV A;  5IK6 A;  4K10 A;  3VJA A;  2AEL A;  1JFA A;  1N23 A;  5B01 A;  4OMG A;  4PVX F;  3TFN A;  3ZOU A;  2E8T A;  1KIZ A;  4KQ5 A;  3PYA A;  5IK0 A;  4P0W A;  4LLS A;  4KK2 A;  5EAU A;  1VG2 A;  3Q2Q A;  4KVW A;  3KRC B;  5DHK A;  2PS4 A;  5JV2 F;  2PS6 A;  5AEL A;  2E8X A;  2J1P A;  5B02 A;  4UMJ A;  3S9V A;  4RNQ A;  2F92 F;  4LZ3 A;  3NF2 A;  3AQ0 A;  5B0M A;  5E8H A;  4DEM F;  2ZCQ A;  3LK5 A;  5EAS A;  5ERM A;  2P1C A;  3NRI A;  3M00 A;  2Q9Y A;  2AET A;  3WCL A;  2ZCS A;  1YYR A;  1WL0 A;  1EZF A;  3M02 A;  4KFA A;  3P41 A;  3RBM A;  3N0F A;  1FPS A;  5HN8 A;  5HN7 A;  3N0G A;  3TC1 A;  1N20 A;  3CP6 A;  2ONG A;  3OAC A;  4DXJ A;  4KPJ A;  4NG6 A;  5DJP F;  5CG5 A;  4NUA A;  5IL3 A;  4H5C F;  3KBK A;  4L2X F;  5ERO A;  2E95 A;  2E8V A;  3ICN A;  4LFE A;  3KRO A;  2EWG A;  3W7F A;  1UBY A;  2J1O A;  2AZK A;  3OAB A;  5DJR F;  3Q1O A;  4LLT A;  5AHU B;  3N46 F;  5KSX F;  2OPN A;  2Z52 A;  1UBX A;  3G4D A;  3N3L F;  4LZ0 A;  1V4J A;  3LGZ B;  4LZC A;  3WCE A;  4LA6 A;  1WL3 A;  4GP1 A;  1RQI A;  3WCJ A;  5E8L A;  5EAT A;  4OGU A;  5DJV F;  3UCA A;  5ILK A;  4KVI A;  5HN9 A;  1HX9 A;  3VJ8 A;  2ZCR A;  1JFG A;  3P5P A;  2ZY1 A;  2J5C A;  3B7L A;  3RYE A;  5A0J A;  3LZ9 A;  2FOR A;  1YJ4 A;  3VJB A;  3WCH A;  2I19 A;  3DYG A;  3KRF A;  3QQV A;  3WJN A;  5DGN F;  1VG4 A;  4MC8 A;  5B0K A;  3ACW A;  3WJO A;  3M0G A;  4LTV A;  3DYH A;  3WEK A;  4LFG A;  1KIY A;  3WEF A;  4P0V A;  3NPR A;  3N5H F;  3WSB A;  1WY0 A;  3N45 F;  4NFI F;  2F8C F;  3IPI A;  3KRP B;  3SDQ A;  5IKH A;  4F6V A;  4KVY A;  3P5R A;  4P0X A;  3KRA B;  1YYQ A;  4KQU A;  3AQB B;  2DH4 A;  4JZB A;  3MZV A;  3V1V A;  3LEE A;  3OYR A;  3G4F A;  2OGD A;  3TFV A;  1N1Z A;  1YV5 A;  2Q9Z A;  4E9Z A;  4NFK F;  5JV1 F;  4JXY A;  2Z4W A;  3LGK A;  3WE9 A;  5B0I A;  1RTR A;  3WEI A;  4NFJ F;  5IVG A;  2O1O A;  1V4H A;  4EA1 A;  1N22 A;  3QKC A;  3SDR A;  1YQ7 A;  4DI5 A;  4RYP A;  3WCM A;  5C05 A;  3KRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...