3P8LA

Crystal structure of polyprenyl synthase from enterococcus faecalis v583
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
300
structure length
283
Chain Sequence
HHHHHHSLTNFSQQHLPLVEKVMVDFIAEYTENERLKEAMLYSIHAGGKRLRPLLVLTTVAAFQKEMETQDYQVAASLEMIHTYSLIHDDLPAMDDDDLRRGKPTNHKVFGEATAILAGDGLLTGAFQLLSLSQLGLSEKVLLMQQLAKAAGNQGMVSGQMGDIEGEKVSLTLEELAAVHEKKTGALIEFALIAGGVLANQTEEVIGLLTQFAHHYGLAFQIRDDLLDATSSTYPALLGIAGAKDALTHQLAEGSAVLEKIKANVPNFSEEHLANLLTQLQLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Enterococcus faecalis
total genus 117
structure length 283
sequence length 300
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3p8lA00
5C05A 5EAUA 3WCIA 1JFAA 2QISA 2E94A 3DYGA 3PDEA 4JZBA 3DYFA 3IBAA 4KVYA 3ZMBA 2DH4A 5AFXA 3LGKA 5AELA 3VJCA 3WEHA 2Z4VA 4RYPA 3VJ8A 4EA2A 2Z7HA 2E95A 3WEKA 4OMGA 3KRAA 1UBYA 1YV5A 4RNQA 4LIXA 5ER8A 5CG5A 4UMJA 3Q2QA 3P5RA 3WEJA 2E8XA 3S9VA 2ONHA 1V4IA 1VG2A 3SDTA 1JFGA 2ONGA 3N5JF 1KIYA 4QPFA 5JA0F 5IK9A 3EFQA 2ZCQA 1YYRA 5ILYA 2E8UA 3ICZA 2EWGA 4LPGF 2ZY1A 2P1CA 4NFKF 4Q23A 1KIZA 2E4OA 4LZ3A 4WK5A 3IPIA 3AQCB 2E90A 2F9KF 3Q2ZA 3WJOA 2I19A 2VF6A 2E8TA 1HM7A 2PS7A 2Q9ZA 2E93A 2J5CA 1YYTA 3KRCA 4JXYA 2AZLA 2AETA 3KROA 5DGSF 5B0KA 3WCCA 1HXGA 1RQJA 3WCGA 3WCAA 4FJQA 4JYXA 5E8HA 3WCHA 2PS5A 5IMPA 5CG6A 1UBXA 1HM4A 5DHIA 1N24A 1PS1A 1VG4A 3PKOA 4K10A 2OGDA 3ACYA 3OACA 3CC9A 4RXDA 4LA6A 2E8WA 3N46F 5IKHA 4HD1A 4KPJA 4F6VA 3EGTA 4N1ZF 3LK5A 4KQUA 4PVYF 5DJRF 1V4JA 4LTVA 3VJAA 5I1UA 3LDWA 3KRPB 5JV2F 2Q58A 1UBWA 4RXCA 3ICKA 3TFPA 5IMIA 3CP6A 5B01A 1YHLA 5DGNF 4KUXA 5DZ2A 4ZQ8A 3TS7A 4NFJF 3LG5A 4KWDA 5A0KA 4LZ0A 5B0MA 5ILDA 5DJPF 2Z4XA 1DI1A 1ZW5A 2FORA 2PS4A 5ILIA 3WCEA 4F62A 2Z4YA 5E8KA 3Q1OA 4GA3A 4E1EA 3RBMA 4LLSA 3KRFA 4F6XA 2F8ZF 1YYQA 3G4DA 2O1OA 4MC3A 5IMNA 3WC9A 1YYUA 2AZJA 4LFEA 2Z4ZA 5HN8A 4JVJF 1WY0A 5IVGA 4LOBA 2Q80A 5KSXF 5ILJA 1RTRA 2Q9YA 3MAVA 3CKEA 3WEIA 2OPMA 3KBKA 3N3DA 2ZCSA 3ACWA 4H5DF 2OA6A 3WSAA 4NUAA 5B03A 2F89F 5IK6A 3AQBB 3P8RA 5ERMA 5IKAA 3M9UA 3WCLA 3WCFA 3SDQA 3VJDA 3WSBA 5B0LA 3LLWA 2ZCOA 2Z50A 5ILKA 3N1VF 4GP2A 2Z78A 3KB9A 4P0XA 3M0GA 5DJVF 2Z4WA 1WKZA 3NF2A 5B00A 1N23A 1WMWA 3WE9A 5ILZA 3ADZA 4DWBA 3KRCB 4LUUA 3B7LA 1HX9A 3OABB 4QXSF 3P5PA 3LMDA 4DXJA 4XQTF 3V1VA 4LLTA 3OYRA 4DEMF 3KROB 4KQSA 4KKMA 3RYEA 5AYPA 3EZ3A 3NPRA 5JV0F 5AHUB 5B02A 3TFVA 4FP4A 2Z7IA 3P41A 5EATA 4E9ZA 1YHMA 3V1XA 1YQ7A 2H8OA 2OPNA 5EROA 2J1PA 1V4EA 3ID0A 4OKZA 3WCMA 3KRPA 5IL8A 3N6KF 4KVDA 3V66A 2J1OA 1N22A 5IK0A 4LFVF 3G4FA 3W7FA 3NRIA 4KVIA 3LSNA 4DI5A 3WCJA 3AQ0A 3M01A 4LFGA 5HN9A 4N9UA 4JXNA 5B0JA 1VG3A 1V4HA 2F92F 4LA5A 1UBVA 5JUZF 2ZEVA 4XQRF 4OMHA 4NFIF 3LOMA 5DGMF 1N21A 3QQVA 4E9UA 3WCDA 4KQ5A 5IM1A 4EA1A 1VG6A 1VG7A 3N45F 3ZCDA 4NKFA 3LJIA 4H5EF 3S4JA 1EZFA 1RQIA 1V4KA 2E91A 4JZXA 5HN7A 3LEEA 3KRAB 2AZKA 4MC8A 3ZMCA 5DHKA 3LVSA 3KRFB 3VJBA 3WCBA 5H9DA 3DYHA 2F7MF 1HXCA 3N3LF 1WL0A 3PYAA 1YHKA 4KK2A 4GP1A 3ZOUA 4GAXA 3RYWA 3M02A 3N5HF 4KPDA 3AE0A 3TFNA 4DHDA 5JV1F 3QKCA 4RXEA 5E8LA 4DWGA 3VJ9A 3TC1A 3WEGA 3Q30A 3LZ9A 3N1WF 4OGUA 2AEKA 5ERNA 2Z52A 2E92A 4P0WA 1YYSA 3ICNA 4EA0A 2F94F 2FTZA 4L2XF 4XQSF 5IN8A 4H5CF 1YJ4A 3APZA 3OABA 5DIQF 1N20A 5A0IA 4LPHF 3NPKA 5DW7A 5ILHA 3N0GA 4OKMA 3ZL6A 1WL2A 1WL1A 3SDVA 3N49F 3WEFA 4LZCA 3WJNA 3SAEA 1WL3A 3SDUA 3WJKA 3ICMA 4LTZA 4PVXF 4KVWA 3ASXA 2PS6A 4NG6A 3M00A 1N1BA 1N1ZA 2PS8A 4DZWA 1HXAA 5A0JA 2ZCRA 4LXWA 5B0IA 3SDRA 3PH7A 2E8VA 3VJEA 3LGZB 3UCAA 3OACB 3RMGA 5IL3A 3N0FA 4RXAA 4NKEA 1DGPA 2AELA 3MZVA 3P8LA 1FPSA 5EASA 4KFAA 2ZEUA 3BNYA 4P0VA 5HNAA 2F8CF 3PYBA 3ACXA 3BNXA 4MC0A 2RAHA
chains in the Genus database with same CATH superfamily
5C05A 5EAUA 3WCIA 1JFAA 2QISA 2E94A 3DYGA 3PDEA 4JZBA 3DYFA 3IBAA 4KVYA 3ZMBA 2DH4A 5AFXA 3LGKA 5AELA 3VJCA 3WEHA 2Z4VA 4RYPA 3VJ8A 4EA2A 2Z7HA 2E95A 3WEKA 4OMGA 3KRAA 1UBYA 1YV5A 4RNQA 4LIXA 5ER8A 5CG5A 4UMJA 3Q2QA 3P5RA 3WEJA 2E8XA 3S9VA 2ONHA 1V4IA 1VG2A 3SDTA 1JFGA 2ONGA 3N5JF 1KIYA 4QPFA 5JA0F 5IK9A 3EFQA 2ZCQA 1YYRA 5ILYA 2E8UA 3ICZA 2EWGA 4LPGF 2ZY1A 2P1CA 4NFKF 4Q23A 1KIZA 2E4OA 4LZ3A 4WK5A 3IPIA 3AQCB 2E90A 2F9KF 3Q2ZA 3WJOA 2I19A 2VF6A 2E8TA 1HM7A 2PS7A 2Q9ZA 2E93A 2J5CA 1YYTA 3KRCA 4JXYA 2AZLA 2AETA 3KROA 5DGSF 5B0KA 3WCCA 1HXGA 1RQJA 3WCGA 3WCAA 4FJQA 4JYXA 5E8HA 3WCHA 2PS5A 5IMPA 5CG6A 1UBXA 1HM4A 5DHIA 1N24A 1PS1A 1VG4A 3PKOA 4K10A 2OGDA 3ACYA 3OACA 3CC9A 4RXDA 4LA6A 2E8WA 3N46F 5IKHA 4HD1A 4KPJA 4F6VA 3EGTA 4N1ZF 3LK5A 4KQUA 4PVYF 5DJRF 1V4JA 4LTVA 3VJAA 5I1UA 3LDWA 3KRPB 5JV2F 2Q58A 1UBWA 4RXCA 3ICKA 3TFPA 5IMIA 3CP6A 5B01A 1YHLA 5DGNF 4KUXA 5DZ2A 4ZQ8A 3TS7A 4NFJF 3LG5A 4KWDA 5A0KA 4LZ0A 5B0MA 5ILDA 5DJPF 2Z4XA 1DI1A 1ZW5A 2FORA 2PS4A 5ILIA 3WCEA 4F62A 2Z4YA 5E8KA 3Q1OA 4GA3A 4E1EA 3RBMA 4LLSA 3KRFA 4F6XA 2F8ZF 1YYQA 3G4DA 2O1OA 4MC3A 5IMNA 3WC9A 1YYUA 2AZJA 4LFEA 2Z4ZA 5HN8A 4JVJF 1WY0A 5IVGA 4LOBA 2Q80A 5KSXF 5ILJA 1RTRA 2Q9YA 3MAVA 3CKEA 3WEIA 2OPMA 3KBKA 3N3DA 2ZCSA 3ACWA 4H5DF 2OA6A 3WSAA 4NUAA 5B03A 2F89F 5IK6A 3AQBB 3P8RA 5ERMA 5IKAA 3M9UA 3WCLA 3WCFA 3SDQA 3VJDA 3WSBA 5B0LA 3LLWA 2ZCOA 2Z50A 5ILKA 3N1VF 4GP2A 2Z78A 3KB9A 4P0XA 3M0GA 5DJVF 2Z4WA 1WKZA 3NF2A 5B00A 1N23A 1WMWA 3WE9A 5ILZA 3ADZA 4DWBA 3KRCB 4LUUA 3B7LA 1HX9A 3OABB 4QXSF 3P5PA 3LMDA 4DXJA 4XQTF 3V1VA 4LLTA 3OYRA 4DEMF 3KROB 4KQSA 4KKMA 3RYEA 5AYPA 3EZ3A 3NPRA 5JV0F 5AHUB 5B02A 3TFVA 4FP4A 2Z7IA 3P41A 5EATA 4E9ZA 1YHMA 3V1XA 1YQ7A 2H8OA 2OPNA 5EROA 2J1PA 1V4EA 3ID0A 4OKZA 3WCMA 3KRPA 5IL8A 3N6KF 4KVDA 3V66A 2J1OA 1N22A 5IK0A 4LFVF 3G4FA 3W7FA 3NRIA 4KVIA 3LSNA 4DI5A 3WCJA 3AQ0A 3M01A 4LFGA 5HN9A 4N9UA 4JXNA 5B0JA 1VG3A 1V4HA 2F92F 4LA5A 1UBVA 5JUZF 2ZEVA 4XQRF 4OMHA 4NFIF 3LOMA 5DGMF 1N21A 3QQVA 4E9UA 3WCDA 4KQ5A 5IM1A 4EA1A 1VG6A 1VG7A 3N45F 3ZCDA 4NKFA 3LJIA 4H5EF 3S4JA 1EZFA 1RQIA 1V4KA 2E91A 4JZXA 5HN7A 3LEEA 3KRAB 2AZKA 4MC8A 3ZMCA 5DHKA 3LVSA 3KRFB 3VJBA 3WCBA 5H9DA 3DYHA 2F7MF 1HXCA 3N3LF 1WL0A 3PYAA 1YHKA 4KK2A 4GP1A 3ZOUA 4GAXA 3RYWA 3M02A 3N5HF 4KPDA 3AE0A 3TFNA 4DHDA 5JV1F 3QKCA 4RXEA 5E8LA 4DWGA 3VJ9A 3TC1A 3WEGA 3Q30A 3LZ9A 3N1WF 4OGUA 2AEKA 5ERNA 2Z52A 2E92A 4P0WA 1YYSA 3ICNA 4EA0A 2F94F 2FTZA 4L2XF 4XQSF 5IN8A 4H5CF 1YJ4A 3APZA 3OABA 5DIQF 1N20A 5A0IA 4LPHF 3NPKA 5DW7A 5ILHA 3N0GA 4OKMA 3ZL6A 1WL2A 1WL1A 3SDVA 3N49F 3WEFA 4LZCA 3WJNA 3SAEA 1WL3A 3SDUA 3WJKA 3ICMA 4LTZA 4PVXF 4KVWA 3ASXA 2PS6A 4NG6A 3M00A 1N1BA 1N1ZA 2PS8A 4DZWA 1HXAA 5A0JA 2ZCRA 4LXWA 5B0IA 3SDRA 3PH7A 2E8VA 3VJEA 3LGZB 3UCAA 3OACB 3RMGA 5IL3A 3N0FA 4RXAA 4NKEA 1DGPA 2AELA 3MZVA 3P8LA 1FPSA 5EASA 4KFAA 2ZEUA 3BNYA 4P0VA 5HNAA 2F8CF 3PYBA 3ACXA 3BNXA 4MC0A 2RAHA
chains in the Genus database with same CATH topology
5C05A 5EAUA 3WCIA 1JFAA 2QISA 2E94A 3DYGA 3PDEA 4JZBA 3DYFA 3IBAA 4KVYA 3ZMBA 2DH4A 5AFXA 3LGKA 5AELA 3VJCA 3WEHA 2Z4VA 4RYPA 3VJ8A 4EA2A 2Z7HA 2E95A 3WEKA 4OMGA 3KRAA 1UBYA 1YV5A 4RNQA 4LIXA 5ER8A 5CG5A 4UMJA 3Q2QA 3P5RA 3WEJA 2E8XA 3S9VA 2ONHA 1V4IA 1VG2A 3SDTA 1JFGA 2ONGA 3N5JF 1KIYA 4QPFA 5JA0F 5IK9A 3EFQA 2ZCQA 1YYRA 5ILYA 2E8UA 3ICZA 2EWGA 4LPGF 2ZY1A 2P1CA 4NFKF 4Q23A 1KIZA 2E4OA 4LZ3A 4WK5A 3IPIA 3AQCB 2E90A 2F9KF 3Q2ZA 3WJOA 2I19A 2VF6A 2E8TA 1HM7A 2PS7A 2Q9ZA 2E93A 2J5CA 1YYTA 3KRCA 4JXYA 2AZLA 2AETA 3KROA 5DGSF 5B0KA 3WCCA 1HXGA 1RQJA 3WCGA 3WCAA 4FJQA 4JYXA 5E8HA 3WCHA 2PS5A 5IMPA 5CG6A 1UBXA 1HM4A 5DHIA 1N24A 1PS1A 1VG4A 3PKOA 4K10A 2OGDA 3ACYA 3OACA 3CC9A 4RXDA 4LA6A 2E8WA 3N46F 5IKHA 4HD1A 4KPJA 4F6VA 3EGTA 4N1ZF 3LK5A 4KQUA 4PVYF 5DJRF 1V4JA 4LTVA 3VJAA 5I1UA 3LDWA 3KRPB 5JV2F 2Q58A 1UBWA 4RXCA 3ICKA 3TFPA 5IMIA 3CP6A 5B01A 1YHLA 5DGNF 4KUXA 5DZ2A 4ZQ8A 3TS7A 4NFJF 3LG5A 4KWDA 5A0KA 4LZ0A 5B0MA 5ILDA 5DJPF 2Z4XA 1DI1A 1ZW5A 2FORA 2PS4A 5ILIA 3WCEA 4F62A 2Z4YA 5E8KA 3Q1OA 4GA3A 4E1EA 3RBMA 4LLSA 3KRFA 4F6XA 2F8ZF 1YYQA 3G4DA 2O1OA 4MC3A 5IMNA 3WC9A 1YYUA 2AZJA 4LFEA 2Z4ZA 5HN8A 4JVJF 1WY0A 5IVGA 4LOBA 2Q80A 5KSXF 5ILJA 1RTRA 2Q9YA 3MAVA 3CKEA 3WEIA 2OPMA 3KBKA 3N3DA 2ZCSA 3ACWA 4H5DF 2OA6A 3WSAA 4NUAA 5B03A 2F89F 5IK6A 3AQBB 3P8RA 5ERMA 5IKAA 3M9UA 3WCLA 3WCFA 3SDQA 3VJDA 3WSBA 5B0LA 3LLWA 2ZCOA 2Z50A 5ILKA 3N1VF 4GP2A 2Z78A 3KB9A 4P0XA 3M0GA 5DJVF 2Z4WA 1WKZA 3NF2A 5B00A 1N23A 1WMWA 3WE9A 5ILZA 3ADZA 4DWBA 3KRCB 4LUUA 3B7LA 1HX9A 3OABB 4QXSF 3P5PA 3LMDA 4DXJA 4XQTF 3V1VA 4LLTA 3OYRA 4DEMF 3KROB 4KQSA 4KKMA 3RYEA 5AYPA 3EZ3A 3NPRA 5JV0F 5AHUB 5B02A 3TFVA 4FP4A 2Z7IA 3P41A 5EATA 4E9ZA 1YHMA 3V1XA 1YQ7A 2H8OA 2OPNA 5EROA 2J1PA 1V4EA 3ID0A 4OKZA 3WCMA 3KRPA 5IL8A 3N6KF 4KVDA 3V66A 2J1OA 1N22A 5IK0A 4LFVF 3G4FA 3W7FA 3NRIA 4KVIA 3LSNA 4DI5A 3WCJA 3AQ0A 3M01A 4LFGA 5HN9A 4N9UA 4JXNA 5B0JA 1VG3A 1V4HA 2F92F 4LA5A 1UBVA 5JUZF 2ZEVA 4XQRF 4OMHA 4NFIF 3LOMA 5DGMF 1N21A 3QQVA 4E9UA 3WCDA 4KQ5A 5IM1A 4EA1A 1VG6A 1VG7A 3N45F 3ZCDA 4NKFA 3LJIA 4H5EF 3S4JA 1EZFA 1RQIA 1V4KA 2E91A 4JZXA 5HN7A 3LEEA 3KRAB 2AZKA 4MC8A 3ZMCA 5DHKA 3LVSA 3KRFB 3VJBA 3WCBA 5H9DA 3DYHA 2F7MF 1HXCA 3N3LF 1WL0A 3PYAA 1YHKA 4KK2A 4GP1A 3ZOUA 4GAXA 3RYWA 3M02A 3N5HF 4KPDA 3AE0A 3TFNA 4DHDA 5JV1F 3QKCA 4RXEA 5E8LA 4DWGA 3VJ9A 3TC1A 3WEGA 3Q30A 3LZ9A 3N1WF 4OGUA 2AEKA 5ERNA 2Z52A 2E92A 4P0WA 1YYSA 3ICNA 4EA0A 2F94F 2FTZA 4L2XF 4XQSF 5IN8A 4H5CF 1YJ4A 3APZA 3OABA 5DIQF 1N20A 5A0IA 4LPHF 3NPKA 5DW7A 5ILHA 3N0GA 4OKMA 3ZL6A 1WL2A 1WL1A 3SDVA 3N49F 3WEFA 4LZCA 3WJNA 3SAEA 1WL3A 3SDUA 3WJKA 3ICMA 4LTZA 4PVXF 4KVWA 3ASXA 2PS6A 4NG6A 3M00A 1N1BA 1N1ZA 2PS8A 4DZWA 1HXAA 5A0JA 2ZCRA 4LXWA 5B0IA 3SDRA 3PH7A 2E8VA 3VJEA 3LGZB 3UCAA 3OACB 3RMGA 5IL3A 3N0FA 4RXAA 4NKEA 1DGPA 2AELA 3MZVA 3P8LA 1FPSA 5EASA 4KFAA 2ZEUA 3BNYA 4P0VA 5HNAA 2F8CF 3PYBA 3ACXA 3BNXA 4MC0A 2RAHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C05 A;  5EAU A;  3WCI A;  1JFA A;  2QIS A;  2E94 A;  3DYG A;  3PDE A;  4JZB A;  3DYF A;  3IBA A;  4KVY A;  3ZMB A;  2DH4 A;  5AFX A;  3LGK A;  5AEL A;  3VJC A;  3WEH A;  2Z4V A;  4RYP A;  3VJ8 A;  4EA2 A;  2Z7H A;  2E95 A;  3WEK A;  4OMG A;  3KRA A;  1UBY A;  1YV5 A;  4RNQ A;  4LIX A;  5ER8 A;  5CG5 A;  4UMJ A;  3Q2Q A;  3P5R A;  3WEJ A;  2E8X A;  3S9V A;  2ONH A;  1V4I A;  1VG2 A;  3SDT A;  1JFG A;  2ONG A;  3N5J F;  1KIY A;  4QPF A;  5JA0 F;  5IK9 A;  3EFQ A;  2ZCQ A;  1YYR A;  5ILY A;  2E8U A;  3ICZ A;  2EWG A;  4LPG F;  2ZY1 A;  2P1C A;  4NFK F;  4Q23 A;  1KIZ A;  2E4O A;  4LZ3 A;  4WK5 A;  3IPI A;  3AQC B;  2E90 A;  2F9K F;  3Q2Z A;  3WJO A;  2I19 A;  2VF6 A;  2E8T A;  1HM7 A;  2PS7 A;  2Q9Z A;  2E93 A;  2J5C A;  1YYT A;  3KRC A;  4JXY A;  2AZL A;  2AET A;  3KRO A;  5DGS F;  5B0K A;  3WCC A;  1HXG A;  1RQJ A;  3WCG A;  3WCA A;  4FJQ A;  4JYX A;  5E8H A;  3WCH A;  2PS5 A;  5IMP A;  5CG6 A;  1UBX A;  1HM4 A;  5DHI A;  1N24 A;  1PS1 A;  1VG4 A;  3PKO A;  4K10 A;  2OGD A;  3ACY A;  3OAC A;  3CC9 A;  4RXD A;  4LA6 A;  2E8W A;  3N46 F;  5IKH A;  4HD1 A;  4KPJ A;  4F6V A;  3EGT A;  4N1Z F;  3LK5 A;  4KQU A;  4PVY F;  5DJR F;  1V4J A;  4LTV A;  3VJA A;  5I1U A;  3LDW A;  3KRP B;  5JV2 F;  2Q58 A;  1UBW A;  4RXC A;  3ICK A;  3TFP A;  5IMI A;  3CP6 A;  5B01 A;  1YHL A;  5DGN F;  4KUX A;  5DZ2 A;  4ZQ8 A;  3TS7 A;  4NFJ F;  3LG5 A;  4KWD A;  5A0K A;  4LZ0 A;  5B0M A;  5ILD A;  5DJP F;  2Z4X A;  1DI1 A;  1ZW5 A;  2FOR A;  2PS4 A;  5ILI A;  3WCE A;  4F62 A;  2Z4Y A;  5E8K A;  3Q1O A;  4GA3 A;  4E1E A;  3RBM A;  4LLS A;  3KRF A;  4F6X A;  2F8Z F;  1YYQ A;  3G4D A;  2O1O A;  4MC3 A;  5IMN A;  3WC9 A;  1YYU A;  2AZJ A;  4LFE A;  2Z4Z A;  5HN8 A;  4JVJ F;  1WY0 A;  5IVG A;  4LOB A;  2Q80 A;  5KSX F;  5ILJ A;  1RTR A;  2Q9Y A;  3MAV A;  3CKE A;  3WEI A;  2OPM A;  3KBK A;  3N3D A;  2ZCS A;  3ACW A;  4H5D F;  2OA6 A;  3WSA A;  4NUA A;  5B03 A;  2F89 F;  5IK6 A;  3AQB B;  3P8R A;  5ERM A;  5IKA A;  3M9U A;  3WCL A;  3WCF A;  3SDQ A;  3VJD A;  3WSB A;  5B0L A;  3LLW A;  2ZCO A;  2Z50 A;  5ILK A;  3N1V F;  4GP2 A;  2Z78 A;  3KB9 A;  4P0X A;  3M0G A;  5DJV F;  2Z4W A;  1WKZ A;  3NF2 A;  5B00 A;  1N23 A;  1WMW A;  3WE9 A;  5ILZ A;  3ADZ A;  4DWB A;  3KRC B;  4LUU A;  3B7L A;  1HX9 A;  3OAB B;  4QXS F;  3P5P A;  3LMD A;  4DXJ A;  4XQT F;  3V1V A;  4LLT A;  3OYR A;  4DEM F;  3KRO B;  4KQS A;  4KKM A;  3RYE A;  5AYP A;  3EZ3 A;  3NPR A;  5JV0 F;  5AHU B;  5B02 A;  3TFV A;  4FP4 A;  2Z7I A;  3P41 A;  5EAT A;  4E9Z A;  1YHM A;  3V1X A;  1YQ7 A;  2H8O A;  2OPN A;  5ERO A;  2J1P A;  1V4E A;  3ID0 A;  4OKZ A;  3WCM A;  3KRP A;  5IL8 A;  3N6K F;  4KVD A;  3V66 A;  2J1O A;  1N22 A;  5IK0 A;  4LFV F;  3G4F A;  3W7F A;  3NRI A;  4KVI A;  3LSN A;  4DI5 A;  3WCJ A;  3AQ0 A;  3M01 A;  4LFG A;  5HN9 A;  4N9U A;  4JXN A;  5B0J A;  1VG3 A;  1V4H A;  2F92 F;  4LA5 A;  1UBV A;  5JUZ F;  2ZEV A;  4XQR F;  4OMH A;  4NFI F;  3LOM A;  5DGM F;  1N21 A;  3QQV A;  4E9U A;  3WCD A;  4KQ5 A;  5IM1 A;  4EA1 A;  1VG6 A;  1VG7 A;  3N45 F;  3ZCD A;  4NKF A;  3LJI A;  4H5E F;  3S4J A;  1EZF A;  1RQI A;  1V4K A;  2E91 A;  4JZX A;  5HN7 A;  3LEE A;  3KRA B;  2AZK A;  4MC8 A;  3ZMC A;  5DHK A;  3LVS A;  3KRF B;  3VJB A;  3WCB A;  5H9D A;  3DYH A;  2F7M F;  1HXC A;  3N3L F;  1WL0 A;  3PYA A;  1YHK A;  4KK2 A;  4GP1 A;  3ZOU A;  4GAX A;  3RYW A;  3M02 A;  3N5H F;  4KPD A;  3AE0 A;  3TFN A;  4DHD A;  5JV1 F;  3QKC A;  4RXE A;  5E8L A;  4DWG A;  3VJ9 A;  3TC1 A;  3WEG A;  3Q30 A;  3LZ9 A;  3N1W F;  4OGU A;  2AEK A;  5ERN A;  2Z52 A;  2E92 A;  4P0W A;  1YYS A;  3ICN A;  4EA0 A;  2F94 F;  2FTZ A;  4L2X F;  4XQS F;  5IN8 A;  4H5C F;  1YJ4 A;  3APZ A;  3OAB A;  5DIQ F;  1N20 A;  5A0I A;  4LPH F;  3NPK A;  5DW7 A;  5ILH A;  3N0G A;  4OKM A;  3ZL6 A;  1WL2 A;  1WL1 A;  3SDV A;  3N49 F;  3WEF A;  4LZC A;  3WJN A;  3SAE A;  1WL3 A;  3SDU A;  3WJK A;  3ICM A;  4LTZ A;  4PVX F;  4KVW A;  3ASX A;  2PS6 A;  4NG6 A;  3M00 A;  1N1B A;  1N1Z A;  2PS8 A;  4DZW A;  1HXA A;  5A0J A;  2ZCR A;  4LXW A;  5B0I A;  3SDR A;  3PH7 A;  2E8V A;  3VJE A;  3LGZ B;  3UCA A;  3OAC B;  3RMG A;  5IL3 A;  3N0F A;  4RXA A;  4NKE A;  1DGP A;  2AEL A;  3MZV A;  3P8L A;  1FPS A;  5EAS A;  4KFA A;  2ZEU A;  3BNY A;  4P0V A;  5HNA A;  2F8C F;  3PYB A;  3ACX A;  3BNX A;  4MC0 A;  2RAH A; 
#chains in the Genus database with same CATH topology
 5C05 A;  5EAU A;  3WCI A;  1JFA A;  2QIS A;  2E94 A;  3DYG A;  3PDE A;  4JZB A;  3DYF A;  3IBA A;  4KVY A;  3ZMB A;  2DH4 A;  5AFX A;  3LGK A;  5AEL A;  3VJC A;  3WEH A;  2Z4V A;  4RYP A;  3VJ8 A;  4EA2 A;  2Z7H A;  2E95 A;  3WEK A;  4OMG A;  3KRA A;  1UBY A;  1YV5 A;  4RNQ A;  4LIX A;  5ER8 A;  5CG5 A;  4UMJ A;  3Q2Q A;  3P5R A;  3WEJ A;  2E8X A;  3S9V A;  2ONH A;  1V4I A;  1VG2 A;  3SDT A;  1JFG A;  2ONG A;  3N5J F;  1KIY A;  4QPF A;  5JA0 F;  5IK9 A;  3EFQ A;  2ZCQ A;  1YYR A;  5ILY A;  2E8U A;  3ICZ A;  2EWG A;  4LPG F;  2ZY1 A;  2P1C A;  4NFK F;  4Q23 A;  1KIZ A;  2E4O A;  4LZ3 A;  4WK5 A;  3IPI A;  3AQC B;  2E90 A;  2F9K F;  3Q2Z A;  3WJO A;  2I19 A;  2VF6 A;  2E8T A;  1HM7 A;  2PS7 A;  2Q9Z A;  2E93 A;  2J5C A;  1YYT A;  3KRC A;  4JXY A;  2AZL A;  2AET A;  3KRO A;  5DGS F;  5B0K A;  3WCC A;  1HXG A;  1RQJ A;  3WCG A;  3WCA A;  4FJQ A;  4JYX A;  5E8H A;  3WCH A;  2PS5 A;  5IMP A;  5CG6 A;  1UBX A;  1HM4 A;  5DHI A;  1N24 A;  1PS1 A;  1VG4 A;  3PKO A;  4K10 A;  2OGD A;  3ACY A;  3OAC A;  3CC9 A;  4RXD A;  4LA6 A;  2E8W A;  3N46 F;  5IKH A;  4HD1 A;  4KPJ A;  4F6V A;  3EGT A;  4N1Z F;  3LK5 A;  4KQU A;  4PVY F;  5DJR F;  1V4J A;  4LTV A;  3VJA A;  5I1U A;  3LDW A;  3KRP B;  5JV2 F;  2Q58 A;  1UBW A;  4RXC A;  3ICK A;  3TFP A;  5IMI A;  3CP6 A;  5B01 A;  1YHL A;  5DGN F;  4KUX A;  5DZ2 A;  4ZQ8 A;  3TS7 A;  4NFJ F;  3LG5 A;  4KWD A;  5A0K A;  4LZ0 A;  5B0M A;  5ILD A;  5DJP F;  2Z4X A;  1DI1 A;  1ZW5 A;  2FOR A;  2PS4 A;  5ILI A;  3WCE A;  4F62 A;  2Z4Y A;  5E8K A;  3Q1O A;  4GA3 A;  4E1E A;  3RBM A;  4LLS A;  3KRF A;  4F6X A;  2F8Z F;  1YYQ A;  3G4D A;  2O1O A;  4MC3 A;  5IMN A;  3WC9 A;  1YYU A;  2AZJ A;  4LFE A;  2Z4Z A;  5HN8 A;  4JVJ F;  1WY0 A;  5IVG A;  4LOB A;  2Q80 A;  5KSX F;  5ILJ A;  1RTR A;  2Q9Y A;  3MAV A;  3CKE A;  3WEI A;  2OPM A;  3KBK A;  3N3D A;  2ZCS A;  3ACW A;  4H5D F;  2OA6 A;  3WSA A;  4NUA A;  5B03 A;  2F89 F;  5IK6 A;  3AQB B;  3P8R A;  5ERM A;  5IKA A;  3M9U A;  3WCL A;  3WCF A;  3SDQ A;  3VJD A;  3WSB A;  5B0L A;  3LLW A;  2ZCO A;  2Z50 A;  5ILK A;  3N1V F;  4GP2 A;  2Z78 A;  3KB9 A;  4P0X A;  3M0G A;  5DJV F;  2Z4W A;  1WKZ A;  3NF2 A;  5B00 A;  1N23 A;  1WMW A;  3WE9 A;  5ILZ A;  3ADZ A;  4DWB A;  3KRC B;  4LUU A;  3B7L A;  1HX9 A;  3OAB B;  4QXS F;  3P5P A;  3LMD A;  4DXJ A;  4XQT F;  3V1V A;  4LLT A;  3OYR A;  4DEM F;  3KRO B;  4KQS A;  4KKM A;  3RYE A;  5AYP A;  3EZ3 A;  3NPR A;  5JV0 F;  5AHU B;  5B02 A;  3TFV A;  4FP4 A;  2Z7I A;  3P41 A;  5EAT A;  4E9Z A;  1YHM A;  3V1X A;  1YQ7 A;  2H8O A;  2OPN A;  5ERO A;  2J1P A;  1V4E A;  3ID0 A;  4OKZ A;  3WCM A;  3KRP A;  5IL8 A;  3N6K F;  4KVD A;  3V66 A;  2J1O A;  1N22 A;  5IK0 A;  4LFV F;  3G4F A;  3W7F A;  3NRI A;  4KVI A;  3LSN A;  4DI5 A;  3WCJ A;  3AQ0 A;  3M01 A;  4LFG A;  5HN9 A;  4N9U A;  4JXN A;  5B0J A;  1VG3 A;  1V4H A;  2F92 F;  4LA5 A;  1UBV A;  5JUZ F;  2ZEV A;  4XQR F;  4OMH A;  4NFI F;  3LOM A;  5DGM F;  1N21 A;  3QQV A;  4E9U A;  3WCD A;  4KQ5 A;  5IM1 A;  4EA1 A;  1VG6 A;  1VG7 A;  3N45 F;  3ZCD A;  4NKF A;  3LJI A;  4H5E F;  3S4J A;  1EZF A;  1RQI A;  1V4K A;  2E91 A;  4JZX A;  5HN7 A;  3LEE A;  3KRA B;  2AZK A;  4MC8 A;  3ZMC A;  5DHK A;  3LVS A;  3KRF B;  3VJB A;  3WCB A;  5H9D A;  3DYH A;  2F7M F;  1HXC A;  3N3L F;  1WL0 A;  3PYA A;  1YHK A;  4KK2 A;  4GP1 A;  3ZOU A;  4GAX A;  3RYW A;  3M02 A;  3N5H F;  4KPD A;  3AE0 A;  3TFN A;  4DHD A;  5JV1 F;  3QKC A;  4RXE A;  5E8L A;  4DWG A;  3VJ9 A;  3TC1 A;  3WEG A;  3Q30 A;  3LZ9 A;  3N1W F;  4OGU A;  2AEK A;  5ERN A;  2Z52 A;  2E92 A;  4P0W A;  1YYS A;  3ICN A;  4EA0 A;  2F94 F;  2FTZ A;  4L2X F;  4XQS F;  5IN8 A;  4H5C F;  1YJ4 A;  3APZ A;  3OAB A;  5DIQ F;  1N20 A;  5A0I A;  4LPH F;  3NPK A;  5DW7 A;  5ILH A;  3N0G A;  4OKM A;  3ZL6 A;  1WL2 A;  1WL1 A;  3SDV A;  3N49 F;  3WEF A;  4LZC A;  3WJN A;  3SAE A;  1WL3 A;  3SDU A;  3WJK A;  3ICM A;  4LTZ A;  4PVX F;  4KVW A;  3ASX A;  2PS6 A;  4NG6 A;  3M00 A;  1N1B A;  1N1Z A;  2PS8 A;  4DZW A;  1HXA A;  5A0J A;  2ZCR A;  4LXW A;  5B0I A;  3SDR A;  3PH7 A;  2E8V A;  3VJE A;  3LGZ B;  3UCA A;  3OAC B;  3RMG A;  5IL3 A;  3N0F A;  4RXA A;  4NKE A;  1DGP A;  2AEL A;  3MZV A;  3P8L A;  1FPS A;  5EAS A;  4KFA A;  2ZEU A;  3BNY A;  4P0V A;  5HNA A;  2F8C F;  3PYB A;  3ACX A;  3BNX A;  4MC0 A;  2RAH A; 
#chains in the Genus database with same CATH homology
 5C05 A;  5EAU A;  3WCI A;  1JFA A;  2QIS A;  2E94 A;  3DYG A;  3PDE A;  4JZB A;  3DYF A;  3IBA A;  4KVY A;  3ZMB A;  2DH4 A;  5AFX A;  3LGK A;  5AEL A;  3VJC A;  3WEH A;  2Z4V A;  4RYP A;  3VJ8 A;  4EA2 A;  2Z7H A;  2E95 A;  3WEK A;  4OMG A;  3KRA A;  1UBY A;  1YV5 A;  4RNQ A;  4LIX A;  5ER8 A;  5CG5 A;  4UMJ A;  3Q2Q A;  3P5R A;  3WEJ A;  2E8X A;  3S9V A;  2ONH A;  1V4I A;  1VG2 A;  3SDT A;  1JFG A;  2ONG A;  3N5J F;  1KIY A;  4QPF A;  5JA0 F;  5IK9 A;  3EFQ A;  2ZCQ A;  1YYR A;  5ILY A;  2E8U A;  3ICZ A;  2EWG A;  4LPG F;  2ZY1 A;  2P1C A;  4NFK F;  4Q23 A;  1KIZ A;  2E4O A;  4LZ3 A;  4WK5 A;  3IPI A;  3AQC B;  2E90 A;  2F9K F;  3Q2Z A;  3WJO A;  2I19 A;  2VF6 A;  2E8T A;  1HM7 A;  2PS7 A;  2Q9Z A;  2E93 A;  2J5C A;  1YYT A;  3KRC A;  4JXY A;  2AZL A;  2AET A;  3KRO A;  5DGS F;  5B0K A;  3WCC A;  1HXG A;  1RQJ A;  3WCG A;  3WCA A;  4FJQ A;  4JYX A;  5E8H A;  3WCH A;  2PS5 A;  5IMP A;  5CG6 A;  1UBX A;  1HM4 A;  5DHI A;  1N24 A;  1PS1 A;  1VG4 A;  3PKO A;  4K10 A;  2OGD A;  3ACY A;  3OAC A;  3CC9 A;  4RXD A;  4LA6 A;  2E8W A;  3N46 F;  5IKH A;  4HD1 A;  4KPJ A;  4F6V A;  3EGT A;  4N1Z F;  3LK5 A;  4KQU A;  4PVY F;  5DJR F;  1V4J A;  4LTV A;  3VJA A;  5I1U A;  3LDW A;  3KRP B;  5JV2 F;  2Q58 A;  1UBW A;  4RXC A;  3ICK A;  3TFP A;  5IMI A;  3CP6 A;  5B01 A;  1YHL A;  5DGN F;  4KUX A;  5DZ2 A;  4ZQ8 A;  3TS7 A;  4NFJ F;  3LG5 A;  4KWD A;  5A0K A;  4LZ0 A;  5B0M A;  5ILD A;  5DJP F;  2Z4X A;  1DI1 A;  1ZW5 A;  2FOR A;  2PS4 A;  5ILI A;  3WCE A;  4F62 A;  2Z4Y A;  5E8K A;  3Q1O A;  4GA3 A;  4E1E A;  3RBM A;  4LLS A;  3KRF A;  4F6X A;  2F8Z F;  1YYQ A;  3G4D A;  2O1O A;  4MC3 A;  5IMN A;  3WC9 A;  1YYU A;  2AZJ A;  4LFE A;  2Z4Z A;  5HN8 A;  4JVJ F;  1WY0 A;  5IVG A;  4LOB A;  2Q80 A;  5KSX F;  5ILJ A;  1RTR A;  2Q9Y A;  3MAV A;  3CKE A;  3WEI A;  2OPM A;  3KBK A;  3N3D A;  2ZCS A;  3ACW A;  4H5D F;  2OA6 A;  3WSA A;  4NUA A;  5B03 A;  2F89 F;  5IK6 A;  3AQB B;  3P8R A;  5ERM A;  5IKA A;  3M9U A;  3WCL A;  3WCF A;  3SDQ A;  3VJD A;  3WSB A;  5B0L A;  3LLW A;  2ZCO A;  2Z50 A;  5ILK A;  3N1V F;  4GP2 A;  2Z78 A;  3KB9 A;  4P0X A;  3M0G A;  5DJV F;  2Z4W A;  1WKZ A;  3NF2 A;  5B00 A;  1N23 A;  1WMW A;  3WE9 A;  5ILZ A;  3ADZ A;  4DWB A;  3KRC B;  4LUU A;  3B7L A;  1HX9 A;  3OAB B;  4QXS F;  3P5P A;  3LMD A;  4DXJ A;  4XQT F;  3V1V A;  4LLT A;  3OYR A;  4DEM F;  3KRO B;  4KQS A;  4KKM A;  3RYE A;  5AYP A;  3EZ3 A;  3NPR A;  5JV0 F;  5AHU B;  5B02 A;  3TFV A;  4FP4 A;  2Z7I A;  3P41 A;  5EAT A;  4E9Z A;  1YHM A;  3V1X A;  1YQ7 A;  2H8O A;  2OPN A;  5ERO A;  2J1P A;  1V4E A;  3ID0 A;  4OKZ A;  3WCM A;  3KRP A;  5IL8 A;  3N6K F;  4KVD A;  3V66 A;  2J1O A;  1N22 A;  5IK0 A;  4LFV F;  3G4F A;  3W7F A;  3NRI A;  4KVI A;  3LSN A;  4DI5 A;  3WCJ A;  3AQ0 A;  3M01 A;  4LFG A;  5HN9 A;  4N9U A;  4JXN A;  5B0J A;  1VG3 A;  1V4H A;  2F92 F;  4LA5 A;  1UBV A;  5JUZ F;  2ZEV A;  4XQR F;  4OMH A;  4NFI F;  3LOM A;  5DGM F;  1N21 A;  3QQV A;  4E9U A;  3WCD A;  4KQ5 A;  5IM1 A;  4EA1 A;  1VG6 A;  1VG7 A;  3N45 F;  3ZCD A;  4NKF A;  3LJI A;  4H5E F;  3S4J A;  1EZF A;  1RQI A;  1V4K A;  2E91 A;  4JZX A;  5HN7 A;  3LEE A;  3KRA B;  2AZK A;  4MC8 A;  3ZMC A;  5DHK A;  3LVS A;  3KRF B;  3VJB A;  3WCB A;  5H9D A;  3DYH A;  2F7M F;  1HXC A;  3N3L F;  1WL0 A;  3PYA A;  1YHK A;  4KK2 A;  4GP1 A;  3ZOU A;  4GAX A;  3RYW A;  3M02 A;  3N5H F;  4KPD A;  3AE0 A;  3TFN A;  4DHD A;  5JV1 F;  3QKC A;  4RXE A;  5E8L A;  4DWG A;  3VJ9 A;  3TC1 A;  3WEG A;  3Q30 A;  3LZ9 A;  3N1W F;  4OGU A;  2AEK A;  5ERN A;  2Z52 A;  2E92 A;  4P0W A;  1YYS A;  3ICN A;  4EA0 A;  2F94 F;  2FTZ A;  4L2X F;  4XQS F;  5IN8 A;  4H5C F;  1YJ4 A;  3APZ A;  3OAB A;  5DIQ F;  1N20 A;  5A0I A;  4LPH F;  3NPK A;  5DW7 A;  5ILH A;  3N0G A;  4OKM A;  3ZL6 A;  1WL2 A;  1WL1 A;  3SDV A;  3N49 F;  3WEF A;  4LZC A;  3WJN A;  3SAE A;  1WL3 A;  3SDU A;  3WJK A;  3ICM A;  4LTZ A;  4PVX F;  4KVW A;  3ASX A;  2PS6 A;  4NG6 A;  3M00 A;  1N1B A;  1N1Z A;  2PS8 A;  4DZW A;  1HXA A;  5A0J A;  2ZCR A;  4LXW A;  5B0I A;  3SDR A;  3PH7 A;  2E8V A;  3VJE A;  3LGZ B;  3UCA A;  3OAC B;  3RMG A;  5IL3 A;  3N0F A;  4RXA A;  4NKE A;  1DGP A;  2AEL A;  3MZV A;  3P8L A;  1FPS A;  5EAS A;  4KFA A;  2ZEU A;  3BNY A;  4P0V A;  5HNA A;  2F8C F;  3PYB A;  3ACX A;  3BNX A;  4MC0 A;  2RAH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...