2EWGA

T. brucei farnesyl diphosphate synthase complexed with minodronate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
367
structure length
367
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLSPNNNGEEDDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords farnesyl pyrophosphate synthase
publication title Solid-state NMR, crystallographic, and computational investigation of bisphosphonates and farnesyl diphosphate synthase-bisphosphonate complexes.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 134
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2005-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2ewgA00
4DI5A 5HN8A 2PS6A 3WSBA 5H9DA 4F6XA 4XQTF 2OPNA 3TFPA 3SDUA 1N23A 5E8KA 5EATA 3BNXA 3LGZB 5C05A 3MZVA 3WCDA 1UBVA 3RYEA 5IKAA 1VG3A 3WEGA 3ZL6A 3VJCA 5HN7A 1KIZA 3EGTA 5DJVF 4XQSF 2OGDA 3N46F 1YYSA 4LIXA 5B02A 3OACB 4EA1A 5IM1A 1RTRA 3EFQA 3N0FA 3OABB 3WCFA 3SDVA 1UBYA 3BNYA 1YYUA 4LTVA 5AELA 3PYAA 5DGMF 4LZ0A 4LZ3A 1VG7A 3WCEA 2E8XA 4LLSA 4JZBA 4LOBA 4KWDA 3ACXA 5DGSF 2J5CA 2EWGA 3LZ9A 5IVGA 2E8TA 3LEEA 4GP1A 2Q80A 3IBAA 1WY0A 5ERMA 3NPKA 3WCHA 5IK0A 3Q30A 3WCBA 2VF6A 3QQVA 2ONHA 4DEMF 3KRPB 3DYFA 1DI1A 3IPIA 5KSXF 3NRIA 3LGKA 3KBKA 2F8CF 3WEJA 2PS5A 3VJAA 4ZQ8A 2FTZA 4LZCA 2QISA 2Q9ZA 1ZW5A 2OPMA 5IN8A 3LMDA 2Z7IA 5DJPF 3N3LF 3ID0A 2J1OA 2DH4A 5JUZF 4H5CF 3WCIA 2ZY1A 1UBWA 3Q2QA 3ACWA 1WL1A 4KVWA 4EA2A 2FORA 1YYRA 4LFVF 3M0GA 3KRCA 4KVDA 2F7MF 5A0IA 3M02A 4RXDA 4NFIF 1V4KA 4QPFA 2E92A 2E91A 3WSAA 5JA0F 3RMGA 5IKHA 4KPDA 2Z4WA 2F8ZF 1JFGA 2ZCSA 2E8VA 3P8LA 1WL3A 3ZOUA 4KKMA 3NPRA 5IL8A 2Z52A 3TFVA 3N0GA 4OKZA 5ILZA 1HM7A 2E4OA 3WCGA 3SAEA 1HX9A 3KROA 2AZJA 5B00A 5DZ2A 4LPHF 4LA5A 2Z4YA 3G4DA 4H5EF 4NKFA 4P0VA 3VJEA 3AQ0A 5B0KA 2P1CA 3AQBB 4OGUA 4XQRF 3ICMA 2Z4VA 4DWBA 1YHMA 2J1PA 4EA0A 4KQSA 3WEFA 3ADZA 3QKCA 2Z4XA 5AFXA 3N5HF 4NG6A 1VG2A 4JXNA 3TFNA 3LLWA 3S9VA 3TS7A 3VJ9A 2F92F 4KQ5A 4GAXA 3P5PA 4NFJF 2E93A 3VJ8A 3V1XA 4L2XF 3WEKA 4RNQA 5CG6A 5DGNF 4UMJA 4GA3A 3DYGA 5HNAA 3KRAA 3LG5A 1YYQA 2I19A 3ICZA 4F62A 5JV1F 5E8LA 3WJOA 5DHKA 5ILYA 2F9KF 3ZMBA 1FPSA 5ILJA 3ICNA 3VJBA 3KRCB 2OA6A 3MAVA 4MC0A 1HXCA 5JV2F 4MC8A 5JV0F 1N21A 5IK6A 4KFAA 5B0MA 1WMWA 1V4HA 5B03A 4P0WA 5AYPA 4GP2A 4DZWA 2ZEVA 4Q23A 4K10A 4PVYF 1V4IA 1WL0A 3OYRA 2E8WA 5EASA 3VJDA 1WKZA 4DXJA 3WJKA 3P5RA 3N3DA 4PVXF 3KROB 4DHDA 3LOMA 3WCAA 3PH7A 3M9UA 4OKMA 1JFAA 1YJ4A 3N6KF 2AZKA 3M00A 3UCAA 3LVSA 4RXAA 4JVJF 1YYTA 4QXSF 3WEIA 3ZMCA 4P0XA 1YHKA 3RBMA 4WK5A 3LSNA 3AQCB 4DWGA 1N22A 3EZ3A 4JZXA 4KPJA 3LJIA 3WE9A 5CG5A 3B7LA 5ERNA 2Z7HA 3WEHA 5ILKA 5EAUA 3WJNA 5DW7A 3APZA 5IMNA 4NUAA 1V4JA 3KB9A 3KRFA 4OMGA 4E1EA 3KRAB 4KQUA 3Q1OA 5ILHA 1RQJA 2O1OA 3DYHA 2ZCOA 5A0KA 3WC9A 3SDQA 1YHLA 2E94A 3M01A 5IK9A 1N20A 5I1UA 3N1WF 3WCCA 3P41A 4LFGA 3CP6A 1HXGA 2Q9YA 4HD1A 1N1BA 3WCLA 3ACYA 4KVYA 1RQIA 3PKOA 3SDTA 5ILIA 4FP4A 4E9UA 3P8RA 4NKEA 2F94F 3TC1A 5B0IA 5ER8A 2AETA 3CKEA 3N1VF 3WCMA 3SDRA 4FJQA 2ZCQA 5E8HA 3Q2ZA 4N1ZF 3N45F 4JYXA 4LA6A 5EROA 3ZCDA 4RXEA 2AEKA 1YV5A 1EZFA 2ZEUA 3OACA 1HXAA 3V66A 2Z78A 5IMPA 3RYWA 2Z4ZA 4RYPA 3OABA 4MC3A 1N24A 3N49F 3ICKA 5IL3A 3W7FA 2Q58A 5B01A 5ILDA 2E90A 4OMHA 3WCJA 4RXCA 2E8UA 5DJRF 4N9UA 3N5JF 5A0JA 1UBXA 1VG6A 5DIQF 2RAHA 1V4EA 1DGPA 5IMIA 2AZLA 3NF2A 4LTZA 4H5DF 2ONGA 4KK2A 2H8OA 5B0LA 2PS7A 4LXWA 2ZCRA 3KRFB 3LDWA 1YQ7A 3V1VA 4F6VA 3CC9A 4NFKF 2PS4A 5DHIA 1KIYA 4LUUA 4KVIA 5AHUB 4KUXA 1WL2A 3S4JA 3LK5A 1N1ZA 1PS1A 3KRPA 1VG4A 1HM4A 4LPGF 4E9ZA 5HN9A 5B0JA 3PYBA 2PS8A 2AELA 3ASXA 4LFEA 3PDEA 3AE0A 2E95A 4JXYA 4LLTA 3G4FA 2Z50A 2F89F
chains in the Genus database with same CATH superfamily
4DI5A 5HN8A 2PS6A 3WSBA 5H9DA 4F6XA 4XQTF 2OPNA 3TFPA 3SDUA 1N23A 5E8KA 5EATA 3BNXA 3LGZB 5C05A 3MZVA 3WCDA 1UBVA 3RYEA 5IKAA 1VG3A 3WEGA 3ZL6A 3VJCA 5HN7A 1KIZA 3EGTA 5DJVF 4XQSF 2OGDA 3N46F 1YYSA 4LIXA 5B02A 3OACB 4EA1A 5IM1A 1RTRA 3EFQA 3N0FA 3OABB 3WCFA 3SDVA 1UBYA 3BNYA 1YYUA 4LTVA 5AELA 3PYAA 5DGMF 4LZ0A 4LZ3A 1VG7A 3WCEA 2E8XA 4LLSA 4JZBA 4LOBA 4KWDA 3ACXA 5DGSF 2J5CA 2EWGA 3LZ9A 5IVGA 2E8TA 3LEEA 4GP1A 2Q80A 3IBAA 1WY0A 5ERMA 3NPKA 3WCHA 5IK0A 3Q30A 3WCBA 2VF6A 3QQVA 2ONHA 4DEMF 3KRPB 3DYFA 1DI1A 3IPIA 5KSXF 3NRIA 3LGKA 3KBKA 2F8CF 3WEJA 2PS5A 3VJAA 4ZQ8A 2FTZA 4LZCA 2QISA 2Q9ZA 1ZW5A 2OPMA 5IN8A 3LMDA 2Z7IA 5DJPF 3N3LF 3ID0A 2J1OA 2DH4A 5JUZF 4H5CF 3WCIA 2ZY1A 1UBWA 3Q2QA 3ACWA 1WL1A 4KVWA 4EA2A 2FORA 1YYRA 4LFVF 3M0GA 3KRCA 4KVDA 2F7MF 5A0IA 3M02A 4RXDA 4NFIF 1V4KA 4QPFA 2E92A 2E91A 3WSAA 5JA0F 3RMGA 5IKHA 4KPDA 2Z4WA 2F8ZF 1JFGA 2ZCSA 2E8VA 3P8LA 1WL3A 3ZOUA 4KKMA 3NPRA 5IL8A 2Z52A 3TFVA 3N0GA 4OKZA 5ILZA 1HM7A 2E4OA 3WCGA 3SAEA 1HX9A 3KROA 2AZJA 5B00A 5DZ2A 4LPHF 4LA5A 2Z4YA 3G4DA 4H5EF 4NKFA 4P0VA 3VJEA 3AQ0A 5B0KA 2P1CA 3AQBB 4OGUA 4XQRF 3ICMA 2Z4VA 4DWBA 1YHMA 2J1PA 4EA0A 4KQSA 3WEFA 3ADZA 3QKCA 2Z4XA 5AFXA 3N5HF 4NG6A 1VG2A 4JXNA 3TFNA 3LLWA 3S9VA 3TS7A 3VJ9A 2F92F 4KQ5A 4GAXA 3P5PA 4NFJF 2E93A 3VJ8A 3V1XA 4L2XF 3WEKA 4RNQA 5CG6A 5DGNF 4UMJA 4GA3A 3DYGA 5HNAA 3KRAA 3LG5A 1YYQA 2I19A 3ICZA 4F62A 5JV1F 5E8LA 3WJOA 5DHKA 5ILYA 2F9KF 3ZMBA 1FPSA 5ILJA 3ICNA 3VJBA 3KRCB 2OA6A 3MAVA 4MC0A 1HXCA 5JV2F 4MC8A 5JV0F 1N21A 5IK6A 4KFAA 5B0MA 1WMWA 1V4HA 5B03A 4P0WA 5AYPA 4GP2A 4DZWA 2ZEVA 4Q23A 4K10A 4PVYF 1V4IA 1WL0A 3OYRA 2E8WA 5EASA 3VJDA 1WKZA 4DXJA 3WJKA 3P5RA 3N3DA 4PVXF 3KROB 4DHDA 3LOMA 3WCAA 3PH7A 3M9UA 4OKMA 1JFAA 1YJ4A 3N6KF 2AZKA 3M00A 3UCAA 3LVSA 4RXAA 4JVJF 1YYTA 4QXSF 3WEIA 3ZMCA 4P0XA 1YHKA 3RBMA 4WK5A 3LSNA 3AQCB 4DWGA 1N22A 3EZ3A 4JZXA 4KPJA 3LJIA 3WE9A 5CG5A 3B7LA 5ERNA 2Z7HA 3WEHA 5ILKA 5EAUA 3WJNA 5DW7A 3APZA 5IMNA 4NUAA 1V4JA 3KB9A 3KRFA 4OMGA 4E1EA 3KRAB 4KQUA 3Q1OA 5ILHA 1RQJA 2O1OA 3DYHA 2ZCOA 5A0KA 3WC9A 3SDQA 1YHLA 2E94A 3M01A 5IK9A 1N20A 5I1UA 3N1WF 3WCCA 3P41A 4LFGA 3CP6A 1HXGA 2Q9YA 4HD1A 1N1BA 3WCLA 3ACYA 4KVYA 1RQIA 3PKOA 3SDTA 5ILIA 4FP4A 4E9UA 3P8RA 4NKEA 2F94F 3TC1A 5B0IA 5ER8A 2AETA 3CKEA 3N1VF 3WCMA 3SDRA 4FJQA 2ZCQA 5E8HA 3Q2ZA 4N1ZF 3N45F 4JYXA 4LA6A 5EROA 3ZCDA 4RXEA 2AEKA 1YV5A 1EZFA 2ZEUA 3OACA 1HXAA 3V66A 2Z78A 5IMPA 3RYWA 2Z4ZA 4RYPA 3OABA 4MC3A 1N24A 3N49F 3ICKA 5IL3A 3W7FA 2Q58A 5B01A 5ILDA 2E90A 4OMHA 3WCJA 4RXCA 2E8UA 5DJRF 4N9UA 3N5JF 5A0JA 1UBXA 1VG6A 5DIQF 2RAHA 1V4EA 1DGPA 5IMIA 2AZLA 3NF2A 4LTZA 4H5DF 2ONGA 4KK2A 2H8OA 5B0LA 2PS7A 4LXWA 2ZCRA 3KRFB 3LDWA 1YQ7A 3V1VA 4F6VA 3CC9A 4NFKF 2PS4A 5DHIA 1KIYA 4LUUA 4KVIA 5AHUB 4KUXA 1WL2A 3S4JA 3LK5A 1N1ZA 1PS1A 3KRPA 1VG4A 1HM4A 4LPGF 4E9ZA 5HN9A 5B0JA 3PYBA 2PS8A 2AELA 3ASXA 4LFEA 3PDEA 3AE0A 2E95A 4JXYA 4LLTA 3G4FA 2Z50A 2F89F
chains in the Genus database with same CATH topology
4DI5A 5HN8A 2PS6A 3WSBA 5H9DA 4F6XA 4XQTF 2OPNA 3TFPA 3SDUA 1N23A 5E8KA 5EATA 3BNXA 3LGZB 5C05A 3MZVA 3WCDA 1UBVA 3RYEA 5IKAA 1VG3A 3WEGA 3ZL6A 3VJCA 5HN7A 1KIZA 3EGTA 5DJVF 4XQSF 2OGDA 3N46F 1YYSA 4LIXA 5B02A 3OACB 4EA1A 5IM1A 1RTRA 3EFQA 3N0FA 3OABB 3WCFA 3SDVA 1UBYA 3BNYA 1YYUA 4LTVA 5AELA 3PYAA 5DGMF 4LZ0A 4LZ3A 1VG7A 3WCEA 2E8XA 4LLSA 4JZBA 4LOBA 4KWDA 3ACXA 5DGSF 2J5CA 2EWGA 3LZ9A 5IVGA 2E8TA 3LEEA 4GP1A 2Q80A 3IBAA 1WY0A 5ERMA 3NPKA 3WCHA 5IK0A 3Q30A 3WCBA 2VF6A 3QQVA 2ONHA 4DEMF 3KRPB 3DYFA 1DI1A 3IPIA 5KSXF 3NRIA 3LGKA 3KBKA 2F8CF 3WEJA 2PS5A 3VJAA 4ZQ8A 2FTZA 4LZCA 2QISA 2Q9ZA 1ZW5A 2OPMA 5IN8A 3LMDA 2Z7IA 5DJPF 3N3LF 3ID0A 2J1OA 2DH4A 5JUZF 4H5CF 3WCIA 2ZY1A 1UBWA 3Q2QA 3ACWA 1WL1A 4KVWA 4EA2A 2FORA 1YYRA 4LFVF 3M0GA 3KRCA 4KVDA 2F7MF 5A0IA 3M02A 4RXDA 4NFIF 1V4KA 4QPFA 2E92A 2E91A 3WSAA 5JA0F 3RMGA 5IKHA 4KPDA 2Z4WA 2F8ZF 1JFGA 2ZCSA 2E8VA 3P8LA 1WL3A 3ZOUA 4KKMA 3NPRA 5IL8A 2Z52A 3TFVA 3N0GA 4OKZA 5ILZA 1HM7A 2E4OA 3WCGA 3SAEA 1HX9A 3KROA 2AZJA 5B00A 5DZ2A 4LPHF 4LA5A 2Z4YA 3G4DA 4H5EF 4NKFA 4P0VA 3VJEA 3AQ0A 5B0KA 2P1CA 3AQBB 4OGUA 4XQRF 3ICMA 2Z4VA 4DWBA 1YHMA 2J1PA 4EA0A 4KQSA 3WEFA 3ADZA 3QKCA 2Z4XA 5AFXA 3N5HF 4NG6A 1VG2A 4JXNA 3TFNA 3LLWA 3S9VA 3TS7A 3VJ9A 2F92F 4KQ5A 4GAXA 3P5PA 4NFJF 2E93A 3VJ8A 3V1XA 4L2XF 3WEKA 4RNQA 5CG6A 5DGNF 4UMJA 4GA3A 3DYGA 5HNAA 3KRAA 3LG5A 1YYQA 2I19A 3ICZA 4F62A 5JV1F 5E8LA 3WJOA 5DHKA 5ILYA 2F9KF 3ZMBA 1FPSA 5ILJA 3ICNA 3VJBA 3KRCB 2OA6A 3MAVA 4MC0A 1HXCA 5JV2F 4MC8A 5JV0F 1N21A 5IK6A 4KFAA 5B0MA 1WMWA 1V4HA 5B03A 4P0WA 5AYPA 4GP2A 4DZWA 2ZEVA 4Q23A 4K10A 4PVYF 1V4IA 1WL0A 3OYRA 2E8WA 5EASA 3VJDA 1WKZA 4DXJA 3WJKA 3P5RA 3N3DA 4PVXF 3KROB 4DHDA 3LOMA 3WCAA 3PH7A 3M9UA 4OKMA 1JFAA 1YJ4A 3N6KF 2AZKA 3M00A 3UCAA 3LVSA 4RXAA 4JVJF 1YYTA 4QXSF 3WEIA 3ZMCA 4P0XA 1YHKA 3RBMA 4WK5A 3LSNA 3AQCB 4DWGA 1N22A 3EZ3A 4JZXA 4KPJA 3LJIA 3WE9A 5CG5A 3B7LA 5ERNA 2Z7HA 3WEHA 5ILKA 5EAUA 3WJNA 5DW7A 3APZA 5IMNA 4NUAA 1V4JA 3KB9A 3KRFA 4OMGA 4E1EA 3KRAB 4KQUA 3Q1OA 5ILHA 1RQJA 2O1OA 3DYHA 2ZCOA 5A0KA 3WC9A 3SDQA 1YHLA 2E94A 3M01A 5IK9A 1N20A 5I1UA 3N1WF 3WCCA 3P41A 4LFGA 3CP6A 1HXGA 2Q9YA 4HD1A 1N1BA 3WCLA 3ACYA 4KVYA 1RQIA 3PKOA 3SDTA 5ILIA 4FP4A 4E9UA 3P8RA 4NKEA 2F94F 3TC1A 5B0IA 5ER8A 2AETA 3CKEA 3N1VF 3WCMA 3SDRA 4FJQA 2ZCQA 5E8HA 3Q2ZA 4N1ZF 3N45F 4JYXA 4LA6A 5EROA 3ZCDA 4RXEA 2AEKA 1YV5A 1EZFA 2ZEUA 3OACA 1HXAA 3V66A 2Z78A 5IMPA 3RYWA 2Z4ZA 4RYPA 3OABA 4MC3A 1N24A 3N49F 3ICKA 5IL3A 3W7FA 2Q58A 5B01A 5ILDA 2E90A 4OMHA 3WCJA 4RXCA 2E8UA 5DJRF 4N9UA 3N5JF 5A0JA 1UBXA 1VG6A 5DIQF 2RAHA 1V4EA 1DGPA 5IMIA 2AZLA 3NF2A 4LTZA 4H5DF 2ONGA 4KK2A 2H8OA 5B0LA 2PS7A 4LXWA 2ZCRA 3KRFB 3LDWA 1YQ7A 3V1VA 4F6VA 3CC9A 4NFKF 2PS4A 5DHIA 1KIYA 4LUUA 4KVIA 5AHUB 4KUXA 1WL2A 3S4JA 3LK5A 1N1ZA 1PS1A 3KRPA 1VG4A 1HM4A 4LPGF 4E9ZA 5HN9A 5B0JA 3PYBA 2PS8A 2AELA 3ASXA 4LFEA 3PDEA 3AE0A 2E95A 4JXYA 4LLTA 3G4FA 2Z50A 2F89F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI5 A;  5HN8 A;  2PS6 A;  3WSB A;  5H9D A;  4F6X A;  4XQT F;  2OPN A;  3TFP A;  3SDU A;  1N23 A;  5E8K A;  5EAT A;  3BNX A;  3LGZ B;  5C05 A;  3MZV A;  3WCD A;  1UBV A;  3RYE A;  5IKA A;  1VG3 A;  3WEG A;  3ZL6 A;  3VJC A;  5HN7 A;  1KIZ A;  3EGT A;  5DJV F;  4XQS F;  2OGD A;  3N46 F;  1YYS A;  4LIX A;  5B02 A;  3OAC B;  4EA1 A;  5IM1 A;  1RTR A;  3EFQ A;  3N0F A;  3OAB B;  3WCF A;  3SDV A;  1UBY A;  3BNY A;  1YYU A;  4LTV A;  5AEL A;  3PYA A;  5DGM F;  4LZ0 A;  4LZ3 A;  1VG7 A;  3WCE A;  2E8X A;  4LLS A;  4JZB A;  4LOB A;  4KWD A;  3ACX A;  5DGS F;  2J5C A;  2EWG A;  3LZ9 A;  5IVG A;  2E8T A;  3LEE A;  4GP1 A;  2Q80 A;  3IBA A;  1WY0 A;  5ERM A;  3NPK A;  3WCH A;  5IK0 A;  3Q30 A;  3WCB A;  2VF6 A;  3QQV A;  2ONH A;  4DEM F;  3KRP B;  3DYF A;  1DI1 A;  3IPI A;  5KSX F;  3NRI A;  3LGK A;  3KBK A;  2F8C F;  3WEJ A;  2PS5 A;  3VJA A;  4ZQ8 A;  2FTZ A;  4LZC A;  2QIS A;  2Q9Z A;  1ZW5 A;  2OPM A;  5IN8 A;  3LMD A;  2Z7I A;  5DJP F;  3N3L F;  3ID0 A;  2J1O A;  2DH4 A;  5JUZ F;  4H5C F;  3WCI A;  2ZY1 A;  1UBW A;  3Q2Q A;  3ACW A;  1WL1 A;  4KVW A;  4EA2 A;  2FOR A;  1YYR A;  4LFV F;  3M0G A;  3KRC A;  4KVD A;  2F7M F;  5A0I A;  3M02 A;  4RXD A;  4NFI F;  1V4K A;  4QPF A;  2E92 A;  2E91 A;  3WSA A;  5JA0 F;  3RMG A;  5IKH A;  4KPD A;  2Z4W A;  2F8Z F;  1JFG A;  2ZCS A;  2E8V A;  3P8L A;  1WL3 A;  3ZOU A;  4KKM A;  3NPR A;  5IL8 A;  2Z52 A;  3TFV A;  3N0G A;  4OKZ A;  5ILZ A;  1HM7 A;  2E4O A;  3WCG A;  3SAE A;  1HX9 A;  3KRO A;  2AZJ A;  5B00 A;  5DZ2 A;  4LPH F;  4LA5 A;  2Z4Y A;  3G4D A;  4H5E F;  4NKF A;  4P0V A;  3VJE A;  3AQ0 A;  5B0K A;  2P1C A;  3AQB B;  4OGU A;  4XQR F;  3ICM A;  2Z4V A;  4DWB A;  1YHM A;  2J1P A;  4EA0 A;  4KQS A;  3WEF A;  3ADZ A;  3QKC A;  2Z4X A;  5AFX A;  3N5H F;  4NG6 A;  1VG2 A;  4JXN A;  3TFN A;  3LLW A;  3S9V A;  3TS7 A;  3VJ9 A;  2F92 F;  4KQ5 A;  4GAX A;  3P5P A;  4NFJ F;  2E93 A;  3VJ8 A;  3V1X A;  4L2X F;  3WEK A;  4RNQ A;  5CG6 A;  5DGN F;  4UMJ A;  4GA3 A;  3DYG A;  5HNA A;  3KRA A;  3LG5 A;  1YYQ A;  2I19 A;  3ICZ A;  4F62 A;  5JV1 F;  5E8L A;  3WJO A;  5DHK A;  5ILY A;  2F9K F;  3ZMB A;  1FPS A;  5ILJ A;  3ICN A;  3VJB A;  3KRC B;  2OA6 A;  3MAV A;  4MC0 A;  1HXC A;  5JV2 F;  4MC8 A;  5JV0 F;  1N21 A;  5IK6 A;  4KFA A;  5B0M A;  1WMW A;  1V4H A;  5B03 A;  4P0W A;  5AYP A;  4GP2 A;  4DZW A;  2ZEV A;  4Q23 A;  4K10 A;  4PVY F;  1V4I A;  1WL0 A;  3OYR A;  2E8W A;  5EAS A;  3VJD A;  1WKZ A;  4DXJ A;  3WJK A;  3P5R A;  3N3D A;  4PVX F;  3KRO B;  4DHD A;  3LOM A;  3WCA A;  3PH7 A;  3M9U A;  4OKM A;  1JFA A;  1YJ4 A;  3N6K F;  2AZK A;  3M00 A;  3UCA A;  3LVS A;  4RXA A;  4JVJ F;  1YYT A;  4QXS F;  3WEI A;  3ZMC A;  4P0X A;  1YHK A;  3RBM A;  4WK5 A;  3LSN A;  3AQC B;  4DWG A;  1N22 A;  3EZ3 A;  4JZX A;  4KPJ A;  3LJI A;  3WE9 A;  5CG5 A;  3B7L A;  5ERN A;  2Z7H A;  3WEH A;  5ILK A;  5EAU A;  3WJN A;  5DW7 A;  3APZ A;  5IMN A;  4NUA A;  1V4J A;  3KB9 A;  3KRF A;  4OMG A;  4E1E A;  3KRA B;  4KQU A;  3Q1O A;  5ILH A;  1RQJ A;  2O1O A;  3DYH A;  2ZCO A;  5A0K A;  3WC9 A;  3SDQ A;  1YHL A;  2E94 A;  3M01 A;  5IK9 A;  1N20 A;  5I1U A;  3N1W F;  3WCC A;  3P41 A;  4LFG A;  3CP6 A;  1HXG A;  2Q9Y A;  4HD1 A;  1N1B A;  3WCL A;  3ACY A;  4KVY A;  1RQI A;  3PKO A;  3SDT A;  5ILI A;  4FP4 A;  4E9U A;  3P8R A;  4NKE A;  2F94 F;  3TC1 A;  5B0I A;  5ER8 A;  2AET A;  3CKE A;  3N1V F;  3WCM A;  3SDR A;  4FJQ A;  2ZCQ A;  5E8H A;  3Q2Z A;  4N1Z F;  3N45 F;  4JYX A;  4LA6 A;  5ERO A;  3ZCD A;  4RXE A;  2AEK A;  1YV5 A;  1EZF A;  2ZEU A;  3OAC A;  1HXA A;  3V66 A;  2Z78 A;  5IMP A;  3RYW A;  2Z4Z A;  4RYP A;  3OAB A;  4MC3 A;  1N24 A;  3N49 F;  3ICK A;  5IL3 A;  3W7F A;  2Q58 A;  5B01 A;  5ILD A;  2E90 A;  4OMH A;  3WCJ A;  4RXC A;  2E8U A;  5DJR F;  4N9U A;  3N5J F;  5A0J A;  1UBX A;  1VG6 A;  5DIQ F;  2RAH A;  1V4E A;  1DGP A;  5IMI A;  2AZL A;  3NF2 A;  4LTZ A;  4H5D F;  2ONG A;  4KK2 A;  2H8O A;  5B0L A;  2PS7 A;  4LXW A;  2ZCR A;  3KRF B;  3LDW A;  1YQ7 A;  3V1V A;  4F6V A;  3CC9 A;  4NFK F;  2PS4 A;  5DHI A;  1KIY A;  4LUU A;  4KVI A;  5AHU B;  4KUX A;  1WL2 A;  3S4J A;  3LK5 A;  1N1Z A;  1PS1 A;  3KRP A;  1VG4 A;  1HM4 A;  4LPG F;  4E9Z A;  5HN9 A;  5B0J A;  3PYB A;  2PS8 A;  2AEL A;  3ASX A;  4LFE A;  3PDE A;  3AE0 A;  2E95 A;  4JXY A;  4LLT A;  3G4F A;  2Z50 A;  2F89 F; 
#chains in the Genus database with same CATH topology
 4DI5 A;  5HN8 A;  2PS6 A;  3WSB A;  5H9D A;  4F6X A;  4XQT F;  2OPN A;  3TFP A;  3SDU A;  1N23 A;  5E8K A;  5EAT A;  3BNX A;  3LGZ B;  5C05 A;  3MZV A;  3WCD A;  1UBV A;  3RYE A;  5IKA A;  1VG3 A;  3WEG A;  3ZL6 A;  3VJC A;  5HN7 A;  1KIZ A;  3EGT A;  5DJV F;  4XQS F;  2OGD A;  3N46 F;  1YYS A;  4LIX A;  5B02 A;  3OAC B;  4EA1 A;  5IM1 A;  1RTR A;  3EFQ A;  3N0F A;  3OAB B;  3WCF A;  3SDV A;  1UBY A;  3BNY A;  1YYU A;  4LTV A;  5AEL A;  3PYA A;  5DGM F;  4LZ0 A;  4LZ3 A;  1VG7 A;  3WCE A;  2E8X A;  4LLS A;  4JZB A;  4LOB A;  4KWD A;  3ACX A;  5DGS F;  2J5C A;  2EWG A;  3LZ9 A;  5IVG A;  2E8T A;  3LEE A;  4GP1 A;  2Q80 A;  3IBA A;  1WY0 A;  5ERM A;  3NPK A;  3WCH A;  5IK0 A;  3Q30 A;  3WCB A;  2VF6 A;  3QQV A;  2ONH A;  4DEM F;  3KRP B;  3DYF A;  1DI1 A;  3IPI A;  5KSX F;  3NRI A;  3LGK A;  3KBK A;  2F8C F;  3WEJ A;  2PS5 A;  3VJA A;  4ZQ8 A;  2FTZ A;  4LZC A;  2QIS A;  2Q9Z A;  1ZW5 A;  2OPM A;  5IN8 A;  3LMD A;  2Z7I A;  5DJP F;  3N3L F;  3ID0 A;  2J1O A;  2DH4 A;  5JUZ F;  4H5C F;  3WCI A;  2ZY1 A;  1UBW A;  3Q2Q A;  3ACW A;  1WL1 A;  4KVW A;  4EA2 A;  2FOR A;  1YYR A;  4LFV F;  3M0G A;  3KRC A;  4KVD A;  2F7M F;  5A0I A;  3M02 A;  4RXD A;  4NFI F;  1V4K A;  4QPF A;  2E92 A;  2E91 A;  3WSA A;  5JA0 F;  3RMG A;  5IKH A;  4KPD A;  2Z4W A;  2F8Z F;  1JFG A;  2ZCS A;  2E8V A;  3P8L A;  1WL3 A;  3ZOU A;  4KKM A;  3NPR A;  5IL8 A;  2Z52 A;  3TFV A;  3N0G A;  4OKZ A;  5ILZ A;  1HM7 A;  2E4O A;  3WCG A;  3SAE A;  1HX9 A;  3KRO A;  2AZJ A;  5B00 A;  5DZ2 A;  4LPH F;  4LA5 A;  2Z4Y A;  3G4D A;  4H5E F;  4NKF A;  4P0V A;  3VJE A;  3AQ0 A;  5B0K A;  2P1C A;  3AQB B;  4OGU A;  4XQR F;  3ICM A;  2Z4V A;  4DWB A;  1YHM A;  2J1P A;  4EA0 A;  4KQS A;  3WEF A;  3ADZ A;  3QKC A;  2Z4X A;  5AFX A;  3N5H F;  4NG6 A;  1VG2 A;  4JXN A;  3TFN A;  3LLW A;  3S9V A;  3TS7 A;  3VJ9 A;  2F92 F;  4KQ5 A;  4GAX A;  3P5P A;  4NFJ F;  2E93 A;  3VJ8 A;  3V1X A;  4L2X F;  3WEK A;  4RNQ A;  5CG6 A;  5DGN F;  4UMJ A;  4GA3 A;  3DYG A;  5HNA A;  3KRA A;  3LG5 A;  1YYQ A;  2I19 A;  3ICZ A;  4F62 A;  5JV1 F;  5E8L A;  3WJO A;  5DHK A;  5ILY A;  2F9K F;  3ZMB A;  1FPS A;  5ILJ A;  3ICN A;  3VJB A;  3KRC B;  2OA6 A;  3MAV A;  4MC0 A;  1HXC A;  5JV2 F;  4MC8 A;  5JV0 F;  1N21 A;  5IK6 A;  4KFA A;  5B0M A;  1WMW A;  1V4H A;  5B03 A;  4P0W A;  5AYP A;  4GP2 A;  4DZW A;  2ZEV A;  4Q23 A;  4K10 A;  4PVY F;  1V4I A;  1WL0 A;  3OYR A;  2E8W A;  5EAS A;  3VJD A;  1WKZ A;  4DXJ A;  3WJK A;  3P5R A;  3N3D A;  4PVX F;  3KRO B;  4DHD A;  3LOM A;  3WCA A;  3PH7 A;  3M9U A;  4OKM A;  1JFA A;  1YJ4 A;  3N6K F;  2AZK A;  3M00 A;  3UCA A;  3LVS A;  4RXA A;  4JVJ F;  1YYT A;  4QXS F;  3WEI A;  3ZMC A;  4P0X A;  1YHK A;  3RBM A;  4WK5 A;  3LSN A;  3AQC B;  4DWG A;  1N22 A;  3EZ3 A;  4JZX A;  4KPJ A;  3LJI A;  3WE9 A;  5CG5 A;  3B7L A;  5ERN A;  2Z7H A;  3WEH A;  5ILK A;  5EAU A;  3WJN A;  5DW7 A;  3APZ A;  5IMN A;  4NUA A;  1V4J A;  3KB9 A;  3KRF A;  4OMG A;  4E1E A;  3KRA B;  4KQU A;  3Q1O A;  5ILH A;  1RQJ A;  2O1O A;  3DYH A;  2ZCO A;  5A0K A;  3WC9 A;  3SDQ A;  1YHL A;  2E94 A;  3M01 A;  5IK9 A;  1N20 A;  5I1U A;  3N1W F;  3WCC A;  3P41 A;  4LFG A;  3CP6 A;  1HXG A;  2Q9Y A;  4HD1 A;  1N1B A;  3WCL A;  3ACY A;  4KVY A;  1RQI A;  3PKO A;  3SDT A;  5ILI A;  4FP4 A;  4E9U A;  3P8R A;  4NKE A;  2F94 F;  3TC1 A;  5B0I A;  5ER8 A;  2AET A;  3CKE A;  3N1V F;  3WCM A;  3SDR A;  4FJQ A;  2ZCQ A;  5E8H A;  3Q2Z A;  4N1Z F;  3N45 F;  4JYX A;  4LA6 A;  5ERO A;  3ZCD A;  4RXE A;  2AEK A;  1YV5 A;  1EZF A;  2ZEU A;  3OAC A;  1HXA A;  3V66 A;  2Z78 A;  5IMP A;  3RYW A;  2Z4Z A;  4RYP A;  3OAB A;  4MC3 A;  1N24 A;  3N49 F;  3ICK A;  5IL3 A;  3W7F A;  2Q58 A;  5B01 A;  5ILD A;  2E90 A;  4OMH A;  3WCJ A;  4RXC A;  2E8U A;  5DJR F;  4N9U A;  3N5J F;  5A0J A;  1UBX A;  1VG6 A;  5DIQ F;  2RAH A;  1V4E A;  1DGP A;  5IMI A;  2AZL A;  3NF2 A;  4LTZ A;  4H5D F;  2ONG A;  4KK2 A;  2H8O A;  5B0L A;  2PS7 A;  4LXW A;  2ZCR A;  3KRF B;  3LDW A;  1YQ7 A;  3V1V A;  4F6V A;  3CC9 A;  4NFK F;  2PS4 A;  5DHI A;  1KIY A;  4LUU A;  4KVI A;  5AHU B;  4KUX A;  1WL2 A;  3S4J A;  3LK5 A;  1N1Z A;  1PS1 A;  3KRP A;  1VG4 A;  1HM4 A;  4LPG F;  4E9Z A;  5HN9 A;  5B0J A;  3PYB A;  2PS8 A;  2AEL A;  3ASX A;  4LFE A;  3PDE A;  3AE0 A;  2E95 A;  4JXY A;  4LLT A;  3G4F A;  2Z50 A;  2F89 F; 
#chains in the Genus database with same CATH homology
 4DI5 A;  5HN8 A;  2PS6 A;  3WSB A;  5H9D A;  4F6X A;  4XQT F;  2OPN A;  3TFP A;  3SDU A;  1N23 A;  5E8K A;  5EAT A;  3BNX A;  3LGZ B;  5C05 A;  3MZV A;  3WCD A;  1UBV A;  3RYE A;  5IKA A;  1VG3 A;  3WEG A;  3ZL6 A;  3VJC A;  5HN7 A;  1KIZ A;  3EGT A;  5DJV F;  4XQS F;  2OGD A;  3N46 F;  1YYS A;  4LIX A;  5B02 A;  3OAC B;  4EA1 A;  5IM1 A;  1RTR A;  3EFQ A;  3N0F A;  3OAB B;  3WCF A;  3SDV A;  1UBY A;  3BNY A;  1YYU A;  4LTV A;  5AEL A;  3PYA A;  5DGM F;  4LZ0 A;  4LZ3 A;  1VG7 A;  3WCE A;  2E8X A;  4LLS A;  4JZB A;  4LOB A;  4KWD A;  3ACX A;  5DGS F;  2J5C A;  2EWG A;  3LZ9 A;  5IVG A;  2E8T A;  3LEE A;  4GP1 A;  2Q80 A;  3IBA A;  1WY0 A;  5ERM A;  3NPK A;  3WCH A;  5IK0 A;  3Q30 A;  3WCB A;  2VF6 A;  3QQV A;  2ONH A;  4DEM F;  3KRP B;  3DYF A;  1DI1 A;  3IPI A;  5KSX F;  3NRI A;  3LGK A;  3KBK A;  2F8C F;  3WEJ A;  2PS5 A;  3VJA A;  4ZQ8 A;  2FTZ A;  4LZC A;  2QIS A;  2Q9Z A;  1ZW5 A;  2OPM A;  5IN8 A;  3LMD A;  2Z7I A;  5DJP F;  3N3L F;  3ID0 A;  2J1O A;  2DH4 A;  5JUZ F;  4H5C F;  3WCI A;  2ZY1 A;  1UBW A;  3Q2Q A;  3ACW A;  1WL1 A;  4KVW A;  4EA2 A;  2FOR A;  1YYR A;  4LFV F;  3M0G A;  3KRC A;  4KVD A;  2F7M F;  5A0I A;  3M02 A;  4RXD A;  4NFI F;  1V4K A;  4QPF A;  2E92 A;  2E91 A;  3WSA A;  5JA0 F;  3RMG A;  5IKH A;  4KPD A;  2Z4W A;  2F8Z F;  1JFG A;  2ZCS A;  2E8V A;  3P8L A;  1WL3 A;  3ZOU A;  4KKM A;  3NPR A;  5IL8 A;  2Z52 A;  3TFV A;  3N0G A;  4OKZ A;  5ILZ A;  1HM7 A;  2E4O A;  3WCG A;  3SAE A;  1HX9 A;  3KRO A;  2AZJ A;  5B00 A;  5DZ2 A;  4LPH F;  4LA5 A;  2Z4Y A;  3G4D A;  4H5E F;  4NKF A;  4P0V A;  3VJE A;  3AQ0 A;  5B0K A;  2P1C A;  3AQB B;  4OGU A;  4XQR F;  3ICM A;  2Z4V A;  4DWB A;  1YHM A;  2J1P A;  4EA0 A;  4KQS A;  3WEF A;  3ADZ A;  3QKC A;  2Z4X A;  5AFX A;  3N5H F;  4NG6 A;  1VG2 A;  4JXN A;  3TFN A;  3LLW A;  3S9V A;  3TS7 A;  3VJ9 A;  2F92 F;  4KQ5 A;  4GAX A;  3P5P A;  4NFJ F;  2E93 A;  3VJ8 A;  3V1X A;  4L2X F;  3WEK A;  4RNQ A;  5CG6 A;  5DGN F;  4UMJ A;  4GA3 A;  3DYG A;  5HNA A;  3KRA A;  3LG5 A;  1YYQ A;  2I19 A;  3ICZ A;  4F62 A;  5JV1 F;  5E8L A;  3WJO A;  5DHK A;  5ILY A;  2F9K F;  3ZMB A;  1FPS A;  5ILJ A;  3ICN A;  3VJB A;  3KRC B;  2OA6 A;  3MAV A;  4MC0 A;  1HXC A;  5JV2 F;  4MC8 A;  5JV0 F;  1N21 A;  5IK6 A;  4KFA A;  5B0M A;  1WMW A;  1V4H A;  5B03 A;  4P0W A;  5AYP A;  4GP2 A;  4DZW A;  2ZEV A;  4Q23 A;  4K10 A;  4PVY F;  1V4I A;  1WL0 A;  3OYR A;  2E8W A;  5EAS A;  3VJD A;  1WKZ A;  4DXJ A;  3WJK A;  3P5R A;  3N3D A;  4PVX F;  3KRO B;  4DHD A;  3LOM A;  3WCA A;  3PH7 A;  3M9U A;  4OKM A;  1JFA A;  1YJ4 A;  3N6K F;  2AZK A;  3M00 A;  3UCA A;  3LVS A;  4RXA A;  4JVJ F;  1YYT A;  4QXS F;  3WEI A;  3ZMC A;  4P0X A;  1YHK A;  3RBM A;  4WK5 A;  3LSN A;  3AQC B;  4DWG A;  1N22 A;  3EZ3 A;  4JZX A;  4KPJ A;  3LJI A;  3WE9 A;  5CG5 A;  3B7L A;  5ERN A;  2Z7H A;  3WEH A;  5ILK A;  5EAU A;  3WJN A;  5DW7 A;  3APZ A;  5IMN A;  4NUA A;  1V4J A;  3KB9 A;  3KRF A;  4OMG A;  4E1E A;  3KRA B;  4KQU A;  3Q1O A;  5ILH A;  1RQJ A;  2O1O A;  3DYH A;  2ZCO A;  5A0K A;  3WC9 A;  3SDQ A;  1YHL A;  2E94 A;  3M01 A;  5IK9 A;  1N20 A;  5I1U A;  3N1W F;  3WCC A;  3P41 A;  4LFG A;  3CP6 A;  1HXG A;  2Q9Y A;  4HD1 A;  1N1B A;  3WCL A;  3ACY A;  4KVY A;  1RQI A;  3PKO A;  3SDT A;  5ILI A;  4FP4 A;  4E9U A;  3P8R A;  4NKE A;  2F94 F;  3TC1 A;  5B0I A;  5ER8 A;  2AET A;  3CKE A;  3N1V F;  3WCM A;  3SDR A;  4FJQ A;  2ZCQ A;  5E8H A;  3Q2Z A;  4N1Z F;  3N45 F;  4JYX A;  4LA6 A;  5ERO A;  3ZCD A;  4RXE A;  2AEK A;  1YV5 A;  1EZF A;  2ZEU A;  3OAC A;  1HXA A;  3V66 A;  2Z78 A;  5IMP A;  3RYW A;  2Z4Z A;  4RYP A;  3OAB A;  4MC3 A;  1N24 A;  3N49 F;  3ICK A;  5IL3 A;  3W7F A;  2Q58 A;  5B01 A;  5ILD A;  2E90 A;  4OMH A;  3WCJ A;  4RXC A;  2E8U A;  5DJR F;  4N9U A;  3N5J F;  5A0J A;  1UBX A;  1VG6 A;  5DIQ F;  2RAH A;  1V4E A;  1DGP A;  5IMI A;  2AZL A;  3NF2 A;  4LTZ A;  4H5D F;  2ONG A;  4KK2 A;  2H8O A;  5B0L A;  2PS7 A;  4LXW A;  2ZCR A;  3KRF B;  3LDW A;  1YQ7 A;  3V1V A;  4F6V A;  3CC9 A;  4NFK F;  2PS4 A;  5DHI A;  1KIY A;  4LUU A;  4KVI A;  5AHU B;  4KUX A;  1WL2 A;  3S4J A;  3LK5 A;  1N1Z A;  1PS1 A;  3KRP A;  1VG4 A;  1HM4 A;  4LPG F;  4E9Z A;  5HN9 A;  5B0J A;  3PYB A;  2PS8 A;  2AEL A;  3ASX A;  4LFE A;  3PDE A;  3AE0 A;  2E95 A;  4JXY A;  4LLT A;  3G4F A;  2Z50 A;  2F89 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...