3AE0A

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with geranylgeranyl thiopyrophosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAADLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dehydrosqualene synthase
publication title Mechanism of action and inhibition of dehydrosqualene synthase.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 110
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2010-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3ae0A00
5I1UA 4NKFA 5A0IA 3VJAA 4XQRF 4GA3A 4RYPA 5HN7A 4NKEA 1HM7A 1RTRA 5DGNF 3V66A 3VJ9A 3OABA 3NF2A 3WCGA 2OGDA 5JA0F 4MC3A 1VG7A 5B0LA 1WL1A 2E4OA 1N23A 3B7LA 2E8XA 3WJKA 1V4KA 4JZBA 5ILJA 2QISA 5ILKA 4DXJA 1VG3A 3LMDA 3LG5A 3N5HF 4KQ5A 1PS1A 5CG6A 1UBXA 1DI1A 2ZCRA 4MC0A 1UBWA 4LLTA 3ACWA 3KB9A 3NRIA 2PS6A 3Q2QA 5AFXA 5DZ2A 1RQIA 5HNAA 4RXDA 3PYAA 4LIXA 1V4IA 3MAVA 3PH7A 3TFPA 1N24A 4KVYA 3PKOA 4OMHA 4LZ0A 2H8OA 4XQTF 5B01A 4N1ZF 3WCCA 3LOMA 4NUAA 4WK5A 4XQSF 1V4HA 3OACB 3ICKA 3LVSA 1VG6A 4KVWA 3KROB 4L2XF 5ER8A 5EASA 3KRAA 3TFNA 3LGZB 5DGMF 5AYPA 5B0KA 1YYTA 2ZEUA 3AE0A 3TC1A 1RQJA 4DHDA 2P1CA 3P5PA 4LFEA 4DEMF 2PS5A 3KROA 4QPFA 1FPSA 3Q2ZA 5IL8A 3SDQA 2RAHA 3WSBA 3WJOA 3M02A 3PDEA 1YYUA 2F7MF 3N1WF 2J1OA 3M01A 4RNQA 1V4EA 4EA2A 4P0WA 1WKZA 3LLWA 3CC9A 3LEEA 3QKCA 5E8LA 2I19A 5DJVF 5JV1F 4LA6A 3N1VF 3P8RA 3EFQA 3ZOUA 4LUUA 1HXGA 4NFJF 3ID0A 3KRCB 2OPNA 3LJIA 4PVXF 3WCAA 4PVYF 4JYXA 2AEKA 3ASXA 5H9DA 3N0FA 1ZW5A 5IMPA 5ERNA 5KSXF 2E8VA 2E95A 3ADZA 2ONHA 3N45F 3IBAA 3SDVA 5JV2F 4KVDA 3NPKA 3KRCA 2DH4A 3ACXA 3ZCDA 3APZA 4NG6A 5E8KA 3SAEA 3LK5A 2Z7HA 4KKMA 1UBYA 5IN8A 2OA6A 4ZQ8A 1JFGA 4LPGF 5IK6A 2E94A 2Q80A 3WCMA 2F8CF 5DHIA 3WCHA 4DZWA 4FP4A 2AZKA 3WEIA 2O1OA 3MZVA 4RXCA 4KPJA 5B00A 1N1ZA 3AQ0A 3ICZA 2Z4WA 1WL3A 3WJNA 1VG4A 5E8HA 3TFVA 4LXWA 2J1PA 1WMWA 3OYRA 4KUXA 3CKEA 4F6VA 4UMJA 3P5RA 3N3DA 3WEFA 3KRAB 5CG5A 4MC8A 4OKMA 1KIZA 3WEKA 1HXAA 4LTVA 2Q9YA 2PS7A 3WC9A 1YV5A 4KQSA 1YHMA 1VG2A 4KWDA 4E1EA 4JXYA 3LSNA 5ILDA 4QXSF 1N20A 3IPIA 3LZ9A 4RXAA 3DYFA 2E8TA 3G4DA 2AZJA 5IK0A 4OGUA 1JFAA 3KRFB 4K10A 3WEGA 3N5JF 2E93A 3WCLA 2VF6A 4HD1A 3WCBA 3VJDA 2Q58A 1DGPA 3ACYA 4KVIA 3N3LF 2OPMA 3EZ3A 3TS7A 3EGTA 5B03A 5B0JA 2Z4ZA 3RMGA 4LZCA 3WCIA 3KRFA 3QQVA 4KFAA 4GAXA 5IVGA 5AELA 2E92A 3VJCA 1KIYA 5IK9A 3AQCB 4EA1A 1YYSA 3ICNA 5ILIA 2E8WA 2AETA 5EATA 4OMGA 4RXEA 5DJPF 5IKAA 3DYGA 5B02A 5JV0F 5EROA 2FORA 3VJEA 2ZEVA 4DWGA 2Z4XA 2Z50A 3KRPA 3RYEA 3WE9A 5DIQF 4Q23A 3P8LA 3CP6A 3RYWA 3PYBA 3WCFA 3WCEA 3Q30A 2F8ZF 3M0GA 3KBKA 1HX9A 4JVJF 4NFKF 3VJBA 2J5CA 4N9UA 4LTZA 4H5CF 5JUZF 4F62A 4LLSA 2F9KF 3WCDA 1WL0A 3G4FA 1UBVA 4GP1A 4LA5A 2E90A 2FTZA 2Z4VA 5A0JA 4FJQA 2AELA 5IL3A 4F6XA 3ICMA 2EWGA 3Q1OA 5ERMA 4LPHF 4P0VA 2AZLA 4JXNA 4NFIF 3WCJA 4DWBA 1N21A 2ZCQA 4E9UA 4LOBA 5IM1A 5DGSF 4E9ZA 3WEHA 3S9VA 3ZL6A 1HM4A 3ZMBA 5EAUA 3P41A 3RBMA 1YHLA 5ILYA 1YQ7A 3SDTA 4LZ3A 1YHKA 2F94F 5ILHA 2F92F 3W7FA 3DYHA 1V4JA 2Z7IA 2E8UA 4H5EF 4GP2A 4JZXA 4EA0A 5C05A 3V1XA 2E91A 5IKHA 5B0IA 5B0MA 3LGKA 4KQUA 1N22A 3WSAA 3OACA 2PS8A 1WY0A 3N0GA 3UCAA 3KRPB 3M9UA 5DHKA 1WL2A 5IMNA 5HN9A 2PS4A 2ZCSA 5DJRF 3NPRA 3WEJA 3BNYA 5ILZA 3SDRA 1EZFA 3SDUA 3BNXA 5HN8A 2Q9ZA 1HXCA 2Z78A 1YJ4A 4KPDA 4OKZA 4KK2A 4DI5A 2ZY1A 3V1VA 3VJ8A 4P0XA 2ONGA 2Z52A 3S4JA 4LFVF 3N46F 4H5DF 3AQBB 1YYQA 2F89F 5A0KA 1YYRA 2ZCOA 3N6KF 2Z4YA 3LDWA 3ZMCA 4LFGA 3OABB 3M00A 3N49F 5IMIA 1N1BA 5DW7A 5AHUB
chains in the Genus database with same CATH superfamily
5I1UA 4NKFA 5A0IA 3VJAA 4XQRF 4GA3A 4RYPA 5HN7A 4NKEA 1HM7A 1RTRA 5DGNF 3V66A 3VJ9A 3OABA 3NF2A 3WCGA 2OGDA 5JA0F 4MC3A 1VG7A 5B0LA 1WL1A 2E4OA 1N23A 3B7LA 2E8XA 3WJKA 1V4KA 4JZBA 5ILJA 2QISA 5ILKA 4DXJA 1VG3A 3LMDA 3LG5A 3N5HF 4KQ5A 1PS1A 5CG6A 1UBXA 1DI1A 2ZCRA 4MC0A 1UBWA 4LLTA 3ACWA 3KB9A 3NRIA 2PS6A 3Q2QA 5AFXA 5DZ2A 1RQIA 5HNAA 4RXDA 3PYAA 4LIXA 1V4IA 3MAVA 3PH7A 3TFPA 1N24A 4KVYA 3PKOA 4OMHA 4LZ0A 2H8OA 4XQTF 5B01A 4N1ZF 3WCCA 3LOMA 4NUAA 4WK5A 4XQSF 1V4HA 3OACB 3ICKA 3LVSA 1VG6A 4KVWA 3KROB 4L2XF 5ER8A 5EASA 3KRAA 3TFNA 3LGZB 5DGMF 5AYPA 5B0KA 1YYTA 2ZEUA 3AE0A 3TC1A 1RQJA 4DHDA 2P1CA 3P5PA 4LFEA 4DEMF 2PS5A 3KROA 4QPFA 1FPSA 3Q2ZA 5IL8A 3SDQA 2RAHA 3WSBA 3WJOA 3M02A 3PDEA 1YYUA 2F7MF 3N1WF 2J1OA 3M01A 4RNQA 1V4EA 4EA2A 4P0WA 1WKZA 3LLWA 3CC9A 3LEEA 3QKCA 5E8LA 2I19A 5DJVF 5JV1F 4LA6A 3N1VF 3P8RA 3EFQA 3ZOUA 4LUUA 1HXGA 4NFJF 3ID0A 3KRCB 2OPNA 3LJIA 4PVXF 3WCAA 4PVYF 4JYXA 2AEKA 3ASXA 5H9DA 3N0FA 1ZW5A 5IMPA 5ERNA 5KSXF 2E8VA 2E95A 3ADZA 2ONHA 3N45F 3IBAA 3SDVA 5JV2F 4KVDA 3NPKA 3KRCA 2DH4A 3ACXA 3ZCDA 3APZA 4NG6A 5E8KA 3SAEA 3LK5A 2Z7HA 4KKMA 1UBYA 5IN8A 2OA6A 4ZQ8A 1JFGA 4LPGF 5IK6A 2E94A 2Q80A 3WCMA 2F8CF 5DHIA 3WCHA 4DZWA 4FP4A 2AZKA 3WEIA 2O1OA 3MZVA 4RXCA 4KPJA 5B00A 1N1ZA 3AQ0A 3ICZA 2Z4WA 1WL3A 3WJNA 1VG4A 5E8HA 3TFVA 4LXWA 2J1PA 1WMWA 3OYRA 4KUXA 3CKEA 4F6VA 4UMJA 3P5RA 3N3DA 3WEFA 3KRAB 5CG5A 4MC8A 4OKMA 1KIZA 3WEKA 1HXAA 4LTVA 2Q9YA 2PS7A 3WC9A 1YV5A 4KQSA 1YHMA 1VG2A 4KWDA 4E1EA 4JXYA 3LSNA 5ILDA 4QXSF 1N20A 3IPIA 3LZ9A 4RXAA 3DYFA 2E8TA 3G4DA 2AZJA 5IK0A 4OGUA 1JFAA 3KRFB 4K10A 3WEGA 3N5JF 2E93A 3WCLA 2VF6A 4HD1A 3WCBA 3VJDA 2Q58A 1DGPA 3ACYA 4KVIA 3N3LF 2OPMA 3EZ3A 3TS7A 3EGTA 5B03A 5B0JA 2Z4ZA 3RMGA 4LZCA 3WCIA 3KRFA 3QQVA 4KFAA 4GAXA 5IVGA 5AELA 2E92A 3VJCA 1KIYA 5IK9A 3AQCB 4EA1A 1YYSA 3ICNA 5ILIA 2E8WA 2AETA 5EATA 4OMGA 4RXEA 5DJPF 5IKAA 3DYGA 5B02A 5JV0F 5EROA 2FORA 3VJEA 2ZEVA 4DWGA 2Z4XA 2Z50A 3KRPA 3RYEA 3WE9A 5DIQF 4Q23A 3P8LA 3CP6A 3RYWA 3PYBA 3WCFA 3WCEA 3Q30A 2F8ZF 3M0GA 3KBKA 1HX9A 4JVJF 4NFKF 3VJBA 2J5CA 4N9UA 4LTZA 4H5CF 5JUZF 4F62A 4LLSA 2F9KF 3WCDA 1WL0A 3G4FA 1UBVA 4GP1A 4LA5A 2E90A 2FTZA 2Z4VA 5A0JA 4FJQA 2AELA 5IL3A 4F6XA 3ICMA 2EWGA 3Q1OA 5ERMA 4LPHF 4P0VA 2AZLA 4JXNA 4NFIF 3WCJA 4DWBA 1N21A 2ZCQA 4E9UA 4LOBA 5IM1A 5DGSF 4E9ZA 3WEHA 3S9VA 3ZL6A 1HM4A 3ZMBA 5EAUA 3P41A 3RBMA 1YHLA 5ILYA 1YQ7A 3SDTA 4LZ3A 1YHKA 2F94F 5ILHA 2F92F 3W7FA 3DYHA 1V4JA 2Z7IA 2E8UA 4H5EF 4GP2A 4JZXA 4EA0A 5C05A 3V1XA 2E91A 5IKHA 5B0IA 5B0MA 3LGKA 4KQUA 1N22A 3WSAA 3OACA 2PS8A 1WY0A 3N0GA 3UCAA 3KRPB 3M9UA 5DHKA 1WL2A 5IMNA 5HN9A 2PS4A 2ZCSA 5DJRF 3NPRA 3WEJA 3BNYA 5ILZA 3SDRA 1EZFA 3SDUA 3BNXA 5HN8A 2Q9ZA 1HXCA 2Z78A 1YJ4A 4KPDA 4OKZA 4KK2A 4DI5A 2ZY1A 3V1VA 3VJ8A 4P0XA 2ONGA 2Z52A 3S4JA 4LFVF 3N46F 4H5DF 3AQBB 1YYQA 2F89F 5A0KA 1YYRA 2ZCOA 3N6KF 2Z4YA 3LDWA 3ZMCA 4LFGA 3OABB 3M00A 3N49F 5IMIA 1N1BA 5DW7A 5AHUB
chains in the Genus database with same CATH topology
5I1UA 4NKFA 5A0IA 3VJAA 4XQRF 4GA3A 4RYPA 5HN7A 4NKEA 1HM7A 1RTRA 5DGNF 3V66A 3VJ9A 3OABA 3NF2A 3WCGA 2OGDA 5JA0F 4MC3A 1VG7A 5B0LA 1WL1A 2E4OA 1N23A 3B7LA 2E8XA 3WJKA 1V4KA 4JZBA 5ILJA 2QISA 5ILKA 4DXJA 1VG3A 3LMDA 3LG5A 3N5HF 4KQ5A 1PS1A 5CG6A 1UBXA 1DI1A 2ZCRA 4MC0A 1UBWA 4LLTA 3ACWA 3KB9A 3NRIA 2PS6A 3Q2QA 5AFXA 5DZ2A 1RQIA 5HNAA 4RXDA 3PYAA 4LIXA 1V4IA 3MAVA 3PH7A 3TFPA 1N24A 4KVYA 3PKOA 4OMHA 4LZ0A 2H8OA 4XQTF 5B01A 4N1ZF 3WCCA 3LOMA 4NUAA 4WK5A 4XQSF 1V4HA 3OACB 3ICKA 3LVSA 1VG6A 4KVWA 3KROB 4L2XF 5ER8A 5EASA 3KRAA 3TFNA 3LGZB 5DGMF 5AYPA 5B0KA 1YYTA 2ZEUA 3AE0A 3TC1A 1RQJA 4DHDA 2P1CA 3P5PA 4LFEA 4DEMF 2PS5A 3KROA 4QPFA 1FPSA 3Q2ZA 5IL8A 3SDQA 2RAHA 3WSBA 3WJOA 3M02A 3PDEA 1YYUA 2F7MF 3N1WF 2J1OA 3M01A 4RNQA 1V4EA 4EA2A 4P0WA 1WKZA 3LLWA 3CC9A 3LEEA 3QKCA 5E8LA 2I19A 5DJVF 5JV1F 4LA6A 3N1VF 3P8RA 3EFQA 3ZOUA 4LUUA 1HXGA 4NFJF 3ID0A 3KRCB 2OPNA 3LJIA 4PVXF 3WCAA 4PVYF 4JYXA 2AEKA 3ASXA 5H9DA 3N0FA 1ZW5A 5IMPA 5ERNA 5KSXF 2E8VA 2E95A 3ADZA 2ONHA 3N45F 3IBAA 3SDVA 5JV2F 4KVDA 3NPKA 3KRCA 2DH4A 3ACXA 3ZCDA 3APZA 4NG6A 5E8KA 3SAEA 3LK5A 2Z7HA 4KKMA 1UBYA 5IN8A 2OA6A 4ZQ8A 1JFGA 4LPGF 5IK6A 2E94A 2Q80A 3WCMA 2F8CF 5DHIA 3WCHA 4DZWA 4FP4A 2AZKA 3WEIA 2O1OA 3MZVA 4RXCA 4KPJA 5B00A 1N1ZA 3AQ0A 3ICZA 2Z4WA 1WL3A 3WJNA 1VG4A 5E8HA 3TFVA 4LXWA 2J1PA 1WMWA 3OYRA 4KUXA 3CKEA 4F6VA 4UMJA 3P5RA 3N3DA 3WEFA 3KRAB 5CG5A 4MC8A 4OKMA 1KIZA 3WEKA 1HXAA 4LTVA 2Q9YA 2PS7A 3WC9A 1YV5A 4KQSA 1YHMA 1VG2A 4KWDA 4E1EA 4JXYA 3LSNA 5ILDA 4QXSF 1N20A 3IPIA 3LZ9A 4RXAA 3DYFA 2E8TA 3G4DA 2AZJA 5IK0A 4OGUA 1JFAA 3KRFB 4K10A 3WEGA 3N5JF 2E93A 3WCLA 2VF6A 4HD1A 3WCBA 3VJDA 2Q58A 1DGPA 3ACYA 4KVIA 3N3LF 2OPMA 3EZ3A 3TS7A 3EGTA 5B03A 5B0JA 2Z4ZA 3RMGA 4LZCA 3WCIA 3KRFA 3QQVA 4KFAA 4GAXA 5IVGA 5AELA 2E92A 3VJCA 1KIYA 5IK9A 3AQCB 4EA1A 1YYSA 3ICNA 5ILIA 2E8WA 2AETA 5EATA 4OMGA 4RXEA 5DJPF 5IKAA 3DYGA 5B02A 5JV0F 5EROA 2FORA 3VJEA 2ZEVA 4DWGA 2Z4XA 2Z50A 3KRPA 3RYEA 3WE9A 5DIQF 4Q23A 3P8LA 3CP6A 3RYWA 3PYBA 3WCFA 3WCEA 3Q30A 2F8ZF 3M0GA 3KBKA 1HX9A 4JVJF 4NFKF 3VJBA 2J5CA 4N9UA 4LTZA 4H5CF 5JUZF 4F62A 4LLSA 2F9KF 3WCDA 1WL0A 3G4FA 1UBVA 4GP1A 4LA5A 2E90A 2FTZA 2Z4VA 5A0JA 4FJQA 2AELA 5IL3A 4F6XA 3ICMA 2EWGA 3Q1OA 5ERMA 4LPHF 4P0VA 2AZLA 4JXNA 4NFIF 3WCJA 4DWBA 1N21A 2ZCQA 4E9UA 4LOBA 5IM1A 5DGSF 4E9ZA 3WEHA 3S9VA 3ZL6A 1HM4A 3ZMBA 5EAUA 3P41A 3RBMA 1YHLA 5ILYA 1YQ7A 3SDTA 4LZ3A 1YHKA 2F94F 5ILHA 2F92F 3W7FA 3DYHA 1V4JA 2Z7IA 2E8UA 4H5EF 4GP2A 4JZXA 4EA0A 5C05A 3V1XA 2E91A 5IKHA 5B0IA 5B0MA 3LGKA 4KQUA 1N22A 3WSAA 3OACA 2PS8A 1WY0A 3N0GA 3UCAA 3KRPB 3M9UA 5DHKA 1WL2A 5IMNA 5HN9A 2PS4A 2ZCSA 5DJRF 3NPRA 3WEJA 3BNYA 5ILZA 3SDRA 1EZFA 3SDUA 3BNXA 5HN8A 2Q9ZA 1HXCA 2Z78A 1YJ4A 4KPDA 4OKZA 4KK2A 4DI5A 2ZY1A 3V1VA 3VJ8A 4P0XA 2ONGA 2Z52A 3S4JA 4LFVF 3N46F 4H5DF 3AQBB 1YYQA 2F89F 5A0KA 1YYRA 2ZCOA 3N6KF 2Z4YA 3LDWA 3ZMCA 4LFGA 3OABB 3M00A 3N49F 5IMIA 1N1BA 5DW7A 5AHUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I1U A;  4NKF A;  5A0I A;  3VJA A;  4XQR F;  4GA3 A;  4RYP A;  5HN7 A;  4NKE A;  1HM7 A;  1RTR A;  5DGN F;  3V66 A;  3VJ9 A;  3OAB A;  3NF2 A;  3WCG A;  2OGD A;  5JA0 F;  4MC3 A;  1VG7 A;  5B0L A;  1WL1 A;  2E4O A;  1N23 A;  3B7L A;  2E8X A;  3WJK A;  1V4K A;  4JZB A;  5ILJ A;  2QIS A;  5ILK A;  4DXJ A;  1VG3 A;  3LMD A;  3LG5 A;  3N5H F;  4KQ5 A;  1PS1 A;  5CG6 A;  1UBX A;  1DI1 A;  2ZCR A;  4MC0 A;  1UBW A;  4LLT A;  3ACW A;  3KB9 A;  3NRI A;  2PS6 A;  3Q2Q A;  5AFX A;  5DZ2 A;  1RQI A;  5HNA A;  4RXD A;  3PYA A;  4LIX A;  1V4I A;  3MAV A;  3PH7 A;  3TFP A;  1N24 A;  4KVY A;  3PKO A;  4OMH A;  4LZ0 A;  2H8O A;  4XQT F;  5B01 A;  4N1Z F;  3WCC A;  3LOM A;  4NUA A;  4WK5 A;  4XQS F;  1V4H A;  3OAC B;  3ICK A;  3LVS A;  1VG6 A;  4KVW A;  3KRO B;  4L2X F;  5ER8 A;  5EAS A;  3KRA A;  3TFN A;  3LGZ B;  5DGM F;  5AYP A;  5B0K A;  1YYT A;  2ZEU A;  3AE0 A;  3TC1 A;  1RQJ A;  4DHD A;  2P1C A;  3P5P A;  4LFE A;  4DEM F;  2PS5 A;  3KRO A;  4QPF A;  1FPS A;  3Q2Z A;  5IL8 A;  3SDQ A;  2RAH A;  3WSB A;  3WJO A;  3M02 A;  3PDE A;  1YYU A;  2F7M F;  3N1W F;  2J1O A;  3M01 A;  4RNQ A;  1V4E A;  4EA2 A;  4P0W A;  1WKZ A;  3LLW A;  3CC9 A;  3LEE A;  3QKC A;  5E8L A;  2I19 A;  5DJV F;  5JV1 F;  4LA6 A;  3N1V F;  3P8R A;  3EFQ A;  3ZOU A;  4LUU A;  1HXG A;  4NFJ F;  3ID0 A;  3KRC B;  2OPN A;  3LJI A;  4PVX F;  3WCA A;  4PVY F;  4JYX A;  2AEK A;  3ASX A;  5H9D A;  3N0F A;  1ZW5 A;  5IMP A;  5ERN A;  5KSX F;  2E8V A;  2E95 A;  3ADZ A;  2ONH A;  3N45 F;  3IBA A;  3SDV A;  5JV2 F;  4KVD A;  3NPK A;  3KRC A;  2DH4 A;  3ACX A;  3ZCD A;  3APZ A;  4NG6 A;  5E8K A;  3SAE A;  3LK5 A;  2Z7H A;  4KKM A;  1UBY A;  5IN8 A;  2OA6 A;  4ZQ8 A;  1JFG A;  4LPG F;  5IK6 A;  2E94 A;  2Q80 A;  3WCM A;  2F8C F;  5DHI A;  3WCH A;  4DZW A;  4FP4 A;  2AZK A;  3WEI A;  2O1O A;  3MZV A;  4RXC A;  4KPJ A;  5B00 A;  1N1Z A;  3AQ0 A;  3ICZ A;  2Z4W A;  1WL3 A;  3WJN A;  1VG4 A;  5E8H A;  3TFV A;  4LXW A;  2J1P A;  1WMW A;  3OYR A;  4KUX A;  3CKE A;  4F6V A;  4UMJ A;  3P5R A;  3N3D A;  3WEF A;  3KRA B;  5CG5 A;  4MC8 A;  4OKM A;  1KIZ A;  3WEK A;  1HXA A;  4LTV A;  2Q9Y A;  2PS7 A;  3WC9 A;  1YV5 A;  4KQS A;  1YHM A;  1VG2 A;  4KWD A;  4E1E A;  4JXY A;  3LSN A;  5ILD A;  4QXS F;  1N20 A;  3IPI A;  3LZ9 A;  4RXA A;  3DYF A;  2E8T A;  3G4D A;  2AZJ A;  5IK0 A;  4OGU A;  1JFA A;  3KRF B;  4K10 A;  3WEG A;  3N5J F;  2E93 A;  3WCL A;  2VF6 A;  4HD1 A;  3WCB A;  3VJD A;  2Q58 A;  1DGP A;  3ACY A;  4KVI A;  3N3L F;  2OPM A;  3EZ3 A;  3TS7 A;  3EGT A;  5B03 A;  5B0J A;  2Z4Z A;  3RMG A;  4LZC A;  3WCI A;  3KRF A;  3QQV A;  4KFA A;  4GAX A;  5IVG A;  5AEL A;  2E92 A;  3VJC A;  1KIY A;  5IK9 A;  3AQC B;  4EA1 A;  1YYS A;  3ICN A;  5ILI A;  2E8W A;  2AET A;  5EAT A;  4OMG A;  4RXE A;  5DJP F;  5IKA A;  3DYG A;  5B02 A;  5JV0 F;  5ERO A;  2FOR A;  3VJE A;  2ZEV A;  4DWG A;  2Z4X A;  2Z50 A;  3KRP A;  3RYE A;  3WE9 A;  5DIQ F;  4Q23 A;  3P8L A;  3CP6 A;  3RYW A;  3PYB A;  3WCF A;  3WCE A;  3Q30 A;  2F8Z F;  3M0G A;  3KBK A;  1HX9 A;  4JVJ F;  4NFK F;  3VJB A;  2J5C A;  4N9U A;  4LTZ A;  4H5C F;  5JUZ F;  4F62 A;  4LLS A;  2F9K F;  3WCD A;  1WL0 A;  3G4F A;  1UBV A;  4GP1 A;  4LA5 A;  2E90 A;  2FTZ A;  2Z4V A;  5A0J A;  4FJQ A;  2AEL A;  5IL3 A;  4F6X A;  3ICM A;  2EWG A;  3Q1O A;  5ERM A;  4LPH F;  4P0V A;  2AZL A;  4JXN A;  4NFI F;  3WCJ A;  4DWB A;  1N21 A;  2ZCQ A;  4E9U A;  4LOB A;  5IM1 A;  5DGS F;  4E9Z A;  3WEH A;  3S9V A;  3ZL6 A;  1HM4 A;  3ZMB A;  5EAU A;  3P41 A;  3RBM A;  1YHL A;  5ILY A;  1YQ7 A;  3SDT A;  4LZ3 A;  1YHK A;  2F94 F;  5ILH A;  2F92 F;  3W7F A;  3DYH A;  1V4J A;  2Z7I A;  2E8U A;  4H5E F;  4GP2 A;  4JZX A;  4EA0 A;  5C05 A;  3V1X A;  2E91 A;  5IKH A;  5B0I A;  5B0M A;  3LGK A;  4KQU A;  1N22 A;  3WSA A;  3OAC A;  2PS8 A;  1WY0 A;  3N0G A;  3UCA A;  3KRP B;  3M9U A;  5DHK A;  1WL2 A;  5IMN A;  5HN9 A;  2PS4 A;  2ZCS A;  5DJR F;  3NPR A;  3WEJ A;  3BNY A;  5ILZ A;  3SDR A;  1EZF A;  3SDU A;  3BNX A;  5HN8 A;  2Q9Z A;  1HXC A;  2Z78 A;  1YJ4 A;  4KPD A;  4OKZ A;  4KK2 A;  4DI5 A;  2ZY1 A;  3V1V A;  3VJ8 A;  4P0X A;  2ONG A;  2Z52 A;  3S4J A;  4LFV F;  3N46 F;  4H5D F;  3AQB B;  1YYQ A;  2F89 F;  5A0K A;  1YYR A;  2ZCO A;  3N6K F;  2Z4Y A;  3LDW A;  3ZMC A;  4LFG A;  3OAB B;  3M00 A;  3N49 F;  5IMI A;  1N1B A;  5DW7 A;  5AHU B; 
#chains in the Genus database with same CATH topology
 5I1U A;  4NKF A;  5A0I A;  3VJA A;  4XQR F;  4GA3 A;  4RYP A;  5HN7 A;  4NKE A;  1HM7 A;  1RTR A;  5DGN F;  3V66 A;  3VJ9 A;  3OAB A;  3NF2 A;  3WCG A;  2OGD A;  5JA0 F;  4MC3 A;  1VG7 A;  5B0L A;  1WL1 A;  2E4O A;  1N23 A;  3B7L A;  2E8X A;  3WJK A;  1V4K A;  4JZB A;  5ILJ A;  2QIS A;  5ILK A;  4DXJ A;  1VG3 A;  3LMD A;  3LG5 A;  3N5H F;  4KQ5 A;  1PS1 A;  5CG6 A;  1UBX A;  1DI1 A;  2ZCR A;  4MC0 A;  1UBW A;  4LLT A;  3ACW A;  3KB9 A;  3NRI A;  2PS6 A;  3Q2Q A;  5AFX A;  5DZ2 A;  1RQI A;  5HNA A;  4RXD A;  3PYA A;  4LIX A;  1V4I A;  3MAV A;  3PH7 A;  3TFP A;  1N24 A;  4KVY A;  3PKO A;  4OMH A;  4LZ0 A;  2H8O A;  4XQT F;  5B01 A;  4N1Z F;  3WCC A;  3LOM A;  4NUA A;  4WK5 A;  4XQS F;  1V4H A;  3OAC B;  3ICK A;  3LVS A;  1VG6 A;  4KVW A;  3KRO B;  4L2X F;  5ER8 A;  5EAS A;  3KRA A;  3TFN A;  3LGZ B;  5DGM F;  5AYP A;  5B0K A;  1YYT A;  2ZEU A;  3AE0 A;  3TC1 A;  1RQJ A;  4DHD A;  2P1C A;  3P5P A;  4LFE A;  4DEM F;  2PS5 A;  3KRO A;  4QPF A;  1FPS A;  3Q2Z A;  5IL8 A;  3SDQ A;  2RAH A;  3WSB A;  3WJO A;  3M02 A;  3PDE A;  1YYU A;  2F7M F;  3N1W F;  2J1O A;  3M01 A;  4RNQ A;  1V4E A;  4EA2 A;  4P0W A;  1WKZ A;  3LLW A;  3CC9 A;  3LEE A;  3QKC A;  5E8L A;  2I19 A;  5DJV F;  5JV1 F;  4LA6 A;  3N1V F;  3P8R A;  3EFQ A;  3ZOU A;  4LUU A;  1HXG A;  4NFJ F;  3ID0 A;  3KRC B;  2OPN A;  3LJI A;  4PVX F;  3WCA A;  4PVY F;  4JYX A;  2AEK A;  3ASX A;  5H9D A;  3N0F A;  1ZW5 A;  5IMP A;  5ERN A;  5KSX F;  2E8V A;  2E95 A;  3ADZ A;  2ONH A;  3N45 F;  3IBA A;  3SDV A;  5JV2 F;  4KVD A;  3NPK A;  3KRC A;  2DH4 A;  3ACX A;  3ZCD A;  3APZ A;  4NG6 A;  5E8K A;  3SAE A;  3LK5 A;  2Z7H A;  4KKM A;  1UBY A;  5IN8 A;  2OA6 A;  4ZQ8 A;  1JFG A;  4LPG F;  5IK6 A;  2E94 A;  2Q80 A;  3WCM A;  2F8C F;  5DHI A;  3WCH A;  4DZW A;  4FP4 A;  2AZK A;  3WEI A;  2O1O A;  3MZV A;  4RXC A;  4KPJ A;  5B00 A;  1N1Z A;  3AQ0 A;  3ICZ A;  2Z4W A;  1WL3 A;  3WJN A;  1VG4 A;  5E8H A;  3TFV A;  4LXW A;  2J1P A;  1WMW A;  3OYR A;  4KUX A;  3CKE A;  4F6V A;  4UMJ A;  3P5R A;  3N3D A;  3WEF A;  3KRA B;  5CG5 A;  4MC8 A;  4OKM A;  1KIZ A;  3WEK A;  1HXA A;  4LTV A;  2Q9Y A;  2PS7 A;  3WC9 A;  1YV5 A;  4KQS A;  1YHM A;  1VG2 A;  4KWD A;  4E1E A;  4JXY A;  3LSN A;  5ILD A;  4QXS F;  1N20 A;  3IPI A;  3LZ9 A;  4RXA A;  3DYF A;  2E8T A;  3G4D A;  2AZJ A;  5IK0 A;  4OGU A;  1JFA A;  3KRF B;  4K10 A;  3WEG A;  3N5J F;  2E93 A;  3WCL A;  2VF6 A;  4HD1 A;  3WCB A;  3VJD A;  2Q58 A;  1DGP A;  3ACY A;  4KVI A;  3N3L F;  2OPM A;  3EZ3 A;  3TS7 A;  3EGT A;  5B03 A;  5B0J A;  2Z4Z A;  3RMG A;  4LZC A;  3WCI A;  3KRF A;  3QQV A;  4KFA A;  4GAX A;  5IVG A;  5AEL A;  2E92 A;  3VJC A;  1KIY A;  5IK9 A;  3AQC B;  4EA1 A;  1YYS A;  3ICN A;  5ILI A;  2E8W A;  2AET A;  5EAT A;  4OMG A;  4RXE A;  5DJP F;  5IKA A;  3DYG A;  5B02 A;  5JV0 F;  5ERO A;  2FOR A;  3VJE A;  2ZEV A;  4DWG A;  2Z4X A;  2Z50 A;  3KRP A;  3RYE A;  3WE9 A;  5DIQ F;  4Q23 A;  3P8L A;  3CP6 A;  3RYW A;  3PYB A;  3WCF A;  3WCE A;  3Q30 A;  2F8Z F;  3M0G A;  3KBK A;  1HX9 A;  4JVJ F;  4NFK F;  3VJB A;  2J5C A;  4N9U A;  4LTZ A;  4H5C F;  5JUZ F;  4F62 A;  4LLS A;  2F9K F;  3WCD A;  1WL0 A;  3G4F A;  1UBV A;  4GP1 A;  4LA5 A;  2E90 A;  2FTZ A;  2Z4V A;  5A0J A;  4FJQ A;  2AEL A;  5IL3 A;  4F6X A;  3ICM A;  2EWG A;  3Q1O A;  5ERM A;  4LPH F;  4P0V A;  2AZL A;  4JXN A;  4NFI F;  3WCJ A;  4DWB A;  1N21 A;  2ZCQ A;  4E9U A;  4LOB A;  5IM1 A;  5DGS F;  4E9Z A;  3WEH A;  3S9V A;  3ZL6 A;  1HM4 A;  3ZMB A;  5EAU A;  3P41 A;  3RBM A;  1YHL A;  5ILY A;  1YQ7 A;  3SDT A;  4LZ3 A;  1YHK A;  2F94 F;  5ILH A;  2F92 F;  3W7F A;  3DYH A;  1V4J A;  2Z7I A;  2E8U A;  4H5E F;  4GP2 A;  4JZX A;  4EA0 A;  5C05 A;  3V1X A;  2E91 A;  5IKH A;  5B0I A;  5B0M A;  3LGK A;  4KQU A;  1N22 A;  3WSA A;  3OAC A;  2PS8 A;  1WY0 A;  3N0G A;  3UCA A;  3KRP B;  3M9U A;  5DHK A;  1WL2 A;  5IMN A;  5HN9 A;  2PS4 A;  2ZCS A;  5DJR F;  3NPR A;  3WEJ A;  3BNY A;  5ILZ A;  3SDR A;  1EZF A;  3SDU A;  3BNX A;  5HN8 A;  2Q9Z A;  1HXC A;  2Z78 A;  1YJ4 A;  4KPD A;  4OKZ A;  4KK2 A;  4DI5 A;  2ZY1 A;  3V1V A;  3VJ8 A;  4P0X A;  2ONG A;  2Z52 A;  3S4J A;  4LFV F;  3N46 F;  4H5D F;  3AQB B;  1YYQ A;  2F89 F;  5A0K A;  1YYR A;  2ZCO A;  3N6K F;  2Z4Y A;  3LDW A;  3ZMC A;  4LFG A;  3OAB B;  3M00 A;  3N49 F;  5IMI A;  1N1B A;  5DW7 A;  5AHU B; 
#chains in the Genus database with same CATH homology
 5I1U A;  4NKF A;  5A0I A;  3VJA A;  4XQR F;  4GA3 A;  4RYP A;  5HN7 A;  4NKE A;  1HM7 A;  1RTR A;  5DGN F;  3V66 A;  3VJ9 A;  3OAB A;  3NF2 A;  3WCG A;  2OGD A;  5JA0 F;  4MC3 A;  1VG7 A;  5B0L A;  1WL1 A;  2E4O A;  1N23 A;  3B7L A;  2E8X A;  3WJK A;  1V4K A;  4JZB A;  5ILJ A;  2QIS A;  5ILK A;  4DXJ A;  1VG3 A;  3LMD A;  3LG5 A;  3N5H F;  4KQ5 A;  1PS1 A;  5CG6 A;  1UBX A;  1DI1 A;  2ZCR A;  4MC0 A;  1UBW A;  4LLT A;  3ACW A;  3KB9 A;  3NRI A;  2PS6 A;  3Q2Q A;  5AFX A;  5DZ2 A;  1RQI A;  5HNA A;  4RXD A;  3PYA A;  4LIX A;  1V4I A;  3MAV A;  3PH7 A;  3TFP A;  1N24 A;  4KVY A;  3PKO A;  4OMH A;  4LZ0 A;  2H8O A;  4XQT F;  5B01 A;  4N1Z F;  3WCC A;  3LOM A;  4NUA A;  4WK5 A;  4XQS F;  1V4H A;  3OAC B;  3ICK A;  3LVS A;  1VG6 A;  4KVW A;  3KRO B;  4L2X F;  5ER8 A;  5EAS A;  3KRA A;  3TFN A;  3LGZ B;  5DGM F;  5AYP A;  5B0K A;  1YYT A;  2ZEU A;  3AE0 A;  3TC1 A;  1RQJ A;  4DHD A;  2P1C A;  3P5P A;  4LFE A;  4DEM F;  2PS5 A;  3KRO A;  4QPF A;  1FPS A;  3Q2Z A;  5IL8 A;  3SDQ A;  2RAH A;  3WSB A;  3WJO A;  3M02 A;  3PDE A;  1YYU A;  2F7M F;  3N1W F;  2J1O A;  3M01 A;  4RNQ A;  1V4E A;  4EA2 A;  4P0W A;  1WKZ A;  3LLW A;  3CC9 A;  3LEE A;  3QKC A;  5E8L A;  2I19 A;  5DJV F;  5JV1 F;  4LA6 A;  3N1V F;  3P8R A;  3EFQ A;  3ZOU A;  4LUU A;  1HXG A;  4NFJ F;  3ID0 A;  3KRC B;  2OPN A;  3LJI A;  4PVX F;  3WCA A;  4PVY F;  4JYX A;  2AEK A;  3ASX A;  5H9D A;  3N0F A;  1ZW5 A;  5IMP A;  5ERN A;  5KSX F;  2E8V A;  2E95 A;  3ADZ A;  2ONH A;  3N45 F;  3IBA A;  3SDV A;  5JV2 F;  4KVD A;  3NPK A;  3KRC A;  2DH4 A;  3ACX A;  3ZCD A;  3APZ A;  4NG6 A;  5E8K A;  3SAE A;  3LK5 A;  2Z7H A;  4KKM A;  1UBY A;  5IN8 A;  2OA6 A;  4ZQ8 A;  1JFG A;  4LPG F;  5IK6 A;  2E94 A;  2Q80 A;  3WCM A;  2F8C F;  5DHI A;  3WCH A;  4DZW A;  4FP4 A;  2AZK A;  3WEI A;  2O1O A;  3MZV A;  4RXC A;  4KPJ A;  5B00 A;  1N1Z A;  3AQ0 A;  3ICZ A;  2Z4W A;  1WL3 A;  3WJN A;  1VG4 A;  5E8H A;  3TFV A;  4LXW A;  2J1P A;  1WMW A;  3OYR A;  4KUX A;  3CKE A;  4F6V A;  4UMJ A;  3P5R A;  3N3D A;  3WEF A;  3KRA B;  5CG5 A;  4MC8 A;  4OKM A;  1KIZ A;  3WEK A;  1HXA A;  4LTV A;  2Q9Y A;  2PS7 A;  3WC9 A;  1YV5 A;  4KQS A;  1YHM A;  1VG2 A;  4KWD A;  4E1E A;  4JXY A;  3LSN A;  5ILD A;  4QXS F;  1N20 A;  3IPI A;  3LZ9 A;  4RXA A;  3DYF A;  2E8T A;  3G4D A;  2AZJ A;  5IK0 A;  4OGU A;  1JFA A;  3KRF B;  4K10 A;  3WEG A;  3N5J F;  2E93 A;  3WCL A;  2VF6 A;  4HD1 A;  3WCB A;  3VJD A;  2Q58 A;  1DGP A;  3ACY A;  4KVI A;  3N3L F;  2OPM A;  3EZ3 A;  3TS7 A;  3EGT A;  5B03 A;  5B0J A;  2Z4Z A;  3RMG A;  4LZC A;  3WCI A;  3KRF A;  3QQV A;  4KFA A;  4GAX A;  5IVG A;  5AEL A;  2E92 A;  3VJC A;  1KIY A;  5IK9 A;  3AQC B;  4EA1 A;  1YYS A;  3ICN A;  5ILI A;  2E8W A;  2AET A;  5EAT A;  4OMG A;  4RXE A;  5DJP F;  5IKA A;  3DYG A;  5B02 A;  5JV0 F;  5ERO A;  2FOR A;  3VJE A;  2ZEV A;  4DWG A;  2Z4X A;  2Z50 A;  3KRP A;  3RYE A;  3WE9 A;  5DIQ F;  4Q23 A;  3P8L A;  3CP6 A;  3RYW A;  3PYB A;  3WCF A;  3WCE A;  3Q30 A;  2F8Z F;  3M0G A;  3KBK A;  1HX9 A;  4JVJ F;  4NFK F;  3VJB A;  2J5C A;  4N9U A;  4LTZ A;  4H5C F;  5JUZ F;  4F62 A;  4LLS A;  2F9K F;  3WCD A;  1WL0 A;  3G4F A;  1UBV A;  4GP1 A;  4LA5 A;  2E90 A;  2FTZ A;  2Z4V A;  5A0J A;  4FJQ A;  2AEL A;  5IL3 A;  4F6X A;  3ICM A;  2EWG A;  3Q1O A;  5ERM A;  4LPH F;  4P0V A;  2AZL A;  4JXN A;  4NFI F;  3WCJ A;  4DWB A;  1N21 A;  2ZCQ A;  4E9U A;  4LOB A;  5IM1 A;  5DGS F;  4E9Z A;  3WEH A;  3S9V A;  3ZL6 A;  1HM4 A;  3ZMB A;  5EAU A;  3P41 A;  3RBM A;  1YHL A;  5ILY A;  1YQ7 A;  3SDT A;  4LZ3 A;  1YHK A;  2F94 F;  5ILH A;  2F92 F;  3W7F A;  3DYH A;  1V4J A;  2Z7I A;  2E8U A;  4H5E F;  4GP2 A;  4JZX A;  4EA0 A;  5C05 A;  3V1X A;  2E91 A;  5IKH A;  5B0I A;  5B0M A;  3LGK A;  4KQU A;  1N22 A;  3WSA A;  3OAC A;  2PS8 A;  1WY0 A;  3N0G A;  3UCA A;  3KRP B;  3M9U A;  5DHK A;  1WL2 A;  5IMN A;  5HN9 A;  2PS4 A;  2ZCS A;  5DJR F;  3NPR A;  3WEJ A;  3BNY A;  5ILZ A;  3SDR A;  1EZF A;  3SDU A;  3BNX A;  5HN8 A;  2Q9Z A;  1HXC A;  2Z78 A;  1YJ4 A;  4KPD A;  4OKZ A;  4KK2 A;  4DI5 A;  2ZY1 A;  3V1V A;  3VJ8 A;  4P0X A;  2ONG A;  2Z52 A;  3S4J A;  4LFV F;  3N46 F;  4H5D F;  3AQB B;  1YYQ A;  2F89 F;  5A0K A;  1YYR A;  2ZCO A;  3N6K F;  2Z4Y A;  3LDW A;  3ZMC A;  4LFG A;  3OAB B;  3M00 A;  3N49 F;  5IMI A;  1N1B A;  5DW7 A;  5AHU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...