3BNYA

Crystal structure of aristolochene synthase complexed with 2-fluorofarnesyl diphosphate (2f-fpp)
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
305
structure length
294
Chain Sequence
SLEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYLCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Aristolochene synthase
publication title X-ray Crystallographic Studies of Substrate Binding to Aristolochene Synthase Suggest a Metal Ion Binding Sequence for Catalysis
pubmed doi rcsb
source organism Aspergillus terreus
total genus 122
structure length 294
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2007-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3bnyA00
2AETA 2ZEVA 3CP6A 5DHIA 4LFVF 4LZCA 3ID0A 4GP1A 1HXCA 1YYSA 3LSNA 1YV5A 3TS7A 4GP2A 3AE0A 3DYFA 3WEHA 4KWDA 2AZLA 3LG5A 1VG6A 3ACXA 3WEKA 3ZOUA 3KRAA 4LUUA 3ICNA 3RYEA 3SDQA 1PS1A 3RMGA 5EROA 4LA6A 4P0WA 2F92F 1RQJA 3KB9A 4LIXA 3IBAA 1N22A 3WCAA 2ZY1A 4DXJA 3EZ3A 5IMNA 4KKMA 3KRCA 5DIQF 4XQTF 3LMDA 2F9KF 2ZCSA 5DZ2A 5JA0F 1YYUA 3M00A 4OKMA 1JFAA 3KRPB 1KIZA 4RXDA 4RXCA 4GAXA 2E8XA 4N1ZF 3WCCA 1VG3A 2E8TA 3WCIA 3V1XA 4NUAA 2O1OA 3CC9A 5IKHA 5HN8A 5E8KA 1RTRA 1RQIA 3OACB 5IVGA 1EZFA 4KK2A 5A0JA 4MC0A 5AELA 3Q30A 4FJQA 5ILHA 3N5JF 4LOBA 4JVJF 2Z78A 5ERNA 3Q2ZA 2F94F 3WCHA 3NF2A 4KUXA 3OABA 1WL1A 5ERMA 3N3DA 4DZWA 5ILDA 4E9ZA 3AQBB 3KRFA 3S4JA 1HXGA 3G4FA 5A0IA 5H9DA 3WSBA 3M0GA 4EA2A 2E8UA 3VJAA 4E1EA 2PS8A 5AFXA 3M02A 3WCEA 4LA5A 3P5RA 2Z4ZA 2ONGA 2AZJA 3WC9A 2E90A 2PS6A 5DGMF 3N46F 1YJ4A 2Z4XA 1HXAA 3TFPA 5IL3A 4LZ0A 4NFKF 4NFIF 5HN9A 1UBVA 3N5HF 1UBYA 3P8LA 4RXAA 1WL2A 2DH4A 3W7FA 4DHDA 5CG6A 4OMHA 3ZMBA 3LGZB 5IM1A 3PKOA 3WJOA 4LTZA 4MC3A 3PYAA 4DI5A 3M9UA 3KROB 3VJCA 4F6XA 3EFQA 3G4DA 4QPFA 3WJNA 3AQ0A 4P0VA 3VJ9A 3ZL6A 1YHMA 5AHUB 1WY0A 4H5CF 3NRIA 3VJEA 3N1WF 3QKCA 3V1VA 5DGSF 3MZVA 4KVIA 4DEMF 2E4OA 1YYQA 3ICMA 1WL3A 3N1VF 5IL8A 1DI1A 3WEIA 1YHLA 4NFJF 1VG2A 4PVYF 1VG4A 5JV2F 3EGTA 3LZ9A 5IMPA 4UMJA 2Q9ZA 4L2XF 1V4IA 4LFGA 5B0JA 5B00A 3SDUA 3SDTA 4KFAA 3Q1OA 1N23A 4E9UA 5JUZF 3BNYA 4DWBA 2FORA 1N20A 1V4EA 4LLTA 1V4HA 1WKZA 2AELA 2E94A 2J1PA 3ACYA 2Z52A 5AYPA 2PS5A 2OPNA 3KRPA 2Z7HA 3ZCDA 3NPRA 4JXYA 2AZKA 4RYPA 3OACA 3VJBA 4NKEA 2Z4YA 3WCBA 4K10A 4OKZA 3N0GA 2E91A 2QISA 1V4JA 3APZA 4H5EF 3TFVA 5CG5A 2E95A 4OGUA 3V66A 3P5PA 2OGDA 3WEFA 5DJRF 3LJIA 4H5DF 5KSXF 4FP4A 2P1CA 2E92A 4KQSA 3WE9A 3ADZA 5IN8A 4EA0A 2ONHA 1WMWA 3LDWA 3LVSA 3LOMA 4LPGF 3N0FA 4JXNA 3OYRA 3PYBA 1HX9A 5DW7A 1WL0A 4KVYA 2Q58A 1N1ZA 4MC8A 4KVDA 5IK9A 3MAVA 5I1UA 2ZCOA 5JV1F 3WCGA 2I19A 3SDVA 1VG7A 4LXWA 4N9UA 3ICZA 4P0XA 3N3LF 3LK5A 1HM7A 3TC1A 5A0KA 5ILJA 5DJVF 4XQRF 2E8WA 3ICKA 4LFEA 1KIYA 1YHKA 2F8CF 3ACWA 5IK0A 4LZ3A 3RBMA 3RYWA 5B0IA 1V4KA 4RNQA 5C05A 5B03A 3PH7A 3KROA 1ZW5A 4Q23A 3AQCB 4NKFA 2F8ZF 5EAUA 2ZCQA 3N45F 1N21A 2Z50A 5JV0F 3ASXA 5ILKA 4JZXA 5B02A 2OA6A 2E93A 4DWGA 4JZBA 3WEJA 3VJ8A 2EWGA 1N1BA 4WK5A 3KRAB 3WJKA 3NPKA 3IPIA 3KBKA 3QQVA 1YYRA 4LTVA 2RAHA 2Z4WA 4KPJA 3ZMCA 2FTZA 4KPDA 5ILYA 5IK6A 3P41A 5ER8A 4GA3A 3KRCB 3Q2QA 3B7LA 4ZQ8A 3UCAA 2PS4A 4F6VA 2ZEUA 5B01A 1YYTA 2E8VA 3WCLA 5DHKA 5ILIA 2J1OA 3N49F 5E8HA 5HN7A 5E8LA 2Z7IA 3DYHA 3N6KF 3BNXA 3WSAA 3M01A 5B0KA 3SAEA 1UBWA 5B0MA 3LGKA 3PDEA 2F89F 4EA1A 1JFGA 3OABB 3WEGA 2Z4VA 4KQ5A 5ILZA 3CKEA 3S9VA 3WCJA 2J5CA 4F62A 3KRFB 5DJPF 4KQUA 2H8OA 3WCMA 2ZCRA 3DYGA 3LEEA 3LLWA 1HM4A 2PS7A 5EATA 5IMIA 3WCFA 3SDRA 4LPHF 2OPMA 4JYXA 3VJDA 5B0LA 5HNAA 4NG6A 1UBXA 1DGPA 1N24A 2F7MF 5DGNF 4OMGA 3WCDA 4LLSA 3TFNA 2Q80A 1FPSA 2AEKA 1YQ7A 4RXEA 5IKAA 2VF6A 4XQSF 4QXSF 2Q9YA 3P8RA 4KVWA 4HD1A 4PVXF 5EASA
chains in the Genus database with same CATH superfamily
2AETA 2ZEVA 3CP6A 5DHIA 4LFVF 4LZCA 3ID0A 4GP1A 1HXCA 1YYSA 3LSNA 1YV5A 3TS7A 4GP2A 3AE0A 3DYFA 3WEHA 4KWDA 2AZLA 3LG5A 1VG6A 3ACXA 3WEKA 3ZOUA 3KRAA 4LUUA 3ICNA 3RYEA 3SDQA 1PS1A 3RMGA 5EROA 4LA6A 4P0WA 2F92F 1RQJA 3KB9A 4LIXA 3IBAA 1N22A 3WCAA 2ZY1A 4DXJA 3EZ3A 5IMNA 4KKMA 3KRCA 5DIQF 4XQTF 3LMDA 2F9KF 2ZCSA 5DZ2A 5JA0F 1YYUA 3M00A 4OKMA 1JFAA 3KRPB 1KIZA 4RXDA 4RXCA 4GAXA 2E8XA 4N1ZF 3WCCA 1VG3A 2E8TA 3WCIA 3V1XA 4NUAA 2O1OA 3CC9A 5IKHA 5HN8A 5E8KA 1RTRA 1RQIA 3OACB 5IVGA 1EZFA 4KK2A 5A0JA 4MC0A 5AELA 3Q30A 4FJQA 5ILHA 3N5JF 4LOBA 4JVJF 2Z78A 5ERNA 3Q2ZA 2F94F 3WCHA 3NF2A 4KUXA 3OABA 1WL1A 5ERMA 3N3DA 4DZWA 5ILDA 4E9ZA 3AQBB 3KRFA 3S4JA 1HXGA 3G4FA 5A0IA 5H9DA 3WSBA 3M0GA 4EA2A 2E8UA 3VJAA 4E1EA 2PS8A 5AFXA 3M02A 3WCEA 4LA5A 3P5RA 2Z4ZA 2ONGA 2AZJA 3WC9A 2E90A 2PS6A 5DGMF 3N46F 1YJ4A 2Z4XA 1HXAA 3TFPA 5IL3A 4LZ0A 4NFKF 4NFIF 5HN9A 1UBVA 3N5HF 1UBYA 3P8LA 4RXAA 1WL2A 2DH4A 3W7FA 4DHDA 5CG6A 4OMHA 3ZMBA 3LGZB 5IM1A 3PKOA 3WJOA 4LTZA 4MC3A 3PYAA 4DI5A 3M9UA 3KROB 3VJCA 4F6XA 3EFQA 3G4DA 4QPFA 3WJNA 3AQ0A 4P0VA 3VJ9A 3ZL6A 1YHMA 5AHUB 1WY0A 4H5CF 3NRIA 3VJEA 3N1WF 3QKCA 3V1VA 5DGSF 3MZVA 4KVIA 4DEMF 2E4OA 1YYQA 3ICMA 1WL3A 3N1VF 5IL8A 1DI1A 3WEIA 1YHLA 4NFJF 1VG2A 4PVYF 1VG4A 5JV2F 3EGTA 3LZ9A 5IMPA 4UMJA 2Q9ZA 4L2XF 1V4IA 4LFGA 5B0JA 5B00A 3SDUA 3SDTA 4KFAA 3Q1OA 1N23A 4E9UA 5JUZF 3BNYA 4DWBA 2FORA 1N20A 1V4EA 4LLTA 1V4HA 1WKZA 2AELA 2E94A 2J1PA 3ACYA 2Z52A 5AYPA 2PS5A 2OPNA 3KRPA 2Z7HA 3ZCDA 3NPRA 4JXYA 2AZKA 4RYPA 3OACA 3VJBA 4NKEA 2Z4YA 3WCBA 4K10A 4OKZA 3N0GA 2E91A 2QISA 1V4JA 3APZA 4H5EF 3TFVA 5CG5A 2E95A 4OGUA 3V66A 3P5PA 2OGDA 3WEFA 5DJRF 3LJIA 4H5DF 5KSXF 4FP4A 2P1CA 2E92A 4KQSA 3WE9A 3ADZA 5IN8A 4EA0A 2ONHA 1WMWA 3LDWA 3LVSA 3LOMA 4LPGF 3N0FA 4JXNA 3OYRA 3PYBA 1HX9A 5DW7A 1WL0A 4KVYA 2Q58A 1N1ZA 4MC8A 4KVDA 5IK9A 3MAVA 5I1UA 2ZCOA 5JV1F 3WCGA 2I19A 3SDVA 1VG7A 4LXWA 4N9UA 3ICZA 4P0XA 3N3LF 3LK5A 1HM7A 3TC1A 5A0KA 5ILJA 5DJVF 4XQRF 2E8WA 3ICKA 4LFEA 1KIYA 1YHKA 2F8CF 3ACWA 5IK0A 4LZ3A 3RBMA 3RYWA 5B0IA 1V4KA 4RNQA 5C05A 5B03A 3PH7A 3KROA 1ZW5A 4Q23A 3AQCB 4NKFA 2F8ZF 5EAUA 2ZCQA 3N45F 1N21A 2Z50A 5JV0F 3ASXA 5ILKA 4JZXA 5B02A 2OA6A 2E93A 4DWGA 4JZBA 3WEJA 3VJ8A 2EWGA 1N1BA 4WK5A 3KRAB 3WJKA 3NPKA 3IPIA 3KBKA 3QQVA 1YYRA 4LTVA 2RAHA 2Z4WA 4KPJA 3ZMCA 2FTZA 4KPDA 5ILYA 5IK6A 3P41A 5ER8A 4GA3A 3KRCB 3Q2QA 3B7LA 4ZQ8A 3UCAA 2PS4A 4F6VA 2ZEUA 5B01A 1YYTA 2E8VA 3WCLA 5DHKA 5ILIA 2J1OA 3N49F 5E8HA 5HN7A 5E8LA 2Z7IA 3DYHA 3N6KF 3BNXA 3WSAA 3M01A 5B0KA 3SAEA 1UBWA 5B0MA 3LGKA 3PDEA 2F89F 4EA1A 1JFGA 3OABB 3WEGA 2Z4VA 4KQ5A 5ILZA 3CKEA 3S9VA 3WCJA 2J5CA 4F62A 3KRFB 5DJPF 4KQUA 2H8OA 3WCMA 2ZCRA 3DYGA 3LEEA 3LLWA 1HM4A 2PS7A 5EATA 5IMIA 3WCFA 3SDRA 4LPHF 2OPMA 4JYXA 3VJDA 5B0LA 5HNAA 4NG6A 1UBXA 1DGPA 1N24A 2F7MF 5DGNF 4OMGA 3WCDA 4LLSA 3TFNA 2Q80A 1FPSA 2AEKA 1YQ7A 4RXEA 5IKAA 2VF6A 4XQSF 4QXSF 2Q9YA 3P8RA 4KVWA 4HD1A 4PVXF 5EASA
chains in the Genus database with same CATH topology
2AETA 2ZEVA 3CP6A 5DHIA 4LFVF 4LZCA 3ID0A 4GP1A 1HXCA 1YYSA 3LSNA 1YV5A 3TS7A 4GP2A 3AE0A 3DYFA 3WEHA 4KWDA 2AZLA 3LG5A 1VG6A 3ACXA 3WEKA 3ZOUA 3KRAA 4LUUA 3ICNA 3RYEA 3SDQA 1PS1A 3RMGA 5EROA 4LA6A 4P0WA 2F92F 1RQJA 3KB9A 4LIXA 3IBAA 1N22A 3WCAA 2ZY1A 4DXJA 3EZ3A 5IMNA 4KKMA 3KRCA 5DIQF 4XQTF 3LMDA 2F9KF 2ZCSA 5DZ2A 5JA0F 1YYUA 3M00A 4OKMA 1JFAA 3KRPB 1KIZA 4RXDA 4RXCA 4GAXA 2E8XA 4N1ZF 3WCCA 1VG3A 2E8TA 3WCIA 3V1XA 4NUAA 2O1OA 3CC9A 5IKHA 5HN8A 5E8KA 1RTRA 1RQIA 3OACB 5IVGA 1EZFA 4KK2A 5A0JA 4MC0A 5AELA 3Q30A 4FJQA 5ILHA 3N5JF 4LOBA 4JVJF 2Z78A 5ERNA 3Q2ZA 2F94F 3WCHA 3NF2A 4KUXA 3OABA 1WL1A 5ERMA 3N3DA 4DZWA 5ILDA 4E9ZA 3AQBB 3KRFA 3S4JA 1HXGA 3G4FA 5A0IA 5H9DA 3WSBA 3M0GA 4EA2A 2E8UA 3VJAA 4E1EA 2PS8A 5AFXA 3M02A 3WCEA 4LA5A 3P5RA 2Z4ZA 2ONGA 2AZJA 3WC9A 2E90A 2PS6A 5DGMF 3N46F 1YJ4A 2Z4XA 1HXAA 3TFPA 5IL3A 4LZ0A 4NFKF 4NFIF 5HN9A 1UBVA 3N5HF 1UBYA 3P8LA 4RXAA 1WL2A 2DH4A 3W7FA 4DHDA 5CG6A 4OMHA 3ZMBA 3LGZB 5IM1A 3PKOA 3WJOA 4LTZA 4MC3A 3PYAA 4DI5A 3M9UA 3KROB 3VJCA 4F6XA 3EFQA 3G4DA 4QPFA 3WJNA 3AQ0A 4P0VA 3VJ9A 3ZL6A 1YHMA 5AHUB 1WY0A 4H5CF 3NRIA 3VJEA 3N1WF 3QKCA 3V1VA 5DGSF 3MZVA 4KVIA 4DEMF 2E4OA 1YYQA 3ICMA 1WL3A 3N1VF 5IL8A 1DI1A 3WEIA 1YHLA 4NFJF 1VG2A 4PVYF 1VG4A 5JV2F 3EGTA 3LZ9A 5IMPA 4UMJA 2Q9ZA 4L2XF 1V4IA 4LFGA 5B0JA 5B00A 3SDUA 3SDTA 4KFAA 3Q1OA 1N23A 4E9UA 5JUZF 3BNYA 4DWBA 2FORA 1N20A 1V4EA 4LLTA 1V4HA 1WKZA 2AELA 2E94A 2J1PA 3ACYA 2Z52A 5AYPA 2PS5A 2OPNA 3KRPA 2Z7HA 3ZCDA 3NPRA 4JXYA 2AZKA 4RYPA 3OACA 3VJBA 4NKEA 2Z4YA 3WCBA 4K10A 4OKZA 3N0GA 2E91A 2QISA 1V4JA 3APZA 4H5EF 3TFVA 5CG5A 2E95A 4OGUA 3V66A 3P5PA 2OGDA 3WEFA 5DJRF 3LJIA 4H5DF 5KSXF 4FP4A 2P1CA 2E92A 4KQSA 3WE9A 3ADZA 5IN8A 4EA0A 2ONHA 1WMWA 3LDWA 3LVSA 3LOMA 4LPGF 3N0FA 4JXNA 3OYRA 3PYBA 1HX9A 5DW7A 1WL0A 4KVYA 2Q58A 1N1ZA 4MC8A 4KVDA 5IK9A 3MAVA 5I1UA 2ZCOA 5JV1F 3WCGA 2I19A 3SDVA 1VG7A 4LXWA 4N9UA 3ICZA 4P0XA 3N3LF 3LK5A 1HM7A 3TC1A 5A0KA 5ILJA 5DJVF 4XQRF 2E8WA 3ICKA 4LFEA 1KIYA 1YHKA 2F8CF 3ACWA 5IK0A 4LZ3A 3RBMA 3RYWA 5B0IA 1V4KA 4RNQA 5C05A 5B03A 3PH7A 3KROA 1ZW5A 4Q23A 3AQCB 4NKFA 2F8ZF 5EAUA 2ZCQA 3N45F 1N21A 2Z50A 5JV0F 3ASXA 5ILKA 4JZXA 5B02A 2OA6A 2E93A 4DWGA 4JZBA 3WEJA 3VJ8A 2EWGA 1N1BA 4WK5A 3KRAB 3WJKA 3NPKA 3IPIA 3KBKA 3QQVA 1YYRA 4LTVA 2RAHA 2Z4WA 4KPJA 3ZMCA 2FTZA 4KPDA 5ILYA 5IK6A 3P41A 5ER8A 4GA3A 3KRCB 3Q2QA 3B7LA 4ZQ8A 3UCAA 2PS4A 4F6VA 2ZEUA 5B01A 1YYTA 2E8VA 3WCLA 5DHKA 5ILIA 2J1OA 3N49F 5E8HA 5HN7A 5E8LA 2Z7IA 3DYHA 3N6KF 3BNXA 3WSAA 3M01A 5B0KA 3SAEA 1UBWA 5B0MA 3LGKA 3PDEA 2F89F 4EA1A 1JFGA 3OABB 3WEGA 2Z4VA 4KQ5A 5ILZA 3CKEA 3S9VA 3WCJA 2J5CA 4F62A 3KRFB 5DJPF 4KQUA 2H8OA 3WCMA 2ZCRA 3DYGA 3LEEA 3LLWA 1HM4A 2PS7A 5EATA 5IMIA 3WCFA 3SDRA 4LPHF 2OPMA 4JYXA 3VJDA 5B0LA 5HNAA 4NG6A 1UBXA 1DGPA 1N24A 2F7MF 5DGNF 4OMGA 3WCDA 4LLSA 3TFNA 2Q80A 1FPSA 2AEKA 1YQ7A 4RXEA 5IKAA 2VF6A 4XQSF 4QXSF 2Q9YA 3P8RA 4KVWA 4HD1A 4PVXF 5EASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AET A;  2ZEV A;  3CP6 A;  5DHI A;  4LFV F;  4LZC A;  3ID0 A;  4GP1 A;  1HXC A;  1YYS A;  3LSN A;  1YV5 A;  3TS7 A;  4GP2 A;  3AE0 A;  3DYF A;  3WEH A;  4KWD A;  2AZL A;  3LG5 A;  1VG6 A;  3ACX A;  3WEK A;  3ZOU A;  3KRA A;  4LUU A;  3ICN A;  3RYE A;  3SDQ A;  1PS1 A;  3RMG A;  5ERO A;  4LA6 A;  4P0W A;  2F92 F;  1RQJ A;  3KB9 A;  4LIX A;  3IBA A;  1N22 A;  3WCA A;  2ZY1 A;  4DXJ A;  3EZ3 A;  5IMN A;  4KKM A;  3KRC A;  5DIQ F;  4XQT F;  3LMD A;  2F9K F;  2ZCS A;  5DZ2 A;  5JA0 F;  1YYU A;  3M00 A;  4OKM A;  1JFA A;  3KRP B;  1KIZ A;  4RXD A;  4RXC A;  4GAX A;  2E8X A;  4N1Z F;  3WCC A;  1VG3 A;  2E8T A;  3WCI A;  3V1X A;  4NUA A;  2O1O A;  3CC9 A;  5IKH A;  5HN8 A;  5E8K A;  1RTR A;  1RQI A;  3OAC B;  5IVG A;  1EZF A;  4KK2 A;  5A0J A;  4MC0 A;  5AEL A;  3Q30 A;  4FJQ A;  5ILH A;  3N5J F;  4LOB A;  4JVJ F;  2Z78 A;  5ERN A;  3Q2Z A;  2F94 F;  3WCH A;  3NF2 A;  4KUX A;  3OAB A;  1WL1 A;  5ERM A;  3N3D A;  4DZW A;  5ILD A;  4E9Z A;  3AQB B;  3KRF A;  3S4J A;  1HXG A;  3G4F A;  5A0I A;  5H9D A;  3WSB A;  3M0G A;  4EA2 A;  2E8U A;  3VJA A;  4E1E A;  2PS8 A;  5AFX A;  3M02 A;  3WCE A;  4LA5 A;  3P5R A;  2Z4Z A;  2ONG A;  2AZJ A;  3WC9 A;  2E90 A;  2PS6 A;  5DGM F;  3N46 F;  1YJ4 A;  2Z4X A;  1HXA A;  3TFP A;  5IL3 A;  4LZ0 A;  4NFK F;  4NFI F;  5HN9 A;  1UBV A;  3N5H F;  1UBY A;  3P8L A;  4RXA A;  1WL2 A;  2DH4 A;  3W7F A;  4DHD A;  5CG6 A;  4OMH A;  3ZMB A;  3LGZ B;  5IM1 A;  3PKO A;  3WJO A;  4LTZ A;  4MC3 A;  3PYA A;  4DI5 A;  3M9U A;  3KRO B;  3VJC A;  4F6X A;  3EFQ A;  3G4D A;  4QPF A;  3WJN A;  3AQ0 A;  4P0V A;  3VJ9 A;  3ZL6 A;  1YHM A;  5AHU B;  1WY0 A;  4H5C F;  3NRI A;  3VJE A;  3N1W F;  3QKC A;  3V1V A;  5DGS F;  3MZV A;  4KVI A;  4DEM F;  2E4O A;  1YYQ A;  3ICM A;  1WL3 A;  3N1V F;  5IL8 A;  1DI1 A;  3WEI A;  1YHL A;  4NFJ F;  1VG2 A;  4PVY F;  1VG4 A;  5JV2 F;  3EGT A;  3LZ9 A;  5IMP A;  4UMJ A;  2Q9Z A;  4L2X F;  1V4I A;  4LFG A;  5B0J A;  5B00 A;  3SDU A;  3SDT A;  4KFA A;  3Q1O A;  1N23 A;  4E9U A;  5JUZ F;  3BNY A;  4DWB A;  2FOR A;  1N20 A;  1V4E A;  4LLT A;  1V4H A;  1WKZ A;  2AEL A;  2E94 A;  2J1P A;  3ACY A;  2Z52 A;  5AYP A;  2PS5 A;  2OPN A;  3KRP A;  2Z7H A;  3ZCD A;  3NPR A;  4JXY A;  2AZK A;  4RYP A;  3OAC A;  3VJB A;  4NKE A;  2Z4Y A;  3WCB A;  4K10 A;  4OKZ A;  3N0G A;  2E91 A;  2QIS A;  1V4J A;  3APZ A;  4H5E F;  3TFV A;  5CG5 A;  2E95 A;  4OGU A;  3V66 A;  3P5P A;  2OGD A;  3WEF A;  5DJR F;  3LJI A;  4H5D F;  5KSX F;  4FP4 A;  2P1C A;  2E92 A;  4KQS A;  3WE9 A;  3ADZ A;  5IN8 A;  4EA0 A;  2ONH A;  1WMW A;  3LDW A;  3LVS A;  3LOM A;  4LPG F;  3N0F A;  4JXN A;  3OYR A;  3PYB A;  1HX9 A;  5DW7 A;  1WL0 A;  4KVY A;  2Q58 A;  1N1Z A;  4MC8 A;  4KVD A;  5IK9 A;  3MAV A;  5I1U A;  2ZCO A;  5JV1 F;  3WCG A;  2I19 A;  3SDV A;  1VG7 A;  4LXW A;  4N9U A;  3ICZ A;  4P0X A;  3N3L F;  3LK5 A;  1HM7 A;  3TC1 A;  5A0K A;  5ILJ A;  5DJV F;  4XQR F;  2E8W A;  3ICK A;  4LFE A;  1KIY A;  1YHK A;  2F8C F;  3ACW A;  5IK0 A;  4LZ3 A;  3RBM A;  3RYW A;  5B0I A;  1V4K A;  4RNQ A;  5C05 A;  5B03 A;  3PH7 A;  3KRO A;  1ZW5 A;  4Q23 A;  3AQC B;  4NKF A;  2F8Z F;  5EAU A;  2ZCQ A;  3N45 F;  1N21 A;  2Z50 A;  5JV0 F;  3ASX A;  5ILK A;  4JZX A;  5B02 A;  2OA6 A;  2E93 A;  4DWG A;  4JZB A;  3WEJ A;  3VJ8 A;  2EWG A;  1N1B A;  4WK5 A;  3KRA B;  3WJK A;  3NPK A;  3IPI A;  3KBK A;  3QQV A;  1YYR A;  4LTV A;  2RAH A;  2Z4W A;  4KPJ A;  3ZMC A;  2FTZ A;  4KPD A;  5ILY A;  5IK6 A;  3P41 A;  5ER8 A;  4GA3 A;  3KRC B;  3Q2Q A;  3B7L A;  4ZQ8 A;  3UCA A;  2PS4 A;  4F6V A;  2ZEU A;  5B01 A;  1YYT A;  2E8V A;  3WCL A;  5DHK A;  5ILI A;  2J1O A;  3N49 F;  5E8H A;  5HN7 A;  5E8L A;  2Z7I A;  3DYH A;  3N6K F;  3BNX A;  3WSA A;  3M01 A;  5B0K A;  3SAE A;  1UBW A;  5B0M A;  3LGK A;  3PDE A;  2F89 F;  4EA1 A;  1JFG A;  3OAB B;  3WEG A;  2Z4V A;  4KQ5 A;  5ILZ A;  3CKE A;  3S9V A;  3WCJ A;  2J5C A;  4F62 A;  3KRF B;  5DJP F;  4KQU A;  2H8O A;  3WCM A;  2ZCR A;  3DYG A;  3LEE A;  3LLW A;  1HM4 A;  2PS7 A;  5EAT A;  5IMI A;  3WCF A;  3SDR A;  4LPH F;  2OPM A;  4JYX A;  3VJD A;  5B0L A;  5HNA A;  4NG6 A;  1UBX A;  1DGP A;  1N24 A;  2F7M F;  5DGN F;  4OMG A;  3WCD A;  4LLS A;  3TFN A;  2Q80 A;  1FPS A;  2AEK A;  1YQ7 A;  4RXE A;  5IKA A;  2VF6 A;  4XQS F;  4QXS F;  2Q9Y A;  3P8R A;  4KVW A;  4HD1 A;  4PVX F;  5EAS A; 
#chains in the Genus database with same CATH topology
 2AET A;  2ZEV A;  3CP6 A;  5DHI A;  4LFV F;  4LZC A;  3ID0 A;  4GP1 A;  1HXC A;  1YYS A;  3LSN A;  1YV5 A;  3TS7 A;  4GP2 A;  3AE0 A;  3DYF A;  3WEH A;  4KWD A;  2AZL A;  3LG5 A;  1VG6 A;  3ACX A;  3WEK A;  3ZOU A;  3KRA A;  4LUU A;  3ICN A;  3RYE A;  3SDQ A;  1PS1 A;  3RMG A;  5ERO A;  4LA6 A;  4P0W A;  2F92 F;  1RQJ A;  3KB9 A;  4LIX A;  3IBA A;  1N22 A;  3WCA A;  2ZY1 A;  4DXJ A;  3EZ3 A;  5IMN A;  4KKM A;  3KRC A;  5DIQ F;  4XQT F;  3LMD A;  2F9K F;  2ZCS A;  5DZ2 A;  5JA0 F;  1YYU A;  3M00 A;  4OKM A;  1JFA A;  3KRP B;  1KIZ A;  4RXD A;  4RXC A;  4GAX A;  2E8X A;  4N1Z F;  3WCC A;  1VG3 A;  2E8T A;  3WCI A;  3V1X A;  4NUA A;  2O1O A;  3CC9 A;  5IKH A;  5HN8 A;  5E8K A;  1RTR A;  1RQI A;  3OAC B;  5IVG A;  1EZF A;  4KK2 A;  5A0J A;  4MC0 A;  5AEL A;  3Q30 A;  4FJQ A;  5ILH A;  3N5J F;  4LOB A;  4JVJ F;  2Z78 A;  5ERN A;  3Q2Z A;  2F94 F;  3WCH A;  3NF2 A;  4KUX A;  3OAB A;  1WL1 A;  5ERM A;  3N3D A;  4DZW A;  5ILD A;  4E9Z A;  3AQB B;  3KRF A;  3S4J A;  1HXG A;  3G4F A;  5A0I A;  5H9D A;  3WSB A;  3M0G A;  4EA2 A;  2E8U A;  3VJA A;  4E1E A;  2PS8 A;  5AFX A;  3M02 A;  3WCE A;  4LA5 A;  3P5R A;  2Z4Z A;  2ONG A;  2AZJ A;  3WC9 A;  2E90 A;  2PS6 A;  5DGM F;  3N46 F;  1YJ4 A;  2Z4X A;  1HXA A;  3TFP A;  5IL3 A;  4LZ0 A;  4NFK F;  4NFI F;  5HN9 A;  1UBV A;  3N5H F;  1UBY A;  3P8L A;  4RXA A;  1WL2 A;  2DH4 A;  3W7F A;  4DHD A;  5CG6 A;  4OMH A;  3ZMB A;  3LGZ B;  5IM1 A;  3PKO A;  3WJO A;  4LTZ A;  4MC3 A;  3PYA A;  4DI5 A;  3M9U A;  3KRO B;  3VJC A;  4F6X A;  3EFQ A;  3G4D A;  4QPF A;  3WJN A;  3AQ0 A;  4P0V A;  3VJ9 A;  3ZL6 A;  1YHM A;  5AHU B;  1WY0 A;  4H5C F;  3NRI A;  3VJE A;  3N1W F;  3QKC A;  3V1V A;  5DGS F;  3MZV A;  4KVI A;  4DEM F;  2E4O A;  1YYQ A;  3ICM A;  1WL3 A;  3N1V F;  5IL8 A;  1DI1 A;  3WEI A;  1YHL A;  4NFJ F;  1VG2 A;  4PVY F;  1VG4 A;  5JV2 F;  3EGT A;  3LZ9 A;  5IMP A;  4UMJ A;  2Q9Z A;  4L2X F;  1V4I A;  4LFG A;  5B0J A;  5B00 A;  3SDU A;  3SDT A;  4KFA A;  3Q1O A;  1N23 A;  4E9U A;  5JUZ F;  3BNY A;  4DWB A;  2FOR A;  1N20 A;  1V4E A;  4LLT A;  1V4H A;  1WKZ A;  2AEL A;  2E94 A;  2J1P A;  3ACY A;  2Z52 A;  5AYP A;  2PS5 A;  2OPN A;  3KRP A;  2Z7H A;  3ZCD A;  3NPR A;  4JXY A;  2AZK A;  4RYP A;  3OAC A;  3VJB A;  4NKE A;  2Z4Y A;  3WCB A;  4K10 A;  4OKZ A;  3N0G A;  2E91 A;  2QIS A;  1V4J A;  3APZ A;  4H5E F;  3TFV A;  5CG5 A;  2E95 A;  4OGU A;  3V66 A;  3P5P A;  2OGD A;  3WEF A;  5DJR F;  3LJI A;  4H5D F;  5KSX F;  4FP4 A;  2P1C A;  2E92 A;  4KQS A;  3WE9 A;  3ADZ A;  5IN8 A;  4EA0 A;  2ONH A;  1WMW A;  3LDW A;  3LVS A;  3LOM A;  4LPG F;  3N0F A;  4JXN A;  3OYR A;  3PYB A;  1HX9 A;  5DW7 A;  1WL0 A;  4KVY A;  2Q58 A;  1N1Z A;  4MC8 A;  4KVD A;  5IK9 A;  3MAV A;  5I1U A;  2ZCO A;  5JV1 F;  3WCG A;  2I19 A;  3SDV A;  1VG7 A;  4LXW A;  4N9U A;  3ICZ A;  4P0X A;  3N3L F;  3LK5 A;  1HM7 A;  3TC1 A;  5A0K A;  5ILJ A;  5DJV F;  4XQR F;  2E8W A;  3ICK A;  4LFE A;  1KIY A;  1YHK A;  2F8C F;  3ACW A;  5IK0 A;  4LZ3 A;  3RBM A;  3RYW A;  5B0I A;  1V4K A;  4RNQ A;  5C05 A;  5B03 A;  3PH7 A;  3KRO A;  1ZW5 A;  4Q23 A;  3AQC B;  4NKF A;  2F8Z F;  5EAU A;  2ZCQ A;  3N45 F;  1N21 A;  2Z50 A;  5JV0 F;  3ASX A;  5ILK A;  4JZX A;  5B02 A;  2OA6 A;  2E93 A;  4DWG A;  4JZB A;  3WEJ A;  3VJ8 A;  2EWG A;  1N1B A;  4WK5 A;  3KRA B;  3WJK A;  3NPK A;  3IPI A;  3KBK A;  3QQV A;  1YYR A;  4LTV A;  2RAH A;  2Z4W A;  4KPJ A;  3ZMC A;  2FTZ A;  4KPD A;  5ILY A;  5IK6 A;  3P41 A;  5ER8 A;  4GA3 A;  3KRC B;  3Q2Q A;  3B7L A;  4ZQ8 A;  3UCA A;  2PS4 A;  4F6V A;  2ZEU A;  5B01 A;  1YYT A;  2E8V A;  3WCL A;  5DHK A;  5ILI A;  2J1O A;  3N49 F;  5E8H A;  5HN7 A;  5E8L A;  2Z7I A;  3DYH A;  3N6K F;  3BNX A;  3WSA A;  3M01 A;  5B0K A;  3SAE A;  1UBW A;  5B0M A;  3LGK A;  3PDE A;  2F89 F;  4EA1 A;  1JFG A;  3OAB B;  3WEG A;  2Z4V A;  4KQ5 A;  5ILZ A;  3CKE A;  3S9V A;  3WCJ A;  2J5C A;  4F62 A;  3KRF B;  5DJP F;  4KQU A;  2H8O A;  3WCM A;  2ZCR A;  3DYG A;  3LEE A;  3LLW A;  1HM4 A;  2PS7 A;  5EAT A;  5IMI A;  3WCF A;  3SDR A;  4LPH F;  2OPM A;  4JYX A;  3VJD A;  5B0L A;  5HNA A;  4NG6 A;  1UBX A;  1DGP A;  1N24 A;  2F7M F;  5DGN F;  4OMG A;  3WCD A;  4LLS A;  3TFN A;  2Q80 A;  1FPS A;  2AEK A;  1YQ7 A;  4RXE A;  5IKA A;  2VF6 A;  4XQS F;  4QXS F;  2Q9Y A;  3P8R A;  4KVW A;  4HD1 A;  4PVX F;  5EAS A; 
#chains in the Genus database with same CATH homology
 2AET A;  2ZEV A;  3CP6 A;  5DHI A;  4LFV F;  4LZC A;  3ID0 A;  4GP1 A;  1HXC A;  1YYS A;  3LSN A;  1YV5 A;  3TS7 A;  4GP2 A;  3AE0 A;  3DYF A;  3WEH A;  4KWD A;  2AZL A;  3LG5 A;  1VG6 A;  3ACX A;  3WEK A;  3ZOU A;  3KRA A;  4LUU A;  3ICN A;  3RYE A;  3SDQ A;  1PS1 A;  3RMG A;  5ERO A;  4LA6 A;  4P0W A;  2F92 F;  1RQJ A;  3KB9 A;  4LIX A;  3IBA A;  1N22 A;  3WCA A;  2ZY1 A;  4DXJ A;  3EZ3 A;  5IMN A;  4KKM A;  3KRC A;  5DIQ F;  4XQT F;  3LMD A;  2F9K F;  2ZCS A;  5DZ2 A;  5JA0 F;  1YYU A;  3M00 A;  4OKM A;  1JFA A;  3KRP B;  1KIZ A;  4RXD A;  4RXC A;  4GAX A;  2E8X A;  4N1Z F;  3WCC A;  1VG3 A;  2E8T A;  3WCI A;  3V1X A;  4NUA A;  2O1O A;  3CC9 A;  5IKH A;  5HN8 A;  5E8K A;  1RTR A;  1RQI A;  3OAC B;  5IVG A;  1EZF A;  4KK2 A;  5A0J A;  4MC0 A;  5AEL A;  3Q30 A;  4FJQ A;  5ILH A;  3N5J F;  4LOB A;  4JVJ F;  2Z78 A;  5ERN A;  3Q2Z A;  2F94 F;  3WCH A;  3NF2 A;  4KUX A;  3OAB A;  1WL1 A;  5ERM A;  3N3D A;  4DZW A;  5ILD A;  4E9Z A;  3AQB B;  3KRF A;  3S4J A;  1HXG A;  3G4F A;  5A0I A;  5H9D A;  3WSB A;  3M0G A;  4EA2 A;  2E8U A;  3VJA A;  4E1E A;  2PS8 A;  5AFX A;  3M02 A;  3WCE A;  4LA5 A;  3P5R A;  2Z4Z A;  2ONG A;  2AZJ A;  3WC9 A;  2E90 A;  2PS6 A;  5DGM F;  3N46 F;  1YJ4 A;  2Z4X A;  1HXA A;  3TFP A;  5IL3 A;  4LZ0 A;  4NFK F;  4NFI F;  5HN9 A;  1UBV A;  3N5H F;  1UBY A;  3P8L A;  4RXA A;  1WL2 A;  2DH4 A;  3W7F A;  4DHD A;  5CG6 A;  4OMH A;  3ZMB A;  3LGZ B;  5IM1 A;  3PKO A;  3WJO A;  4LTZ A;  4MC3 A;  3PYA A;  4DI5 A;  3M9U A;  3KRO B;  3VJC A;  4F6X A;  3EFQ A;  3G4D A;  4QPF A;  3WJN A;  3AQ0 A;  4P0V A;  3VJ9 A;  3ZL6 A;  1YHM A;  5AHU B;  1WY0 A;  4H5C F;  3NRI A;  3VJE A;  3N1W F;  3QKC A;  3V1V A;  5DGS F;  3MZV A;  4KVI A;  4DEM F;  2E4O A;  1YYQ A;  3ICM A;  1WL3 A;  3N1V F;  5IL8 A;  1DI1 A;  3WEI A;  1YHL A;  4NFJ F;  1VG2 A;  4PVY F;  1VG4 A;  5JV2 F;  3EGT A;  3LZ9 A;  5IMP A;  4UMJ A;  2Q9Z A;  4L2X F;  1V4I A;  4LFG A;  5B0J A;  5B00 A;  3SDU A;  3SDT A;  4KFA A;  3Q1O A;  1N23 A;  4E9U A;  5JUZ F;  3BNY A;  4DWB A;  2FOR A;  1N20 A;  1V4E A;  4LLT A;  1V4H A;  1WKZ A;  2AEL A;  2E94 A;  2J1P A;  3ACY A;  2Z52 A;  5AYP A;  2PS5 A;  2OPN A;  3KRP A;  2Z7H A;  3ZCD A;  3NPR A;  4JXY A;  2AZK A;  4RYP A;  3OAC A;  3VJB A;  4NKE A;  2Z4Y A;  3WCB A;  4K10 A;  4OKZ A;  3N0G A;  2E91 A;  2QIS A;  1V4J A;  3APZ A;  4H5E F;  3TFV A;  5CG5 A;  2E95 A;  4OGU A;  3V66 A;  3P5P A;  2OGD A;  3WEF A;  5DJR F;  3LJI A;  4H5D F;  5KSX F;  4FP4 A;  2P1C A;  2E92 A;  4KQS A;  3WE9 A;  3ADZ A;  5IN8 A;  4EA0 A;  2ONH A;  1WMW A;  3LDW A;  3LVS A;  3LOM A;  4LPG F;  3N0F A;  4JXN A;  3OYR A;  3PYB A;  1HX9 A;  5DW7 A;  1WL0 A;  4KVY A;  2Q58 A;  1N1Z A;  4MC8 A;  4KVD A;  5IK9 A;  3MAV A;  5I1U A;  2ZCO A;  5JV1 F;  3WCG A;  2I19 A;  3SDV A;  1VG7 A;  4LXW A;  4N9U A;  3ICZ A;  4P0X A;  3N3L F;  3LK5 A;  1HM7 A;  3TC1 A;  5A0K A;  5ILJ A;  5DJV F;  4XQR F;  2E8W A;  3ICK A;  4LFE A;  1KIY A;  1YHK A;  2F8C F;  3ACW A;  5IK0 A;  4LZ3 A;  3RBM A;  3RYW A;  5B0I A;  1V4K A;  4RNQ A;  5C05 A;  5B03 A;  3PH7 A;  3KRO A;  1ZW5 A;  4Q23 A;  3AQC B;  4NKF A;  2F8Z F;  5EAU A;  2ZCQ A;  3N45 F;  1N21 A;  2Z50 A;  5JV0 F;  3ASX A;  5ILK A;  4JZX A;  5B02 A;  2OA6 A;  2E93 A;  4DWG A;  4JZB A;  3WEJ A;  3VJ8 A;  2EWG A;  1N1B A;  4WK5 A;  3KRA B;  3WJK A;  3NPK A;  3IPI A;  3KBK A;  3QQV A;  1YYR A;  4LTV A;  2RAH A;  2Z4W A;  4KPJ A;  3ZMC A;  2FTZ A;  4KPD A;  5ILY A;  5IK6 A;  3P41 A;  5ER8 A;  4GA3 A;  3KRC B;  3Q2Q A;  3B7L A;  4ZQ8 A;  3UCA A;  2PS4 A;  4F6V A;  2ZEU A;  5B01 A;  1YYT A;  2E8V A;  3WCL A;  5DHK A;  5ILI A;  2J1O A;  3N49 F;  5E8H A;  5HN7 A;  5E8L A;  2Z7I A;  3DYH A;  3N6K F;  3BNX A;  3WSA A;  3M01 A;  5B0K A;  3SAE A;  1UBW A;  5B0M A;  3LGK A;  3PDE A;  2F89 F;  4EA1 A;  1JFG A;  3OAB B;  3WEG A;  2Z4V A;  4KQ5 A;  5ILZ A;  3CKE A;  3S9V A;  3WCJ A;  2J5C A;  4F62 A;  3KRF B;  5DJP F;  4KQU A;  2H8O A;  3WCM A;  2ZCR A;  3DYG A;  3LEE A;  3LLW A;  1HM4 A;  2PS7 A;  5EAT A;  5IMI A;  3WCF A;  3SDR A;  4LPH F;  2OPM A;  4JYX A;  3VJD A;  5B0L A;  5HNA A;  4NG6 A;  1UBX A;  1DGP A;  1N24 A;  2F7M F;  5DGN F;  4OMG A;  3WCD A;  4LLS A;  3TFN A;  2Q80 A;  1FPS A;  2AEK A;  1YQ7 A;  4RXE A;  5IKA A;  2VF6 A;  4XQS F;  4QXS F;  2Q9Y A;  3P8R A;  4KVW A;  4HD1 A;  4PVX F;  5EAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...