3BNYA

Crystal structure of aristolochene synthase complexed with 2-fluorofarnesyl diphosphate (2f-fpp)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
305
structure length
294
Chain Sequence
SLEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYLCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aristolochene synthase
publication title X-ray Crystallographic Studies of Substrate Binding to Aristolochene Synthase Suggest a Metal Ion Binding Sequence for Catalysis
pubmed doi rcsb
source organism Aspergillus terreus
molecule tags Lyase
total genus 122
structure length 294
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2007-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3bnyA00
2F89F 4KVWA 2Z50A 1WL0A 1RQJA 5IK0A 5HN9A 4QXSF 1YYTA 2AETA 3WJOA 5DZ2A 2F8CF 3KRFA 1YYQA 2E92A 3AQCB 3WJNA 5IL3A 3LGZB 3WCEA 2AELA 4P0WA 4KQUA 2Z78A 3KRCA 1RTRA 1HXAA 1VG3A 3BNYA 4OKMA 3Q1OA 1UBVA 4LLTA 2E8UA 4H5CF 5E8HA 1V4IA 4FJQA 3ZL6A 3N0GA 4RYPA 1YHMA 3G4FA 3LDWA 1WKZA 5ILDA 1WL1A 5EASA 3ICMA 4NFIF 3SDUA 3Q2ZA 2Z4XA 3DYHA 3N3DA 4E9ZA 3KRPA 5IKHA 4FP4A 4QPFA 5A0IA 1HXCA 4N1ZF 3CKEA 5IMPA 3ZMCA 2Z4YA 3KROA 1V4EA 3PH7A 3TFNA 3KBKA 3P5RA 5DJVF 3CP6A 5B00A 2Z52A 3RYWA 5KSXF 3VJ9A 1WL3A 2J1OA 2PS6A 3P8RA 4ZQ8A 5B01A 2P1CA 1KIZA 4KWDA 3IPIA 5CG6A 3PKOA 4L2XF 3N1VF 2PS7A 1WMWA 5ILZA 3N45F 3N1WF 3KRAA 1EZFA 3ID0A 3WCIA 1JFAA 1WY0A 5B0LA 3LJIA 4OMHA 4OGUA 4DI5A 3ZOUA 1YYSA 2AZJA 4NFKF 3SDRA 5ILYA 2J1PA 3OABA 5JV2F 3TFPA 5DGNF 3TC1A 5ER8A 3ADZA 4P0XA 3VJEA 2PS5A 3RYEA 4F6VA 4PVXF 3N5JF 5B0MA 3RMGA 1VG7A 4H5DF 4GA3A 2RAHA 3SDQA 3LSNA 5HNAA 3LVSA 4KUXA 3LMDA 5IK6A 4GP1A 4JXNA 4KVYA 5IN8A 4RXEA 4NFJF 5IVGA 3OYRA 3LEEA 1N22A 2AZKA 2ZCOA 3WEKA 3WCFA 5C05A 4DZWA 4DWGA 1N21A 2E4OA 5B0KA 2F7MF 1V4KA 4GP2A 3EZ3A 1N1ZA 2ZCSA 3MAVA 2OGDA 2Z4ZA 3WCCA 3ICZA 1YYUA 4LPGF 2ZEVA 2Q9ZA 2FORA 5E8KA 5ERNA 3TFVA 4WK5A 5DGSF 5IL8A 1VG2A 5JUZF 4E1EA 2E8TA 4LA6A 2EWGA 5ERMA 3WCDA 3WEGA 2AEKA 2E94A 2ZY1A 4RXAA 3WCAA 2Q80A 1UBXA 2ZCQA 3EGTA 3B7LA 3NRIA 3ICNA 2J5CA 1HXGA 2Q9YA 3PYBA 1YV5A 3WSAA 3LZ9A 4F62A 2F9KF 3ASXA 5DHKA 5B03A 5I1UA 1YJ4A 2I19A 5IKAA 5HN8A 1JFGA 2ZCRA 5IMNA 1YHKA 5ILIA 4KFAA 3APZA 2VF6A 3DYGA 2OPMA 4XQSF 1V4JA 5ILJA 3NF2A 5EATA 3LK5A 4KK2A 4JZBA 1DI1A 2O1OA 3UCAA 5A0JA 3ZCDA 4DXJA 5ILHA 3WCBA 3KRFB 4DHDA 3WCMA 4LZ0A 4KPJA 3VJCA 3WCLA 2FTZA 5DIQF 5IMIA 3WSBA 3OACB 3WEJA 3WEIA 5JV1F 3WCHA 2E93A 4LOBA 4KPDA 4KQ5A 4LA5A 3PYAA 5JA0F 4MC8A 3WC9A 5E8LA 3WEFA 4LFGA 5DW7A 3LGKA 3M9UA 4MC0A 5B0JA 2E95A 1ZW5A 1HM7A 1V4HA 3ACXA 2E90A 3SAEA 4Q23A 4LLSA 3WEHA 3P5PA 4K10A 4NUAA 3KRPB 3TS7A 5B02A 4E9UA 3WJKA 4GAXA 5AHUB 3PDEA 5AYPA 1UBYA 5EROA 4JZXA 3P41A 3AQ0A 2Z4VA 4XQRF 4LPHF 4OKZA 4KVDA 1YYRA 1N1BA 5DGMF 2Z4WA 2E8VA 3ZMBA 2Z7HA 4LZCA 2F8ZF 3SDTA 3LOMA 4DWBA 4LXWA 3RBMA 3N5HF 3N0FA 2E91A 3VJDA 4KVIA 2F92F 3OACA 5ILKA 3KRAB 3ACYA 3BNXA 3IBAA 4RNQA 4H5EF 3AE0A 2OA6A 5DJRF 3M0GA 1HM4A 5H9DA 4UMJA 4P0VA 3SDVA 4JVJF 1VG4A 3M00A 3G4DA 1PS1A 3LLWA 3WCGA 4N9UA 3OABB 5IK9A 1FPSA 2H8OA 3V1VA 4LFVF 3V66A 4MC3A 5AELA 3Q2QA 5JV0F 4XQTF 4NKFA 3S4JA 2PS8A 5A0KA 3MZVA 4LIXA 3N46F 2QISA 3AQBB 2ONGA 3VJAA 2E8XA 2Z7IA 4F6XA 3S9VA 2PS4A 1KIYA 5EAUA 3DYFA 3P8LA 4LTZA 4HD1A 2F94F 3N6KF 3QKCA 3QQVA 4NKEA 3KRCB 4KKMA 4RXCA 3N3LF 3VJBA 4JYXA 1RQIA 1WL2A 4OMGA 5IM1A 1YHLA 3ACWA 3Q30A 1HX9A 4LFEA 4NG6A 3ICKA 3M01A 2E8WA 2ZEUA 5HN7A 3NPKA 1N23A 3LG5A 2DH4A 4EA1A 1YQ7A 2AZLA 3NPRA 3EFQA 5DHIA 1VG6A 3KB9A 3N49F 4KQSA 3WE9A 3M02A 1UBWA 4DEMF 4LZ3A 3W7FA 4LTVA 1N24A 2OPNA 4EA2A 5B0IA 4JXYA 5DJPF 5CG5A 4RXDA 5AFXA 1DGPA 4LUUA 3KROB 1N20A 4EA0A 3WCJA 3VJ8A 4PVYF 3CC9A 2Q58A 3V1XA 2ONHA
chains in the Genus database with same CATH superfamily
2F89F 4KVWA 2Z50A 1WL0A 1RQJA 5IK0A 5HN9A 4QXSF 1YYTA 2AETA 3WJOA 5DZ2A 2F8CF 3KRFA 1YYQA 2E92A 3AQCB 3WJNA 5IL3A 3LGZB 3WCEA 2AELA 4P0WA 4KQUA 2Z78A 3KRCA 1RTRA 1HXAA 1VG3A 3BNYA 4OKMA 3Q1OA 1UBVA 4LLTA 2E8UA 4H5CF 5E8HA 1V4IA 4FJQA 3ZL6A 3N0GA 4RYPA 1YHMA 3G4FA 3LDWA 1WKZA 5ILDA 1WL1A 5EASA 3ICMA 4NFIF 3SDUA 3Q2ZA 2Z4XA 3DYHA 3N3DA 4E9ZA 3KRPA 5IKHA 4FP4A 4QPFA 5A0IA 1HXCA 4N1ZF 3CKEA 5IMPA 3ZMCA 2Z4YA 3KROA 1V4EA 3PH7A 3TFNA 3KBKA 3P5RA 5DJVF 3CP6A 5B00A 2Z52A 3RYWA 5KSXF 3VJ9A 1WL3A 2J1OA 2PS6A 3P8RA 4ZQ8A 5B01A 2P1CA 1KIZA 4KWDA 3IPIA 5CG6A 3PKOA 4L2XF 3N1VF 2PS7A 1WMWA 5ILZA 3N45F 3N1WF 3KRAA 1EZFA 3ID0A 3WCIA 1JFAA 1WY0A 5B0LA 3LJIA 4OMHA 4OGUA 4DI5A 3ZOUA 1YYSA 2AZJA 4NFKF 3SDRA 5ILYA 2J1PA 3OABA 5JV2F 3TFPA 5DGNF 3TC1A 5ER8A 3ADZA 4P0XA 3VJEA 2PS5A 3RYEA 4F6VA 4PVXF 3N5JF 5B0MA 3RMGA 1VG7A 4H5DF 4GA3A 2RAHA 3SDQA 3LSNA 5HNAA 3LVSA 4KUXA 3LMDA 5IK6A 4GP1A 4JXNA 4KVYA 5IN8A 4RXEA 4NFJF 5IVGA 3OYRA 3LEEA 1N22A 2AZKA 2ZCOA 3WEKA 3WCFA 5C05A 4DZWA 4DWGA 1N21A 2E4OA 5B0KA 2F7MF 1V4KA 4GP2A 3EZ3A 1N1ZA 2ZCSA 3MAVA 2OGDA 2Z4ZA 3WCCA 3ICZA 1YYUA 4LPGF 2ZEVA 2Q9ZA 2FORA 5E8KA 5ERNA 3TFVA 4WK5A 5DGSF 5IL8A 1VG2A 5JUZF 4E1EA 2E8TA 4LA6A 2EWGA 5ERMA 3WCDA 3WEGA 2AEKA 2E94A 2ZY1A 4RXAA 3WCAA 2Q80A 1UBXA 2ZCQA 3EGTA 3B7LA 3NRIA 3ICNA 2J5CA 1HXGA 2Q9YA 3PYBA 1YV5A 3WSAA 3LZ9A 4F62A 2F9KF 3ASXA 5DHKA 5B03A 5I1UA 1YJ4A 2I19A 5IKAA 5HN8A 1JFGA 2ZCRA 5IMNA 1YHKA 5ILIA 4KFAA 3APZA 2VF6A 3DYGA 2OPMA 4XQSF 1V4JA 5ILJA 3NF2A 5EATA 3LK5A 4KK2A 4JZBA 1DI1A 2O1OA 3UCAA 5A0JA 3ZCDA 4DXJA 5ILHA 3WCBA 3KRFB 4DHDA 3WCMA 4LZ0A 4KPJA 3VJCA 3WCLA 2FTZA 5DIQF 5IMIA 3WSBA 3OACB 3WEJA 3WEIA 5JV1F 3WCHA 2E93A 4LOBA 4KPDA 4KQ5A 4LA5A 3PYAA 5JA0F 4MC8A 3WC9A 5E8LA 3WEFA 4LFGA 5DW7A 3LGKA 3M9UA 4MC0A 5B0JA 2E95A 1ZW5A 1HM7A 1V4HA 3ACXA 2E90A 3SAEA 4Q23A 4LLSA 3WEHA 3P5PA 4K10A 4NUAA 3KRPB 3TS7A 5B02A 4E9UA 3WJKA 4GAXA 5AHUB 3PDEA 5AYPA 1UBYA 5EROA 4JZXA 3P41A 3AQ0A 2Z4VA 4XQRF 4LPHF 4OKZA 4KVDA 1YYRA 1N1BA 5DGMF 2Z4WA 2E8VA 3ZMBA 2Z7HA 4LZCA 2F8ZF 3SDTA 3LOMA 4DWBA 4LXWA 3RBMA 3N5HF 3N0FA 2E91A 3VJDA 4KVIA 2F92F 3OACA 5ILKA 3KRAB 3ACYA 3BNXA 3IBAA 4RNQA 4H5EF 3AE0A 2OA6A 5DJRF 3M0GA 1HM4A 5H9DA 4UMJA 4P0VA 3SDVA 4JVJF 1VG4A 3M00A 3G4DA 1PS1A 3LLWA 3WCGA 4N9UA 3OABB 5IK9A 1FPSA 2H8OA 3V1VA 4LFVF 3V66A 4MC3A 5AELA 3Q2QA 5JV0F 4XQTF 4NKFA 3S4JA 2PS8A 5A0KA 3MZVA 4LIXA 3N46F 2QISA 3AQBB 2ONGA 3VJAA 2E8XA 2Z7IA 4F6XA 3S9VA 2PS4A 1KIYA 5EAUA 3DYFA 3P8LA 4LTZA 4HD1A 2F94F 3N6KF 3QKCA 3QQVA 4NKEA 3KRCB 4KKMA 4RXCA 3N3LF 3VJBA 4JYXA 1RQIA 1WL2A 4OMGA 5IM1A 1YHLA 3ACWA 3Q30A 1HX9A 4LFEA 4NG6A 3ICKA 3M01A 2E8WA 2ZEUA 5HN7A 3NPKA 1N23A 3LG5A 2DH4A 4EA1A 1YQ7A 2AZLA 3NPRA 3EFQA 5DHIA 1VG6A 3KB9A 3N49F 4KQSA 3WE9A 3M02A 1UBWA 4DEMF 4LZ3A 3W7FA 4LTVA 1N24A 2OPNA 4EA2A 5B0IA 4JXYA 5DJPF 5CG5A 4RXDA 5AFXA 1DGPA 4LUUA 3KROB 1N20A 4EA0A 3WCJA 3VJ8A 4PVYF 3CC9A 2Q58A 3V1XA 2ONHA
chains in the Genus database with same CATH topology
2F89F 4KVWA 2Z50A 1WL0A 1RQJA 5IK0A 5HN9A 4QXSF 1YYTA 2AETA 3WJOA 5DZ2A 2F8CF 3KRFA 1YYQA 2E92A 3AQCB 3WJNA 5IL3A 3LGZB 3WCEA 2AELA 4P0WA 4KQUA 2Z78A 3KRCA 1RTRA 1HXAA 1VG3A 3BNYA 4OKMA 3Q1OA 1UBVA 4LLTA 2E8UA 4H5CF 5E8HA 1V4IA 4FJQA 3ZL6A 3N0GA 4RYPA 1YHMA 3G4FA 3LDWA 1WKZA 5ILDA 1WL1A 5EASA 3ICMA 4NFIF 3SDUA 3Q2ZA 2Z4XA 3DYHA 3N3DA 4E9ZA 3KRPA 5IKHA 4FP4A 4QPFA 5A0IA 1HXCA 4N1ZF 3CKEA 5IMPA 3ZMCA 2Z4YA 3KROA 1V4EA 3PH7A 3TFNA 3KBKA 3P5RA 5DJVF 3CP6A 5B00A 2Z52A 3RYWA 5KSXF 3VJ9A 1WL3A 2J1OA 2PS6A 3P8RA 4ZQ8A 5B01A 2P1CA 1KIZA 4KWDA 3IPIA 5CG6A 3PKOA 4L2XF 3N1VF 2PS7A 1WMWA 5ILZA 3N45F 3N1WF 3KRAA 1EZFA 3ID0A 3WCIA 1JFAA 1WY0A 5B0LA 3LJIA 4OMHA 4OGUA 4DI5A 3ZOUA 1YYSA 2AZJA 4NFKF 3SDRA 5ILYA 2J1PA 3OABA 5JV2F 3TFPA 5DGNF 3TC1A 5ER8A 3ADZA 4P0XA 3VJEA 2PS5A 3RYEA 4F6VA 4PVXF 3N5JF 5B0MA 3RMGA 1VG7A 4H5DF 4GA3A 2RAHA 3SDQA 3LSNA 5HNAA 3LVSA 4KUXA 3LMDA 5IK6A 4GP1A 4JXNA 4KVYA 5IN8A 4RXEA 4NFJF 5IVGA 3OYRA 3LEEA 1N22A 2AZKA 2ZCOA 3WEKA 3WCFA 5C05A 4DZWA 4DWGA 1N21A 2E4OA 5B0KA 2F7MF 1V4KA 4GP2A 3EZ3A 1N1ZA 2ZCSA 3MAVA 2OGDA 2Z4ZA 3WCCA 3ICZA 1YYUA 4LPGF 2ZEVA 2Q9ZA 2FORA 5E8KA 5ERNA 3TFVA 4WK5A 5DGSF 5IL8A 1VG2A 5JUZF 4E1EA 2E8TA 4LA6A 2EWGA 5ERMA 3WCDA 3WEGA 2AEKA 2E94A 2ZY1A 4RXAA 3WCAA 2Q80A 1UBXA 2ZCQA 3EGTA 3B7LA 3NRIA 3ICNA 2J5CA 1HXGA 2Q9YA 3PYBA 1YV5A 3WSAA 3LZ9A 4F62A 2F9KF 3ASXA 5DHKA 5B03A 5I1UA 1YJ4A 2I19A 5IKAA 5HN8A 1JFGA 2ZCRA 5IMNA 1YHKA 5ILIA 4KFAA 3APZA 2VF6A 3DYGA 2OPMA 4XQSF 1V4JA 5ILJA 3NF2A 5EATA 3LK5A 4KK2A 4JZBA 1DI1A 2O1OA 3UCAA 5A0JA 3ZCDA 4DXJA 5ILHA 3WCBA 3KRFB 4DHDA 3WCMA 4LZ0A 4KPJA 3VJCA 3WCLA 2FTZA 5DIQF 5IMIA 3WSBA 3OACB 3WEJA 3WEIA 5JV1F 3WCHA 2E93A 4LOBA 4KPDA 4KQ5A 4LA5A 3PYAA 5JA0F 4MC8A 3WC9A 5E8LA 3WEFA 4LFGA 5DW7A 3LGKA 3M9UA 4MC0A 5B0JA 2E95A 1ZW5A 1HM7A 1V4HA 3ACXA 2E90A 3SAEA 4Q23A 4LLSA 3WEHA 3P5PA 4K10A 4NUAA 3KRPB 3TS7A 5B02A 4E9UA 3WJKA 4GAXA 5AHUB 3PDEA 5AYPA 1UBYA 5EROA 4JZXA 3P41A 3AQ0A 2Z4VA 4XQRF 4LPHF 4OKZA 4KVDA 1YYRA 1N1BA 5DGMF 2Z4WA 2E8VA 3ZMBA 2Z7HA 4LZCA 2F8ZF 3SDTA 3LOMA 4DWBA 4LXWA 3RBMA 3N5HF 3N0FA 2E91A 3VJDA 4KVIA 2F92F 3OACA 5ILKA 3KRAB 3ACYA 3BNXA 3IBAA 4RNQA 4H5EF 3AE0A 2OA6A 5DJRF 3M0GA 1HM4A 5H9DA 4UMJA 4P0VA 3SDVA 4JVJF 1VG4A 3M00A 3G4DA 1PS1A 3LLWA 3WCGA 4N9UA 3OABB 5IK9A 1FPSA 2H8OA 3V1VA 4LFVF 3V66A 4MC3A 5AELA 3Q2QA 5JV0F 4XQTF 4NKFA 3S4JA 2PS8A 5A0KA 3MZVA 4LIXA 3N46F 2QISA 3AQBB 2ONGA 3VJAA 2E8XA 2Z7IA 4F6XA 3S9VA 2PS4A 1KIYA 5EAUA 3DYFA 3P8LA 4LTZA 4HD1A 2F94F 3N6KF 3QKCA 3QQVA 4NKEA 3KRCB 4KKMA 4RXCA 3N3LF 3VJBA 4JYXA 1RQIA 1WL2A 4OMGA 5IM1A 1YHLA 3ACWA 3Q30A 1HX9A 4LFEA 4NG6A 3ICKA 3M01A 2E8WA 2ZEUA 5HN7A 3NPKA 1N23A 3LG5A 2DH4A 4EA1A 1YQ7A 2AZLA 3NPRA 3EFQA 5DHIA 1VG6A 3KB9A 3N49F 4KQSA 3WE9A 3M02A 1UBWA 4DEMF 4LZ3A 3W7FA 4LTVA 1N24A 2OPNA 4EA2A 5B0IA 4JXYA 5DJPF 5CG5A 4RXDA 5AFXA 1DGPA 4LUUA 3KROB 1N20A 4EA0A 3WCJA 3VJ8A 4PVYF 3CC9A 2Q58A 3V1XA 2ONHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F89 F;  4KVW A;  2Z50 A;  1WL0 A;  1RQJ A;  5IK0 A;  5HN9 A;  4QXS F;  1YYT A;  2AET A;  3WJO A;  5DZ2 A;  2F8C F;  3KRF A;  1YYQ A;  2E92 A;  3AQC B;  3WJN A;  5IL3 A;  3LGZ B;  3WCE A;  2AEL A;  4P0W A;  4KQU A;  2Z78 A;  3KRC A;  1RTR A;  1HXA A;  1VG3 A;  3BNY A;  4OKM A;  3Q1O A;  1UBV A;  4LLT A;  2E8U A;  4H5C F;  5E8H A;  1V4I A;  4FJQ A;  3ZL6 A;  3N0G A;  4RYP A;  1YHM A;  3G4F A;  3LDW A;  1WKZ A;  5ILD A;  1WL1 A;  5EAS A;  3ICM A;  4NFI F;  3SDU A;  3Q2Z A;  2Z4X A;  3DYH A;  3N3D A;  4E9Z A;  3KRP A;  5IKH A;  4FP4 A;  4QPF A;  5A0I A;  1HXC A;  4N1Z F;  3CKE A;  5IMP A;  3ZMC A;  2Z4Y A;  3KRO A;  1V4E A;  3PH7 A;  3TFN A;  3KBK A;  3P5R A;  5DJV F;  3CP6 A;  5B00 A;  2Z52 A;  3RYW A;  5KSX F;  3VJ9 A;  1WL3 A;  2J1O A;  2PS6 A;  3P8R A;  4ZQ8 A;  5B01 A;  2P1C A;  1KIZ A;  4KWD A;  3IPI A;  5CG6 A;  3PKO A;  4L2X F;  3N1V F;  2PS7 A;  1WMW A;  5ILZ A;  3N45 F;  3N1W F;  3KRA A;  1EZF A;  3ID0 A;  3WCI A;  1JFA A;  1WY0 A;  5B0L A;  3LJI A;  4OMH A;  4OGU A;  4DI5 A;  3ZOU A;  1YYS A;  2AZJ A;  4NFK F;  3SDR A;  5ILY A;  2J1P A;  3OAB A;  5JV2 F;  3TFP A;  5DGN F;  3TC1 A;  5ER8 A;  3ADZ A;  4P0X A;  3VJE A;  2PS5 A;  3RYE A;  4F6V A;  4PVX F;  3N5J F;  5B0M A;  3RMG A;  1VG7 A;  4H5D F;  4GA3 A;  2RAH A;  3SDQ A;  3LSN A;  5HNA A;  3LVS A;  4KUX A;  3LMD A;  5IK6 A;  4GP1 A;  4JXN A;  4KVY A;  5IN8 A;  4RXE A;  4NFJ F;  5IVG A;  3OYR A;  3LEE A;  1N22 A;  2AZK A;  2ZCO A;  3WEK A;  3WCF A;  5C05 A;  4DZW A;  4DWG A;  1N21 A;  2E4O A;  5B0K A;  2F7M F;  1V4K A;  4GP2 A;  3EZ3 A;  1N1Z A;  2ZCS A;  3MAV A;  2OGD A;  2Z4Z A;  3WCC A;  3ICZ A;  1YYU A;  4LPG F;  2ZEV A;  2Q9Z A;  2FOR A;  5E8K A;  5ERN A;  3TFV A;  4WK5 A;  5DGS F;  5IL8 A;  1VG2 A;  5JUZ F;  4E1E A;  2E8T A;  4LA6 A;  2EWG A;  5ERM A;  3WCD A;  3WEG A;  2AEK A;  2E94 A;  2ZY1 A;  4RXA A;  3WCA A;  2Q80 A;  1UBX A;  2ZCQ A;  3EGT A;  3B7L A;  3NRI A;  3ICN A;  2J5C A;  1HXG A;  2Q9Y A;  3PYB A;  1YV5 A;  3WSA A;  3LZ9 A;  4F62 A;  2F9K F;  3ASX A;  5DHK A;  5B03 A;  5I1U A;  1YJ4 A;  2I19 A;  5IKA A;  5HN8 A;  1JFG A;  2ZCR A;  5IMN A;  1YHK A;  5ILI A;  4KFA A;  3APZ A;  2VF6 A;  3DYG A;  2OPM A;  4XQS F;  1V4J A;  5ILJ A;  3NF2 A;  5EAT A;  3LK5 A;  4KK2 A;  4JZB A;  1DI1 A;  2O1O A;  3UCA A;  5A0J A;  3ZCD A;  4DXJ A;  5ILH A;  3WCB A;  3KRF B;  4DHD A;  3WCM A;  4LZ0 A;  4KPJ A;  3VJC A;  3WCL A;  2FTZ A;  5DIQ F;  5IMI A;  3WSB A;  3OAC B;  3WEJ A;  3WEI A;  5JV1 F;  3WCH A;  2E93 A;  4LOB A;  4KPD A;  4KQ5 A;  4LA5 A;  3PYA A;  5JA0 F;  4MC8 A;  3WC9 A;  5E8L A;  3WEF A;  4LFG A;  5DW7 A;  3LGK A;  3M9U A;  4MC0 A;  5B0J A;  2E95 A;  1ZW5 A;  1HM7 A;  1V4H A;  3ACX A;  2E90 A;  3SAE A;  4Q23 A;  4LLS A;  3WEH A;  3P5P A;  4K10 A;  4NUA A;  3KRP B;  3TS7 A;  5B02 A;  4E9U A;  3WJK A;  4GAX A;  5AHU B;  3PDE A;  5AYP A;  1UBY A;  5ERO A;  4JZX A;  3P41 A;  3AQ0 A;  2Z4V A;  4XQR F;  4LPH F;  4OKZ A;  4KVD A;  1YYR A;  1N1B A;  5DGM F;  2Z4W A;  2E8V A;  3ZMB A;  2Z7H A;  4LZC A;  2F8Z F;  3SDT A;  3LOM A;  4DWB A;  4LXW A;  3RBM A;  3N5H F;  3N0F A;  2E91 A;  3VJD A;  4KVI A;  2F92 F;  3OAC A;  5ILK A;  3KRA B;  3ACY A;  3BNX A;  3IBA A;  4RNQ A;  4H5E F;  3AE0 A;  2OA6 A;  5DJR F;  3M0G A;  1HM4 A;  5H9D A;  4UMJ A;  4P0V A;  3SDV A;  4JVJ F;  1VG4 A;  3M00 A;  3G4D A;  1PS1 A;  3LLW A;  3WCG A;  4N9U A;  3OAB B;  5IK9 A;  1FPS A;  2H8O A;  3V1V A;  4LFV F;  3V66 A;  4MC3 A;  5AEL A;  3Q2Q A;  5JV0 F;  4XQT F;  4NKF A;  3S4J A;  2PS8 A;  5A0K A;  3MZV A;  4LIX A;  3N46 F;  2QIS A;  3AQB B;  2ONG A;  3VJA A;  2E8X A;  2Z7I A;  4F6X A;  3S9V A;  2PS4 A;  1KIY A;  5EAU A;  3DYF A;  3P8L A;  4LTZ A;  4HD1 A;  2F94 F;  3N6K F;  3QKC A;  3QQV A;  4NKE A;  3KRC B;  4KKM A;  4RXC A;  3N3L F;  3VJB A;  4JYX A;  1RQI A;  1WL2 A;  4OMG A;  5IM1 A;  1YHL A;  3ACW A;  3Q30 A;  1HX9 A;  4LFE A;  4NG6 A;  3ICK A;  3M01 A;  2E8W A;  2ZEU A;  5HN7 A;  3NPK A;  1N23 A;  3LG5 A;  2DH4 A;  4EA1 A;  1YQ7 A;  2AZL A;  3NPR A;  3EFQ A;  5DHI A;  1VG6 A;  3KB9 A;  3N49 F;  4KQS A;  3WE9 A;  3M02 A;  1UBW A;  4DEM F;  4LZ3 A;  3W7F A;  4LTV A;  1N24 A;  2OPN A;  4EA2 A;  5B0I A;  4JXY A;  5DJP F;  5CG5 A;  4RXD A;  5AFX A;  1DGP A;  4LUU A;  3KRO B;  1N20 A;  4EA0 A;  3WCJ A;  3VJ8 A;  4PVY F;  3CC9 A;  2Q58 A;  3V1X A;  2ONH A; 
#chains in the Genus database with same CATH topology
 2F89 F;  4KVW A;  2Z50 A;  1WL0 A;  1RQJ A;  5IK0 A;  5HN9 A;  4QXS F;  1YYT A;  2AET A;  3WJO A;  5DZ2 A;  2F8C F;  3KRF A;  1YYQ A;  2E92 A;  3AQC B;  3WJN A;  5IL3 A;  3LGZ B;  3WCE A;  2AEL A;  4P0W A;  4KQU A;  2Z78 A;  3KRC A;  1RTR A;  1HXA A;  1VG3 A;  3BNY A;  4OKM A;  3Q1O A;  1UBV A;  4LLT A;  2E8U A;  4H5C F;  5E8H A;  1V4I A;  4FJQ A;  3ZL6 A;  3N0G A;  4RYP A;  1YHM A;  3G4F A;  3LDW A;  1WKZ A;  5ILD A;  1WL1 A;  5EAS A;  3ICM A;  4NFI F;  3SDU A;  3Q2Z A;  2Z4X A;  3DYH A;  3N3D A;  4E9Z A;  3KRP A;  5IKH A;  4FP4 A;  4QPF A;  5A0I A;  1HXC A;  4N1Z F;  3CKE A;  5IMP A;  3ZMC A;  2Z4Y A;  3KRO A;  1V4E A;  3PH7 A;  3TFN A;  3KBK A;  3P5R A;  5DJV F;  3CP6 A;  5B00 A;  2Z52 A;  3RYW A;  5KSX F;  3VJ9 A;  1WL3 A;  2J1O A;  2PS6 A;  3P8R A;  4ZQ8 A;  5B01 A;  2P1C A;  1KIZ A;  4KWD A;  3IPI A;  5CG6 A;  3PKO A;  4L2X F;  3N1V F;  2PS7 A;  1WMW A;  5ILZ A;  3N45 F;  3N1W F;  3KRA A;  1EZF A;  3ID0 A;  3WCI A;  1JFA A;  1WY0 A;  5B0L A;  3LJI A;  4OMH A;  4OGU A;  4DI5 A;  3ZOU A;  1YYS A;  2AZJ A;  4NFK F;  3SDR A;  5ILY A;  2J1P A;  3OAB A;  5JV2 F;  3TFP A;  5DGN F;  3TC1 A;  5ER8 A;  3ADZ A;  4P0X A;  3VJE A;  2PS5 A;  3RYE A;  4F6V A;  4PVX F;  3N5J F;  5B0M A;  3RMG A;  1VG7 A;  4H5D F;  4GA3 A;  2RAH A;  3SDQ A;  3LSN A;  5HNA A;  3LVS A;  4KUX A;  3LMD A;  5IK6 A;  4GP1 A;  4JXN A;  4KVY A;  5IN8 A;  4RXE A;  4NFJ F;  5IVG A;  3OYR A;  3LEE A;  1N22 A;  2AZK A;  2ZCO A;  3WEK A;  3WCF A;  5C05 A;  4DZW A;  4DWG A;  1N21 A;  2E4O A;  5B0K A;  2F7M F;  1V4K A;  4GP2 A;  3EZ3 A;  1N1Z A;  2ZCS A;  3MAV A;  2OGD A;  2Z4Z A;  3WCC A;  3ICZ A;  1YYU A;  4LPG F;  2ZEV A;  2Q9Z A;  2FOR A;  5E8K A;  5ERN A;  3TFV A;  4WK5 A;  5DGS F;  5IL8 A;  1VG2 A;  5JUZ F;  4E1E A;  2E8T A;  4LA6 A;  2EWG A;  5ERM A;  3WCD A;  3WEG A;  2AEK A;  2E94 A;  2ZY1 A;  4RXA A;  3WCA A;  2Q80 A;  1UBX A;  2ZCQ A;  3EGT A;  3B7L A;  3NRI A;  3ICN A;  2J5C A;  1HXG A;  2Q9Y A;  3PYB A;  1YV5 A;  3WSA A;  3LZ9 A;  4F62 A;  2F9K F;  3ASX A;  5DHK A;  5B03 A;  5I1U A;  1YJ4 A;  2I19 A;  5IKA A;  5HN8 A;  1JFG A;  2ZCR A;  5IMN A;  1YHK A;  5ILI A;  4KFA A;  3APZ A;  2VF6 A;  3DYG A;  2OPM A;  4XQS F;  1V4J A;  5ILJ A;  3NF2 A;  5EAT A;  3LK5 A;  4KK2 A;  4JZB A;  1DI1 A;  2O1O A;  3UCA A;  5A0J A;  3ZCD A;  4DXJ A;  5ILH A;  3WCB A;  3KRF B;  4DHD A;  3WCM A;  4LZ0 A;  4KPJ A;  3VJC A;  3WCL A;  2FTZ A;  5DIQ F;  5IMI A;  3WSB A;  3OAC B;  3WEJ A;  3WEI A;  5JV1 F;  3WCH A;  2E93 A;  4LOB A;  4KPD A;  4KQ5 A;  4LA5 A;  3PYA A;  5JA0 F;  4MC8 A;  3WC9 A;  5E8L A;  3WEF A;  4LFG A;  5DW7 A;  3LGK A;  3M9U A;  4MC0 A;  5B0J A;  2E95 A;  1ZW5 A;  1HM7 A;  1V4H A;  3ACX A;  2E90 A;  3SAE A;  4Q23 A;  4LLS A;  3WEH A;  3P5P A;  4K10 A;  4NUA A;  3KRP B;  3TS7 A;  5B02 A;  4E9U A;  3WJK A;  4GAX A;  5AHU B;  3PDE A;  5AYP A;  1UBY A;  5ERO A;  4JZX A;  3P41 A;  3AQ0 A;  2Z4V A;  4XQR F;  4LPH F;  4OKZ A;  4KVD A;  1YYR A;  1N1B A;  5DGM F;  2Z4W A;  2E8V A;  3ZMB A;  2Z7H A;  4LZC A;  2F8Z F;  3SDT A;  3LOM A;  4DWB A;  4LXW A;  3RBM A;  3N5H F;  3N0F A;  2E91 A;  3VJD A;  4KVI A;  2F92 F;  3OAC A;  5ILK A;  3KRA B;  3ACY A;  3BNX A;  3IBA A;  4RNQ A;  4H5E F;  3AE0 A;  2OA6 A;  5DJR F;  3M0G A;  1HM4 A;  5H9D A;  4UMJ A;  4P0V A;  3SDV A;  4JVJ F;  1VG4 A;  3M00 A;  3G4D A;  1PS1 A;  3LLW A;  3WCG A;  4N9U A;  3OAB B;  5IK9 A;  1FPS A;  2H8O A;  3V1V A;  4LFV F;  3V66 A;  4MC3 A;  5AEL A;  3Q2Q A;  5JV0 F;  4XQT F;  4NKF A;  3S4J A;  2PS8 A;  5A0K A;  3MZV A;  4LIX A;  3N46 F;  2QIS A;  3AQB B;  2ONG A;  3VJA A;  2E8X A;  2Z7I A;  4F6X A;  3S9V A;  2PS4 A;  1KIY A;  5EAU A;  3DYF A;  3P8L A;  4LTZ A;  4HD1 A;  2F94 F;  3N6K F;  3QKC A;  3QQV A;  4NKE A;  3KRC B;  4KKM A;  4RXC A;  3N3L F;  3VJB A;  4JYX A;  1RQI A;  1WL2 A;  4OMG A;  5IM1 A;  1YHL A;  3ACW A;  3Q30 A;  1HX9 A;  4LFE A;  4NG6 A;  3ICK A;  3M01 A;  2E8W A;  2ZEU A;  5HN7 A;  3NPK A;  1N23 A;  3LG5 A;  2DH4 A;  4EA1 A;  1YQ7 A;  2AZL A;  3NPR A;  3EFQ A;  5DHI A;  1VG6 A;  3KB9 A;  3N49 F;  4KQS A;  3WE9 A;  3M02 A;  1UBW A;  4DEM F;  4LZ3 A;  3W7F A;  4LTV A;  1N24 A;  2OPN A;  4EA2 A;  5B0I A;  4JXY A;  5DJP F;  5CG5 A;  4RXD A;  5AFX A;  1DGP A;  4LUU A;  3KRO B;  1N20 A;  4EA0 A;  3WCJ A;  3VJ8 A;  4PVY F;  3CC9 A;  2Q58 A;  3V1X A;  2ONH A; 
#chains in the Genus database with same CATH homology
 2F89 F;  4KVW A;  2Z50 A;  1WL0 A;  1RQJ A;  5IK0 A;  5HN9 A;  4QXS F;  1YYT A;  2AET A;  3WJO A;  5DZ2 A;  2F8C F;  3KRF A;  1YYQ A;  2E92 A;  3AQC B;  3WJN A;  5IL3 A;  3LGZ B;  3WCE A;  2AEL A;  4P0W A;  4KQU A;  2Z78 A;  3KRC A;  1RTR A;  1HXA A;  1VG3 A;  3BNY A;  4OKM A;  3Q1O A;  1UBV A;  4LLT A;  2E8U A;  4H5C F;  5E8H A;  1V4I A;  4FJQ A;  3ZL6 A;  3N0G A;  4RYP A;  1YHM A;  3G4F A;  3LDW A;  1WKZ A;  5ILD A;  1WL1 A;  5EAS A;  3ICM A;  4NFI F;  3SDU A;  3Q2Z A;  2Z4X A;  3DYH A;  3N3D A;  4E9Z A;  3KRP A;  5IKH A;  4FP4 A;  4QPF A;  5A0I A;  1HXC A;  4N1Z F;  3CKE A;  5IMP A;  3ZMC A;  2Z4Y A;  3KRO A;  1V4E A;  3PH7 A;  3TFN A;  3KBK A;  3P5R A;  5DJV F;  3CP6 A;  5B00 A;  2Z52 A;  3RYW A;  5KSX F;  3VJ9 A;  1WL3 A;  2J1O A;  2PS6 A;  3P8R A;  4ZQ8 A;  5B01 A;  2P1C A;  1KIZ A;  4KWD A;  3IPI A;  5CG6 A;  3PKO A;  4L2X F;  3N1V F;  2PS7 A;  1WMW A;  5ILZ A;  3N45 F;  3N1W F;  3KRA A;  1EZF A;  3ID0 A;  3WCI A;  1JFA A;  1WY0 A;  5B0L A;  3LJI A;  4OMH A;  4OGU A;  4DI5 A;  3ZOU A;  1YYS A;  2AZJ A;  4NFK F;  3SDR A;  5ILY A;  2J1P A;  3OAB A;  5JV2 F;  3TFP A;  5DGN F;  3TC1 A;  5ER8 A;  3ADZ A;  4P0X A;  3VJE A;  2PS5 A;  3RYE A;  4F6V A;  4PVX F;  3N5J F;  5B0M A;  3RMG A;  1VG7 A;  4H5D F;  4GA3 A;  2RAH A;  3SDQ A;  3LSN A;  5HNA A;  3LVS A;  4KUX A;  3LMD A;  5IK6 A;  4GP1 A;  4JXN A;  4KVY A;  5IN8 A;  4RXE A;  4NFJ F;  5IVG A;  3OYR A;  3LEE A;  1N22 A;  2AZK A;  2ZCO A;  3WEK A;  3WCF A;  5C05 A;  4DZW A;  4DWG A;  1N21 A;  2E4O A;  5B0K A;  2F7M F;  1V4K A;  4GP2 A;  3EZ3 A;  1N1Z A;  2ZCS A;  3MAV A;  2OGD A;  2Z4Z A;  3WCC A;  3ICZ A;  1YYU A;  4LPG F;  2ZEV A;  2Q9Z A;  2FOR A;  5E8K A;  5ERN A;  3TFV A;  4WK5 A;  5DGS F;  5IL8 A;  1VG2 A;  5JUZ F;  4E1E A;  2E8T A;  4LA6 A;  2EWG A;  5ERM A;  3WCD A;  3WEG A;  2AEK A;  2E94 A;  2ZY1 A;  4RXA A;  3WCA A;  2Q80 A;  1UBX A;  2ZCQ A;  3EGT A;  3B7L A;  3NRI A;  3ICN A;  2J5C A;  1HXG A;  2Q9Y A;  3PYB A;  1YV5 A;  3WSA A;  3LZ9 A;  4F62 A;  2F9K F;  3ASX A;  5DHK A;  5B03 A;  5I1U A;  1YJ4 A;  2I19 A;  5IKA A;  5HN8 A;  1JFG A;  2ZCR A;  5IMN A;  1YHK A;  5ILI A;  4KFA A;  3APZ A;  2VF6 A;  3DYG A;  2OPM A;  4XQS F;  1V4J A;  5ILJ A;  3NF2 A;  5EAT A;  3LK5 A;  4KK2 A;  4JZB A;  1DI1 A;  2O1O A;  3UCA A;  5A0J A;  3ZCD A;  4DXJ A;  5ILH A;  3WCB A;  3KRF B;  4DHD A;  3WCM A;  4LZ0 A;  4KPJ A;  3VJC A;  3WCL A;  2FTZ A;  5DIQ F;  5IMI A;  3WSB A;  3OAC B;  3WEJ A;  3WEI A;  5JV1 F;  3WCH A;  2E93 A;  4LOB A;  4KPD A;  4KQ5 A;  4LA5 A;  3PYA A;  5JA0 F;  4MC8 A;  3WC9 A;  5E8L A;  3WEF A;  4LFG A;  5DW7 A;  3LGK A;  3M9U A;  4MC0 A;  5B0J A;  2E95 A;  1ZW5 A;  1HM7 A;  1V4H A;  3ACX A;  2E90 A;  3SAE A;  4Q23 A;  4LLS A;  3WEH A;  3P5P A;  4K10 A;  4NUA A;  3KRP B;  3TS7 A;  5B02 A;  4E9U A;  3WJK A;  4GAX A;  5AHU B;  3PDE A;  5AYP A;  1UBY A;  5ERO A;  4JZX A;  3P41 A;  3AQ0 A;  2Z4V A;  4XQR F;  4LPH F;  4OKZ A;  4KVD A;  1YYR A;  1N1B A;  5DGM F;  2Z4W A;  2E8V A;  3ZMB A;  2Z7H A;  4LZC A;  2F8Z F;  3SDT A;  3LOM A;  4DWB A;  4LXW A;  3RBM A;  3N5H F;  3N0F A;  2E91 A;  3VJD A;  4KVI A;  2F92 F;  3OAC A;  5ILK A;  3KRA B;  3ACY A;  3BNX A;  3IBA A;  4RNQ A;  4H5E F;  3AE0 A;  2OA6 A;  5DJR F;  3M0G A;  1HM4 A;  5H9D A;  4UMJ A;  4P0V A;  3SDV A;  4JVJ F;  1VG4 A;  3M00 A;  3G4D A;  1PS1 A;  3LLW A;  3WCG A;  4N9U A;  3OAB B;  5IK9 A;  1FPS A;  2H8O A;  3V1V A;  4LFV F;  3V66 A;  4MC3 A;  5AEL A;  3Q2Q A;  5JV0 F;  4XQT F;  4NKF A;  3S4J A;  2PS8 A;  5A0K A;  3MZV A;  4LIX A;  3N46 F;  2QIS A;  3AQB B;  2ONG A;  3VJA A;  2E8X A;  2Z7I A;  4F6X A;  3S9V A;  2PS4 A;  1KIY A;  5EAU A;  3DYF A;  3P8L A;  4LTZ A;  4HD1 A;  2F94 F;  3N6K F;  3QKC A;  3QQV A;  4NKE A;  3KRC B;  4KKM A;  4RXC A;  3N3L F;  3VJB A;  4JYX A;  1RQI A;  1WL2 A;  4OMG A;  5IM1 A;  1YHL A;  3ACW A;  3Q30 A;  1HX9 A;  4LFE A;  4NG6 A;  3ICK A;  3M01 A;  2E8W A;  2ZEU A;  5HN7 A;  3NPK A;  1N23 A;  3LG5 A;  2DH4 A;  4EA1 A;  1YQ7 A;  2AZL A;  3NPR A;  3EFQ A;  5DHI A;  1VG6 A;  3KB9 A;  3N49 F;  4KQS A;  3WE9 A;  3M02 A;  1UBW A;  4DEM F;  4LZ3 A;  3W7F A;  4LTV A;  1N24 A;  2OPN A;  4EA2 A;  5B0I A;  4JXY A;  5DJP F;  5CG5 A;  4RXD A;  5AFX A;  1DGP A;  4LUU A;  3KRO B;  1N20 A;  4EA0 A;  3WCJ A;  3VJ8 A;  4PVY F;  3CC9 A;  2Q58 A;  3V1X A;  2ONH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...