2EWGA

T. brucei farnesyl diphosphate synthase complexed with minodronate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
367
structure length
367
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLSPNNNGEEDDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords farnesyl pyrophosphate synthase
publication title Solid-state NMR, crystallographic, and computational investigation of bisphosphonates and farnesyl diphosphate synthase-bisphosphonate complexes.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 134
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2005-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2ewgA00
3VJCA 3LK5A 5B0MA 3OABB 5ILHA 1V4HA 4JYXA 2OA6A 3AE0A 5IK6A 5KSXF 5A0KA 2J1PA 1PS1A 4NUAA 3EFQA 3M0GA 5H9DA 2Z4ZA 3TC1A 5B00A 4H5EF 3KRCA 5IN8A 5AHUB 1N24A 3ZOUA 3NPKA 2QISA 3BNXA 3WEKA 1WMWA 5IMNA 4NKFA 3N1VF 3KRPB 2ZCSA 3N5HF 2Z4VA 3SDRA 5A0IA 3P5RA 3NPRA 4KQ5A 1RTRA 4P0XA 3LDWA 2PS7A 3LEEA 5IMIA 5AYPA 5EATA 3N45F 4RXDA 3M02A 4KVDA 1DGPA 5IKHA 3VJAA 3N0FA 5DZ2A 2E95A 3WCAA 2E8XA 3N0GA 4E1EA 1HM7A 3IPIA 2VF6A 3SDTA 3DYHA 3G4DA 3WE9A 3P8LA 3IBAA 1HXGA 5DGNF 1KIYA 3LLWA 5A0JA 5JUZF 2J5CA 3RYWA 3TFVA 4LLTA 3UCAA 4E9UA 1UBWA 4QXSF 3P5PA 3QQVA 2E4OA 3ICKA 4KK2A 4NFJF 3RMGA 3VJ9A 4KKMA 5E8KA 4N1ZF 4QPFA 4DWBA 4F6VA 1N1BA 5AELA 1N23A 4JZXA 1N22A 4NKEA 4H5CF 3WSAA 2E94A 3ACXA 4OKMA 2F8ZF 4OKZA 2F8CF 4GP1A 1YJ4A 4RYPA 4GA3A 4PVXF 5ILDA 1HXAA 3VJDA 4LZ3A 2Z50A 1WY0A 4EA1A 1V4KA 1YYRA 3ZCDA 4P0WA 4LA5A 4XQSF 1YYUA 3ZL6A 5ILJA 3LGKA 3LOMA 3LG5A 3PYAA 4LA6A 3CC9A 1N21A 4GP2A 5ERMA 4LXWA 2DH4A 3P41A 4LZCA 3N5JF 3SDUA 4RXCA 4LTZA 5E8HA 4NG6A 3DYFA 4LZ0A 4F62A 3WEJA 5JV0F 4LPHF 2Z52A 3MAVA 4LLSA 3M01A 3ACYA 5IL3A 5DJVF 1WKZA 2ZCOA 4KPJA 4KVWA 5B0KA 3EGTA 5B0JA 4L2XF 3EZ3A 4E9ZA 3ADZA 2E8WA 4WK5A 5DJRF 3WCIA 4LUUA 4MC8A 3Q2QA 5DJPF 1WL3A 3ICZA 3KRFA 4OMHA 4LFGA 3SAEA 1N1ZA 1UBXA 2AEKA 5ILKA 4XQTF 1V4IA 3KRAA 5B01A 5C05A 3KROA 3QKCA 3LVSA 5I1UA 3WCLA 3WEFA 3ICNA 4KVYA 2E92A 4DI5A 2Z4WA 3LSNA 5IKAA 3LZ9A 3KRCB 2AZKA 3B7LA 2E90A 2FORA 5DHKA 3WCDA 4OGUA 1RQIA 2E93A 4DHDA 3SDQA 3VJ8A 3NRIA 5ILIA 5EAUA 4KWDA 1WL2A 4F6XA 2J1OA 4LOBA 3SDVA 1VG3A 4UMJA 3MZVA 2ZY1A 5IM1A 2OGDA 1EZFA 3ASXA 4JXNA 3WCJA 1WL1A 3LJIA 1ZW5A 3S4JA 5CG6A 5DGMF 1UBYA 3BNYA 3G4FA 5B03A 4KUXA 3N3DA 2ONHA 4KQUA 1VG7A 2Z78A 3AQCB 2Q58A 3WCBA 5IL8A 3RBMA 5JV2F 3PYBA 3KB9A 2Q80A 1FPSA 3CKEA 5EASA 1YHKA 5ILYA 3PDEA 1UBVA 5AFXA 1KIZA 5IMPA 4RNQA 3OACA 2E91A 2EWGA 2AELA 1V4EA 5CG5A 3ZMBA 2F94F 5JV1F 5EROA 5DIQF 1YHLA 2F89F 1VG6A 5IK9A 3TS7A 2PS6A 1YHMA 1V4JA 4LIXA 2E8UA 4JVJF 5ERNA 4FP4A 3WEGA 4H5DF 4RXAA 3CP6A 3WSBA 4FJQA 3Q2ZA 5ER8A 3TFPA 3WEIA 1YV5A 4LTVA 2Z4YA 1VG4A 4LPGF 4OMGA 4EA2A 1YQ7A 3WCEA 4GAXA 3KRPA 2ZCQA 3V1VA 2ONGA 3KBKA 4N9UA 3AQ0A 5HN8A 3ACWA 3V1XA 1DI1A 1HXCA 4RXEA 3WJNA 3OYRA 5HNAA 4KPDA 3M00A 1JFAA 4ZQ8A 4KQSA 2Q9YA 3AQBB 1YYSA 2F92F 3WCHA 5DHIA 3S9VA 3NF2A 2PS4A 3N46F 4JZBA 2AZLA 3PKOA 3WJKA 4Q23A 4DXJA 3TFNA 3ICMA 2H8OA 3LGZB 4MC0A 3ID0A 2PS8A 5IK0A 4NFIF 3WEHA 2OPNA 4K10A 2RAHA 1HM4A 3N3LF 3KRFB 2Z7IA 2Q9ZA 3PH7A 2F7MF 1JFGA 4XQRF 2FTZA 2E8VA 3WCMA 3WCGA 1WL0A 4KVIA 4P0VA 5B0IA 3KRAB 2Z7HA 3ZMCA 4DEMF 3KROB 5B0LA 2OPMA 2I19A 3N1WF 1YYTA 2P1CA 3WC9A 3WCCA 3LMDA 4PVYF 3P8RA 3N6KF 2ZEVA 3DYGA 1RQJA 4DWGA 4HD1A 4LFEA 2AETA 5HN7A 3RYEA 4EA0A 3V66A 3VJEA 5JA0F 3N49F 3W7FA 1VG2A 3Q30A 4JXYA 4DZWA 3WCFA 3OABA 4KFAA 3VJBA 5IVGA 5HN9A 2F9KF 1N20A 1YYQA 2PS5A 2E8TA 4LFVF 2Z4XA 4NFKF 5ILZA 2ZEUA 5DW7A 3M9UA 3APZA 5B02A 2ZCRA 3Q1OA 2AZJA 3OACB 5DGSF 2O1OA 4MC3A 5E8LA 3WJOA 1HX9A
chains in the Genus database with same CATH superfamily
3VJCA 3LK5A 5B0MA 3OABB 5ILHA 1V4HA 4JYXA 2OA6A 3AE0A 5IK6A 5KSXF 5A0KA 2J1PA 1PS1A 4NUAA 3EFQA 3M0GA 5H9DA 2Z4ZA 3TC1A 5B00A 4H5EF 3KRCA 5IN8A 5AHUB 1N24A 3ZOUA 3NPKA 2QISA 3BNXA 3WEKA 1WMWA 5IMNA 4NKFA 3N1VF 3KRPB 2ZCSA 3N5HF 2Z4VA 3SDRA 5A0IA 3P5RA 3NPRA 4KQ5A 1RTRA 4P0XA 3LDWA 2PS7A 3LEEA 5IMIA 5AYPA 5EATA 3N45F 4RXDA 3M02A 4KVDA 1DGPA 5IKHA 3VJAA 3N0FA 5DZ2A 2E95A 3WCAA 2E8XA 3N0GA 4E1EA 1HM7A 3IPIA 2VF6A 3SDTA 3DYHA 3G4DA 3WE9A 3P8LA 3IBAA 1HXGA 5DGNF 1KIYA 3LLWA 5A0JA 5JUZF 2J5CA 3RYWA 3TFVA 4LLTA 3UCAA 4E9UA 1UBWA 4QXSF 3P5PA 3QQVA 2E4OA 3ICKA 4KK2A 4NFJF 3RMGA 3VJ9A 4KKMA 5E8KA 4N1ZF 4QPFA 4DWBA 4F6VA 1N1BA 5AELA 1N23A 4JZXA 1N22A 4NKEA 4H5CF 3WSAA 2E94A 3ACXA 4OKMA 2F8ZF 4OKZA 2F8CF 4GP1A 1YJ4A 4RYPA 4GA3A 4PVXF 5ILDA 1HXAA 3VJDA 4LZ3A 2Z50A 1WY0A 4EA1A 1V4KA 1YYRA 3ZCDA 4P0WA 4LA5A 4XQSF 1YYUA 3ZL6A 5ILJA 3LGKA 3LOMA 3LG5A 3PYAA 4LA6A 3CC9A 1N21A 4GP2A 5ERMA 4LXWA 2DH4A 3P41A 4LZCA 3N5JF 3SDUA 4RXCA 4LTZA 5E8HA 4NG6A 3DYFA 4LZ0A 4F62A 3WEJA 5JV0F 4LPHF 2Z52A 3MAVA 4LLSA 3M01A 3ACYA 5IL3A 5DJVF 1WKZA 2ZCOA 4KPJA 4KVWA 5B0KA 3EGTA 5B0JA 4L2XF 3EZ3A 4E9ZA 3ADZA 2E8WA 4WK5A 5DJRF 3WCIA 4LUUA 4MC8A 3Q2QA 5DJPF 1WL3A 3ICZA 3KRFA 4OMHA 4LFGA 3SAEA 1N1ZA 1UBXA 2AEKA 5ILKA 4XQTF 1V4IA 3KRAA 5B01A 5C05A 3KROA 3QKCA 3LVSA 5I1UA 3WCLA 3WEFA 3ICNA 4KVYA 2E92A 4DI5A 2Z4WA 3LSNA 5IKAA 3LZ9A 3KRCB 2AZKA 3B7LA 2E90A 2FORA 5DHKA 3WCDA 4OGUA 1RQIA 2E93A 4DHDA 3SDQA 3VJ8A 3NRIA 5ILIA 5EAUA 4KWDA 1WL2A 4F6XA 2J1OA 4LOBA 3SDVA 1VG3A 4UMJA 3MZVA 2ZY1A 5IM1A 2OGDA 1EZFA 3ASXA 4JXNA 3WCJA 1WL1A 3LJIA 1ZW5A 3S4JA 5CG6A 5DGMF 1UBYA 3BNYA 3G4FA 5B03A 4KUXA 3N3DA 2ONHA 4KQUA 1VG7A 2Z78A 3AQCB 2Q58A 3WCBA 5IL8A 3RBMA 5JV2F 3PYBA 3KB9A 2Q80A 1FPSA 3CKEA 5EASA 1YHKA 5ILYA 3PDEA 1UBVA 5AFXA 1KIZA 5IMPA 4RNQA 3OACA 2E91A 2EWGA 2AELA 1V4EA 5CG5A 3ZMBA 2F94F 5JV1F 5EROA 5DIQF 1YHLA 2F89F 1VG6A 5IK9A 3TS7A 2PS6A 1YHMA 1V4JA 4LIXA 2E8UA 4JVJF 5ERNA 4FP4A 3WEGA 4H5DF 4RXAA 3CP6A 3WSBA 4FJQA 3Q2ZA 5ER8A 3TFPA 3WEIA 1YV5A 4LTVA 2Z4YA 1VG4A 4LPGF 4OMGA 4EA2A 1YQ7A 3WCEA 4GAXA 3KRPA 2ZCQA 3V1VA 2ONGA 3KBKA 4N9UA 3AQ0A 5HN8A 3ACWA 3V1XA 1DI1A 1HXCA 4RXEA 3WJNA 3OYRA 5HNAA 4KPDA 3M00A 1JFAA 4ZQ8A 4KQSA 2Q9YA 3AQBB 1YYSA 2F92F 3WCHA 5DHIA 3S9VA 3NF2A 2PS4A 3N46F 4JZBA 2AZLA 3PKOA 3WJKA 4Q23A 4DXJA 3TFNA 3ICMA 2H8OA 3LGZB 4MC0A 3ID0A 2PS8A 5IK0A 4NFIF 3WEHA 2OPNA 4K10A 2RAHA 1HM4A 3N3LF 3KRFB 2Z7IA 2Q9ZA 3PH7A 2F7MF 1JFGA 4XQRF 2FTZA 2E8VA 3WCMA 3WCGA 1WL0A 4KVIA 4P0VA 5B0IA 3KRAB 2Z7HA 3ZMCA 4DEMF 3KROB 5B0LA 2OPMA 2I19A 3N1WF 1YYTA 2P1CA 3WC9A 3WCCA 3LMDA 4PVYF 3P8RA 3N6KF 2ZEVA 3DYGA 1RQJA 4DWGA 4HD1A 4LFEA 2AETA 5HN7A 3RYEA 4EA0A 3V66A 3VJEA 5JA0F 3N49F 3W7FA 1VG2A 3Q30A 4JXYA 4DZWA 3WCFA 3OABA 4KFAA 3VJBA 5IVGA 5HN9A 2F9KF 1N20A 1YYQA 2PS5A 2E8TA 4LFVF 2Z4XA 4NFKF 5ILZA 2ZEUA 5DW7A 3M9UA 3APZA 5B02A 2ZCRA 3Q1OA 2AZJA 3OACB 5DGSF 2O1OA 4MC3A 5E8LA 3WJOA 1HX9A
chains in the Genus database with same CATH topology
3VJCA 3LK5A 5B0MA 3OABB 5ILHA 1V4HA 4JYXA 2OA6A 3AE0A 5IK6A 5KSXF 5A0KA 2J1PA 1PS1A 4NUAA 3EFQA 3M0GA 5H9DA 2Z4ZA 3TC1A 5B00A 4H5EF 3KRCA 5IN8A 5AHUB 1N24A 3ZOUA 3NPKA 2QISA 3BNXA 3WEKA 1WMWA 5IMNA 4NKFA 3N1VF 3KRPB 2ZCSA 3N5HF 2Z4VA 3SDRA 5A0IA 3P5RA 3NPRA 4KQ5A 1RTRA 4P0XA 3LDWA 2PS7A 3LEEA 5IMIA 5AYPA 5EATA 3N45F 4RXDA 3M02A 4KVDA 1DGPA 5IKHA 3VJAA 3N0FA 5DZ2A 2E95A 3WCAA 2E8XA 3N0GA 4E1EA 1HM7A 3IPIA 2VF6A 3SDTA 3DYHA 3G4DA 3WE9A 3P8LA 3IBAA 1HXGA 5DGNF 1KIYA 3LLWA 5A0JA 5JUZF 2J5CA 3RYWA 3TFVA 4LLTA 3UCAA 4E9UA 1UBWA 4QXSF 3P5PA 3QQVA 2E4OA 3ICKA 4KK2A 4NFJF 3RMGA 3VJ9A 4KKMA 5E8KA 4N1ZF 4QPFA 4DWBA 4F6VA 1N1BA 5AELA 1N23A 4JZXA 1N22A 4NKEA 4H5CF 3WSAA 2E94A 3ACXA 4OKMA 2F8ZF 4OKZA 2F8CF 4GP1A 1YJ4A 4RYPA 4GA3A 4PVXF 5ILDA 1HXAA 3VJDA 4LZ3A 2Z50A 1WY0A 4EA1A 1V4KA 1YYRA 3ZCDA 4P0WA 4LA5A 4XQSF 1YYUA 3ZL6A 5ILJA 3LGKA 3LOMA 3LG5A 3PYAA 4LA6A 3CC9A 1N21A 4GP2A 5ERMA 4LXWA 2DH4A 3P41A 4LZCA 3N5JF 3SDUA 4RXCA 4LTZA 5E8HA 4NG6A 3DYFA 4LZ0A 4F62A 3WEJA 5JV0F 4LPHF 2Z52A 3MAVA 4LLSA 3M01A 3ACYA 5IL3A 5DJVF 1WKZA 2ZCOA 4KPJA 4KVWA 5B0KA 3EGTA 5B0JA 4L2XF 3EZ3A 4E9ZA 3ADZA 2E8WA 4WK5A 5DJRF 3WCIA 4LUUA 4MC8A 3Q2QA 5DJPF 1WL3A 3ICZA 3KRFA 4OMHA 4LFGA 3SAEA 1N1ZA 1UBXA 2AEKA 5ILKA 4XQTF 1V4IA 3KRAA 5B01A 5C05A 3KROA 3QKCA 3LVSA 5I1UA 3WCLA 3WEFA 3ICNA 4KVYA 2E92A 4DI5A 2Z4WA 3LSNA 5IKAA 3LZ9A 3KRCB 2AZKA 3B7LA 2E90A 2FORA 5DHKA 3WCDA 4OGUA 1RQIA 2E93A 4DHDA 3SDQA 3VJ8A 3NRIA 5ILIA 5EAUA 4KWDA 1WL2A 4F6XA 2J1OA 4LOBA 3SDVA 1VG3A 4UMJA 3MZVA 2ZY1A 5IM1A 2OGDA 1EZFA 3ASXA 4JXNA 3WCJA 1WL1A 3LJIA 1ZW5A 3S4JA 5CG6A 5DGMF 1UBYA 3BNYA 3G4FA 5B03A 4KUXA 3N3DA 2ONHA 4KQUA 1VG7A 2Z78A 3AQCB 2Q58A 3WCBA 5IL8A 3RBMA 5JV2F 3PYBA 3KB9A 2Q80A 1FPSA 3CKEA 5EASA 1YHKA 5ILYA 3PDEA 1UBVA 5AFXA 1KIZA 5IMPA 4RNQA 3OACA 2E91A 2EWGA 2AELA 1V4EA 5CG5A 3ZMBA 2F94F 5JV1F 5EROA 5DIQF 1YHLA 2F89F 1VG6A 5IK9A 3TS7A 2PS6A 1YHMA 1V4JA 4LIXA 2E8UA 4JVJF 5ERNA 4FP4A 3WEGA 4H5DF 4RXAA 3CP6A 3WSBA 4FJQA 3Q2ZA 5ER8A 3TFPA 3WEIA 1YV5A 4LTVA 2Z4YA 1VG4A 4LPGF 4OMGA 4EA2A 1YQ7A 3WCEA 4GAXA 3KRPA 2ZCQA 3V1VA 2ONGA 3KBKA 4N9UA 3AQ0A 5HN8A 3ACWA 3V1XA 1DI1A 1HXCA 4RXEA 3WJNA 3OYRA 5HNAA 4KPDA 3M00A 1JFAA 4ZQ8A 4KQSA 2Q9YA 3AQBB 1YYSA 2F92F 3WCHA 5DHIA 3S9VA 3NF2A 2PS4A 3N46F 4JZBA 2AZLA 3PKOA 3WJKA 4Q23A 4DXJA 3TFNA 3ICMA 2H8OA 3LGZB 4MC0A 3ID0A 2PS8A 5IK0A 4NFIF 3WEHA 2OPNA 4K10A 2RAHA 1HM4A 3N3LF 3KRFB 2Z7IA 2Q9ZA 3PH7A 2F7MF 1JFGA 4XQRF 2FTZA 2E8VA 3WCMA 3WCGA 1WL0A 4KVIA 4P0VA 5B0IA 3KRAB 2Z7HA 3ZMCA 4DEMF 3KROB 5B0LA 2OPMA 2I19A 3N1WF 1YYTA 2P1CA 3WC9A 3WCCA 3LMDA 4PVYF 3P8RA 3N6KF 2ZEVA 3DYGA 1RQJA 4DWGA 4HD1A 4LFEA 2AETA 5HN7A 3RYEA 4EA0A 3V66A 3VJEA 5JA0F 3N49F 3W7FA 1VG2A 3Q30A 4JXYA 4DZWA 3WCFA 3OABA 4KFAA 3VJBA 5IVGA 5HN9A 2F9KF 1N20A 1YYQA 2PS5A 2E8TA 4LFVF 2Z4XA 4NFKF 5ILZA 2ZEUA 5DW7A 3M9UA 3APZA 5B02A 2ZCRA 3Q1OA 2AZJA 3OACB 5DGSF 2O1OA 4MC3A 5E8LA 3WJOA 1HX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VJC A;  3LK5 A;  5B0M A;  3OAB B;  5ILH A;  1V4H A;  4JYX A;  2OA6 A;  3AE0 A;  5IK6 A;  5KSX F;  5A0K A;  2J1P A;  1PS1 A;  4NUA A;  3EFQ A;  3M0G A;  5H9D A;  2Z4Z A;  3TC1 A;  5B00 A;  4H5E F;  3KRC A;  5IN8 A;  5AHU B;  1N24 A;  3ZOU A;  3NPK A;  2QIS A;  3BNX A;  3WEK A;  1WMW A;  5IMN A;  4NKF A;  3N1V F;  3KRP B;  2ZCS A;  3N5H F;  2Z4V A;  3SDR A;  5A0I A;  3P5R A;  3NPR A;  4KQ5 A;  1RTR A;  4P0X A;  3LDW A;  2PS7 A;  3LEE A;  5IMI A;  5AYP A;  5EAT A;  3N45 F;  4RXD A;  3M02 A;  4KVD A;  1DGP A;  5IKH A;  3VJA A;  3N0F A;  5DZ2 A;  2E95 A;  3WCA A;  2E8X A;  3N0G A;  4E1E A;  1HM7 A;  3IPI A;  2VF6 A;  3SDT A;  3DYH A;  3G4D A;  3WE9 A;  3P8L A;  3IBA A;  1HXG A;  5DGN F;  1KIY A;  3LLW A;  5A0J A;  5JUZ F;  2J5C A;  3RYW A;  3TFV A;  4LLT A;  3UCA A;  4E9U A;  1UBW A;  4QXS F;  3P5P A;  3QQV A;  2E4O A;  3ICK A;  4KK2 A;  4NFJ F;  3RMG A;  3VJ9 A;  4KKM A;  5E8K A;  4N1Z F;  4QPF A;  4DWB A;  4F6V A;  1N1B A;  5AEL A;  1N23 A;  4JZX A;  1N22 A;  4NKE A;  4H5C F;  3WSA A;  2E94 A;  3ACX A;  4OKM A;  2F8Z F;  4OKZ A;  2F8C F;  4GP1 A;  1YJ4 A;  4RYP A;  4GA3 A;  4PVX F;  5ILD A;  1HXA A;  3VJD A;  4LZ3 A;  2Z50 A;  1WY0 A;  4EA1 A;  1V4K A;  1YYR A;  3ZCD A;  4P0W A;  4LA5 A;  4XQS F;  1YYU A;  3ZL6 A;  5ILJ A;  3LGK A;  3LOM A;  3LG5 A;  3PYA A;  4LA6 A;  3CC9 A;  1N21 A;  4GP2 A;  5ERM A;  4LXW A;  2DH4 A;  3P41 A;  4LZC A;  3N5J F;  3SDU A;  4RXC A;  4LTZ A;  5E8H A;  4NG6 A;  3DYF A;  4LZ0 A;  4F62 A;  3WEJ A;  5JV0 F;  4LPH F;  2Z52 A;  3MAV A;  4LLS A;  3M01 A;  3ACY A;  5IL3 A;  5DJV F;  1WKZ A;  2ZCO A;  4KPJ A;  4KVW A;  5B0K A;  3EGT A;  5B0J A;  4L2X F;  3EZ3 A;  4E9Z A;  3ADZ A;  2E8W A;  4WK5 A;  5DJR F;  3WCI A;  4LUU A;  4MC8 A;  3Q2Q A;  5DJP F;  1WL3 A;  3ICZ A;  3KRF A;  4OMH A;  4LFG A;  3SAE A;  1N1Z A;  1UBX A;  2AEK A;  5ILK A;  4XQT F;  1V4I A;  3KRA A;  5B01 A;  5C05 A;  3KRO A;  3QKC A;  3LVS A;  5I1U A;  3WCL A;  3WEF A;  3ICN A;  4KVY A;  2E92 A;  4DI5 A;  2Z4W A;  3LSN A;  5IKA A;  3LZ9 A;  3KRC B;  2AZK A;  3B7L A;  2E90 A;  2FOR A;  5DHK A;  3WCD A;  4OGU A;  1RQI A;  2E93 A;  4DHD A;  3SDQ A;  3VJ8 A;  3NRI A;  5ILI A;  5EAU A;  4KWD A;  1WL2 A;  4F6X A;  2J1O A;  4LOB A;  3SDV A;  1VG3 A;  4UMJ A;  3MZV A;  2ZY1 A;  5IM1 A;  2OGD A;  1EZF A;  3ASX A;  4JXN A;  3WCJ A;  1WL1 A;  3LJI A;  1ZW5 A;  3S4J A;  5CG6 A;  5DGM F;  1UBY A;  3BNY A;  3G4F A;  5B03 A;  4KUX A;  3N3D A;  2ONH A;  4KQU A;  1VG7 A;  2Z78 A;  3AQC B;  2Q58 A;  3WCB A;  5IL8 A;  3RBM A;  5JV2 F;  3PYB A;  3KB9 A;  2Q80 A;  1FPS A;  3CKE A;  5EAS A;  1YHK A;  5ILY A;  3PDE A;  1UBV A;  5AFX A;  1KIZ A;  5IMP A;  4RNQ A;  3OAC A;  2E91 A;  2EWG A;  2AEL A;  1V4E A;  5CG5 A;  3ZMB A;  2F94 F;  5JV1 F;  5ERO A;  5DIQ F;  1YHL A;  2F89 F;  1VG6 A;  5IK9 A;  3TS7 A;  2PS6 A;  1YHM A;  1V4J A;  4LIX A;  2E8U A;  4JVJ F;  5ERN A;  4FP4 A;  3WEG A;  4H5D F;  4RXA A;  3CP6 A;  3WSB A;  4FJQ A;  3Q2Z A;  5ER8 A;  3TFP A;  3WEI A;  1YV5 A;  4LTV A;  2Z4Y A;  1VG4 A;  4LPG F;  4OMG A;  4EA2 A;  1YQ7 A;  3WCE A;  4GAX A;  3KRP A;  2ZCQ A;  3V1V A;  2ONG A;  3KBK A;  4N9U A;  3AQ0 A;  5HN8 A;  3ACW A;  3V1X A;  1DI1 A;  1HXC A;  4RXE A;  3WJN A;  3OYR A;  5HNA A;  4KPD A;  3M00 A;  1JFA A;  4ZQ8 A;  4KQS A;  2Q9Y A;  3AQB B;  1YYS A;  2F92 F;  3WCH A;  5DHI A;  3S9V A;  3NF2 A;  2PS4 A;  3N46 F;  4JZB A;  2AZL A;  3PKO A;  3WJK A;  4Q23 A;  4DXJ A;  3TFN A;  3ICM A;  2H8O A;  3LGZ B;  4MC0 A;  3ID0 A;  2PS8 A;  5IK0 A;  4NFI F;  3WEH A;  2OPN A;  4K10 A;  2RAH A;  1HM4 A;  3N3L F;  3KRF B;  2Z7I A;  2Q9Z A;  3PH7 A;  2F7M F;  1JFG A;  4XQR F;  2FTZ A;  2E8V A;  3WCM A;  3WCG A;  1WL0 A;  4KVI A;  4P0V A;  5B0I A;  3KRA B;  2Z7H A;  3ZMC A;  4DEM F;  3KRO B;  5B0L A;  2OPM A;  2I19 A;  3N1W F;  1YYT A;  2P1C A;  3WC9 A;  3WCC A;  3LMD A;  4PVY F;  3P8R A;  3N6K F;  2ZEV A;  3DYG A;  1RQJ A;  4DWG A;  4HD1 A;  4LFE A;  2AET A;  5HN7 A;  3RYE A;  4EA0 A;  3V66 A;  3VJE A;  5JA0 F;  3N49 F;  3W7F A;  1VG2 A;  3Q30 A;  4JXY A;  4DZW A;  3WCF A;  3OAB A;  4KFA A;  3VJB A;  5IVG A;  5HN9 A;  2F9K F;  1N20 A;  1YYQ A;  2PS5 A;  2E8T A;  4LFV F;  2Z4X A;  4NFK F;  5ILZ A;  2ZEU A;  5DW7 A;  3M9U A;  3APZ A;  5B02 A;  2ZCR A;  3Q1O A;  2AZJ A;  3OAC B;  5DGS F;  2O1O A;  4MC3 A;  5E8L A;  3WJO A;  1HX9 A; 
#chains in the Genus database with same CATH topology
 3VJC A;  3LK5 A;  5B0M A;  3OAB B;  5ILH A;  1V4H A;  4JYX A;  2OA6 A;  3AE0 A;  5IK6 A;  5KSX F;  5A0K A;  2J1P A;  1PS1 A;  4NUA A;  3EFQ A;  3M0G A;  5H9D A;  2Z4Z A;  3TC1 A;  5B00 A;  4H5E F;  3KRC A;  5IN8 A;  5AHU B;  1N24 A;  3ZOU A;  3NPK A;  2QIS A;  3BNX A;  3WEK A;  1WMW A;  5IMN A;  4NKF A;  3N1V F;  3KRP B;  2ZCS A;  3N5H F;  2Z4V A;  3SDR A;  5A0I A;  3P5R A;  3NPR A;  4KQ5 A;  1RTR A;  4P0X A;  3LDW A;  2PS7 A;  3LEE A;  5IMI A;  5AYP A;  5EAT A;  3N45 F;  4RXD A;  3M02 A;  4KVD A;  1DGP A;  5IKH A;  3VJA A;  3N0F A;  5DZ2 A;  2E95 A;  3WCA A;  2E8X A;  3N0G A;  4E1E A;  1HM7 A;  3IPI A;  2VF6 A;  3SDT A;  3DYH A;  3G4D A;  3WE9 A;  3P8L A;  3IBA A;  1HXG A;  5DGN F;  1KIY A;  3LLW A;  5A0J A;  5JUZ F;  2J5C A;  3RYW A;  3TFV A;  4LLT A;  3UCA A;  4E9U A;  1UBW A;  4QXS F;  3P5P A;  3QQV A;  2E4O A;  3ICK A;  4KK2 A;  4NFJ F;  3RMG A;  3VJ9 A;  4KKM A;  5E8K A;  4N1Z F;  4QPF A;  4DWB A;  4F6V A;  1N1B A;  5AEL A;  1N23 A;  4JZX A;  1N22 A;  4NKE A;  4H5C F;  3WSA A;  2E94 A;  3ACX A;  4OKM A;  2F8Z F;  4OKZ A;  2F8C F;  4GP1 A;  1YJ4 A;  4RYP A;  4GA3 A;  4PVX F;  5ILD A;  1HXA A;  3VJD A;  4LZ3 A;  2Z50 A;  1WY0 A;  4EA1 A;  1V4K A;  1YYR A;  3ZCD A;  4P0W A;  4LA5 A;  4XQS F;  1YYU A;  3ZL6 A;  5ILJ A;  3LGK A;  3LOM A;  3LG5 A;  3PYA A;  4LA6 A;  3CC9 A;  1N21 A;  4GP2 A;  5ERM A;  4LXW A;  2DH4 A;  3P41 A;  4LZC A;  3N5J F;  3SDU A;  4RXC A;  4LTZ A;  5E8H A;  4NG6 A;  3DYF A;  4LZ0 A;  4F62 A;  3WEJ A;  5JV0 F;  4LPH F;  2Z52 A;  3MAV A;  4LLS A;  3M01 A;  3ACY A;  5IL3 A;  5DJV F;  1WKZ A;  2ZCO A;  4KPJ A;  4KVW A;  5B0K A;  3EGT A;  5B0J A;  4L2X F;  3EZ3 A;  4E9Z A;  3ADZ A;  2E8W A;  4WK5 A;  5DJR F;  3WCI A;  4LUU A;  4MC8 A;  3Q2Q A;  5DJP F;  1WL3 A;  3ICZ A;  3KRF A;  4OMH A;  4LFG A;  3SAE A;  1N1Z A;  1UBX A;  2AEK A;  5ILK A;  4XQT F;  1V4I A;  3KRA A;  5B01 A;  5C05 A;  3KRO A;  3QKC A;  3LVS A;  5I1U A;  3WCL A;  3WEF A;  3ICN A;  4KVY A;  2E92 A;  4DI5 A;  2Z4W A;  3LSN A;  5IKA A;  3LZ9 A;  3KRC B;  2AZK A;  3B7L A;  2E90 A;  2FOR A;  5DHK A;  3WCD A;  4OGU A;  1RQI A;  2E93 A;  4DHD A;  3SDQ A;  3VJ8 A;  3NRI A;  5ILI A;  5EAU A;  4KWD A;  1WL2 A;  4F6X A;  2J1O A;  4LOB A;  3SDV A;  1VG3 A;  4UMJ A;  3MZV A;  2ZY1 A;  5IM1 A;  2OGD A;  1EZF A;  3ASX A;  4JXN A;  3WCJ A;  1WL1 A;  3LJI A;  1ZW5 A;  3S4J A;  5CG6 A;  5DGM F;  1UBY A;  3BNY A;  3G4F A;  5B03 A;  4KUX A;  3N3D A;  2ONH A;  4KQU A;  1VG7 A;  2Z78 A;  3AQC B;  2Q58 A;  3WCB A;  5IL8 A;  3RBM A;  5JV2 F;  3PYB A;  3KB9 A;  2Q80 A;  1FPS A;  3CKE A;  5EAS A;  1YHK A;  5ILY A;  3PDE A;  1UBV A;  5AFX A;  1KIZ A;  5IMP A;  4RNQ A;  3OAC A;  2E91 A;  2EWG A;  2AEL A;  1V4E A;  5CG5 A;  3ZMB A;  2F94 F;  5JV1 F;  5ERO A;  5DIQ F;  1YHL A;  2F89 F;  1VG6 A;  5IK9 A;  3TS7 A;  2PS6 A;  1YHM A;  1V4J A;  4LIX A;  2E8U A;  4JVJ F;  5ERN A;  4FP4 A;  3WEG A;  4H5D F;  4RXA A;  3CP6 A;  3WSB A;  4FJQ A;  3Q2Z A;  5ER8 A;  3TFP A;  3WEI A;  1YV5 A;  4LTV A;  2Z4Y A;  1VG4 A;  4LPG F;  4OMG A;  4EA2 A;  1YQ7 A;  3WCE A;  4GAX A;  3KRP A;  2ZCQ A;  3V1V A;  2ONG A;  3KBK A;  4N9U A;  3AQ0 A;  5HN8 A;  3ACW A;  3V1X A;  1DI1 A;  1HXC A;  4RXE A;  3WJN A;  3OYR A;  5HNA A;  4KPD A;  3M00 A;  1JFA A;  4ZQ8 A;  4KQS A;  2Q9Y A;  3AQB B;  1YYS A;  2F92 F;  3WCH A;  5DHI A;  3S9V A;  3NF2 A;  2PS4 A;  3N46 F;  4JZB A;  2AZL A;  3PKO A;  3WJK A;  4Q23 A;  4DXJ A;  3TFN A;  3ICM A;  2H8O A;  3LGZ B;  4MC0 A;  3ID0 A;  2PS8 A;  5IK0 A;  4NFI F;  3WEH A;  2OPN A;  4K10 A;  2RAH A;  1HM4 A;  3N3L F;  3KRF B;  2Z7I A;  2Q9Z A;  3PH7 A;  2F7M F;  1JFG A;  4XQR F;  2FTZ A;  2E8V A;  3WCM A;  3WCG A;  1WL0 A;  4KVI A;  4P0V A;  5B0I A;  3KRA B;  2Z7H A;  3ZMC A;  4DEM F;  3KRO B;  5B0L A;  2OPM A;  2I19 A;  3N1W F;  1YYT A;  2P1C A;  3WC9 A;  3WCC A;  3LMD A;  4PVY F;  3P8R A;  3N6K F;  2ZEV A;  3DYG A;  1RQJ A;  4DWG A;  4HD1 A;  4LFE A;  2AET A;  5HN7 A;  3RYE A;  4EA0 A;  3V66 A;  3VJE A;  5JA0 F;  3N49 F;  3W7F A;  1VG2 A;  3Q30 A;  4JXY A;  4DZW A;  3WCF A;  3OAB A;  4KFA A;  3VJB A;  5IVG A;  5HN9 A;  2F9K F;  1N20 A;  1YYQ A;  2PS5 A;  2E8T A;  4LFV F;  2Z4X A;  4NFK F;  5ILZ A;  2ZEU A;  5DW7 A;  3M9U A;  3APZ A;  5B02 A;  2ZCR A;  3Q1O A;  2AZJ A;  3OAC B;  5DGS F;  2O1O A;  4MC3 A;  5E8L A;  3WJO A;  1HX9 A; 
#chains in the Genus database with same CATH homology
 3VJC A;  3LK5 A;  5B0M A;  3OAB B;  5ILH A;  1V4H A;  4JYX A;  2OA6 A;  3AE0 A;  5IK6 A;  5KSX F;  5A0K A;  2J1P A;  1PS1 A;  4NUA A;  3EFQ A;  3M0G A;  5H9D A;  2Z4Z A;  3TC1 A;  5B00 A;  4H5E F;  3KRC A;  5IN8 A;  5AHU B;  1N24 A;  3ZOU A;  3NPK A;  2QIS A;  3BNX A;  3WEK A;  1WMW A;  5IMN A;  4NKF A;  3N1V F;  3KRP B;  2ZCS A;  3N5H F;  2Z4V A;  3SDR A;  5A0I A;  3P5R A;  3NPR A;  4KQ5 A;  1RTR A;  4P0X A;  3LDW A;  2PS7 A;  3LEE A;  5IMI A;  5AYP A;  5EAT A;  3N45 F;  4RXD A;  3M02 A;  4KVD A;  1DGP A;  5IKH A;  3VJA A;  3N0F A;  5DZ2 A;  2E95 A;  3WCA A;  2E8X A;  3N0G A;  4E1E A;  1HM7 A;  3IPI A;  2VF6 A;  3SDT A;  3DYH A;  3G4D A;  3WE9 A;  3P8L A;  3IBA A;  1HXG A;  5DGN F;  1KIY A;  3LLW A;  5A0J A;  5JUZ F;  2J5C A;  3RYW A;  3TFV A;  4LLT A;  3UCA A;  4E9U A;  1UBW A;  4QXS F;  3P5P A;  3QQV A;  2E4O A;  3ICK A;  4KK2 A;  4NFJ F;  3RMG A;  3VJ9 A;  4KKM A;  5E8K A;  4N1Z F;  4QPF A;  4DWB A;  4F6V A;  1N1B A;  5AEL A;  1N23 A;  4JZX A;  1N22 A;  4NKE A;  4H5C F;  3WSA A;  2E94 A;  3ACX A;  4OKM A;  2F8Z F;  4OKZ A;  2F8C F;  4GP1 A;  1YJ4 A;  4RYP A;  4GA3 A;  4PVX F;  5ILD A;  1HXA A;  3VJD A;  4LZ3 A;  2Z50 A;  1WY0 A;  4EA1 A;  1V4K A;  1YYR A;  3ZCD A;  4P0W A;  4LA5 A;  4XQS F;  1YYU A;  3ZL6 A;  5ILJ A;  3LGK A;  3LOM A;  3LG5 A;  3PYA A;  4LA6 A;  3CC9 A;  1N21 A;  4GP2 A;  5ERM A;  4LXW A;  2DH4 A;  3P41 A;  4LZC A;  3N5J F;  3SDU A;  4RXC A;  4LTZ A;  5E8H A;  4NG6 A;  3DYF A;  4LZ0 A;  4F62 A;  3WEJ A;  5JV0 F;  4LPH F;  2Z52 A;  3MAV A;  4LLS A;  3M01 A;  3ACY A;  5IL3 A;  5DJV F;  1WKZ A;  2ZCO A;  4KPJ A;  4KVW A;  5B0K A;  3EGT A;  5B0J A;  4L2X F;  3EZ3 A;  4E9Z A;  3ADZ A;  2E8W A;  4WK5 A;  5DJR F;  3WCI A;  4LUU A;  4MC8 A;  3Q2Q A;  5DJP F;  1WL3 A;  3ICZ A;  3KRF A;  4OMH A;  4LFG A;  3SAE A;  1N1Z A;  1UBX A;  2AEK A;  5ILK A;  4XQT F;  1V4I A;  3KRA A;  5B01 A;  5C05 A;  3KRO A;  3QKC A;  3LVS A;  5I1U A;  3WCL A;  3WEF A;  3ICN A;  4KVY A;  2E92 A;  4DI5 A;  2Z4W A;  3LSN A;  5IKA A;  3LZ9 A;  3KRC B;  2AZK A;  3B7L A;  2E90 A;  2FOR A;  5DHK A;  3WCD A;  4OGU A;  1RQI A;  2E93 A;  4DHD A;  3SDQ A;  3VJ8 A;  3NRI A;  5ILI A;  5EAU A;  4KWD A;  1WL2 A;  4F6X A;  2J1O A;  4LOB A;  3SDV A;  1VG3 A;  4UMJ A;  3MZV A;  2ZY1 A;  5IM1 A;  2OGD A;  1EZF A;  3ASX A;  4JXN A;  3WCJ A;  1WL1 A;  3LJI A;  1ZW5 A;  3S4J A;  5CG6 A;  5DGM F;  1UBY A;  3BNY A;  3G4F A;  5B03 A;  4KUX A;  3N3D A;  2ONH A;  4KQU A;  1VG7 A;  2Z78 A;  3AQC B;  2Q58 A;  3WCB A;  5IL8 A;  3RBM A;  5JV2 F;  3PYB A;  3KB9 A;  2Q80 A;  1FPS A;  3CKE A;  5EAS A;  1YHK A;  5ILY A;  3PDE A;  1UBV A;  5AFX A;  1KIZ A;  5IMP A;  4RNQ A;  3OAC A;  2E91 A;  2EWG A;  2AEL A;  1V4E A;  5CG5 A;  3ZMB A;  2F94 F;  5JV1 F;  5ERO A;  5DIQ F;  1YHL A;  2F89 F;  1VG6 A;  5IK9 A;  3TS7 A;  2PS6 A;  1YHM A;  1V4J A;  4LIX A;  2E8U A;  4JVJ F;  5ERN A;  4FP4 A;  3WEG A;  4H5D F;  4RXA A;  3CP6 A;  3WSB A;  4FJQ A;  3Q2Z A;  5ER8 A;  3TFP A;  3WEI A;  1YV5 A;  4LTV A;  2Z4Y A;  1VG4 A;  4LPG F;  4OMG A;  4EA2 A;  1YQ7 A;  3WCE A;  4GAX A;  3KRP A;  2ZCQ A;  3V1V A;  2ONG A;  3KBK A;  4N9U A;  3AQ0 A;  5HN8 A;  3ACW A;  3V1X A;  1DI1 A;  1HXC A;  4RXE A;  3WJN A;  3OYR A;  5HNA A;  4KPD A;  3M00 A;  1JFA A;  4ZQ8 A;  4KQS A;  2Q9Y A;  3AQB B;  1YYS A;  2F92 F;  3WCH A;  5DHI A;  3S9V A;  3NF2 A;  2PS4 A;  3N46 F;  4JZB A;  2AZL A;  3PKO A;  3WJK A;  4Q23 A;  4DXJ A;  3TFN A;  3ICM A;  2H8O A;  3LGZ B;  4MC0 A;  3ID0 A;  2PS8 A;  5IK0 A;  4NFI F;  3WEH A;  2OPN A;  4K10 A;  2RAH A;  1HM4 A;  3N3L F;  3KRF B;  2Z7I A;  2Q9Z A;  3PH7 A;  2F7M F;  1JFG A;  4XQR F;  2FTZ A;  2E8V A;  3WCM A;  3WCG A;  1WL0 A;  4KVI A;  4P0V A;  5B0I A;  3KRA B;  2Z7H A;  3ZMC A;  4DEM F;  3KRO B;  5B0L A;  2OPM A;  2I19 A;  3N1W F;  1YYT A;  2P1C A;  3WC9 A;  3WCC A;  3LMD A;  4PVY F;  3P8R A;  3N6K F;  2ZEV A;  3DYG A;  1RQJ A;  4DWG A;  4HD1 A;  4LFE A;  2AET A;  5HN7 A;  3RYE A;  4EA0 A;  3V66 A;  3VJE A;  5JA0 F;  3N49 F;  3W7F A;  1VG2 A;  3Q30 A;  4JXY A;  4DZW A;  3WCF A;  3OAB A;  4KFA A;  3VJB A;  5IVG A;  5HN9 A;  2F9K F;  1N20 A;  1YYQ A;  2PS5 A;  2E8T A;  4LFV F;  2Z4X A;  4NFK F;  5ILZ A;  2ZEU A;  5DW7 A;  3M9U A;  3APZ A;  5B02 A;  2ZCR A;  3Q1O A;  2AZJ A;  3OAC B;  5DGS F;  2O1O A;  4MC3 A;  5E8L A;  3WJO A;  1HX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...