1RQJA

Active conformation of farnesyl pyrophosphate synthase bound to isopentyl pyrophosphate and risedronate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
299
structure length
299
Chain Sequence
MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTLAFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLDAEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQGADQQLGKSTYPALLGLEQARKKARDLIDDARQSLKQLAEQSLDTSALEALADYIIQRNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
pubmed doi rcsb
source organism Escherichia coli
total genus 126
structure length 299
sequence length 299
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2003-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 1rqjA00
4RXAA 4FP4A 2E8VA 2OPNA 3ACWA 1V4JA 4LZCA 3OYRA 5IL3A 3Q1OA 4GAXA 3ADZA 1KIYA 3V1XA 4GP1A 3ACXA 3KRCA 4LFGA 4DI5A 5IM1A 1WKZA 5IN8A 2Q9YA 3LVSA 4MC0A 4F62A 2PS6A 3ACYA 5DIQF 5ILIA 3RMGA 1YYSA 3LLWA 5IKAA 5DJVF 3ZOUA 1YYRA 4K10A 1YHLA 1YYQA 3PH7A 2VF6A 3SDRA 3N49F 4LXWA 3ID0A 2EWGA 1N21A 3NPRA 3M02A 1VG3A 3NF2A 1RTRA 2Q80A 5JV0F 1FPSA 2QISA 2ZCRA 1N1ZA 3WCJA 5I1UA 5HN8A 1HXCA 3CKEA 4LTZA 2PS7A 3MZVA 3KRFB 3N1WF 2F94F 4P0XA 4PVXF 4XQSF 1DI1A 2Z7IA 3DYFA 1YQ7A 3TC1A 3LJIA 1YJ4A 1WL1A 4XQTF 4EA1A 2Q9ZA 5B03A 2I19A 5EASA 1VG4A 3ICKA 4GA3A 4DWBA 4LLSA 4JVJF 4EA0A 2E91A 3LMDA 2F8ZF 3LGZB 3KRCB 3WEHA 5B01A 2F89F 4KVDA 2AEKA 5ILYA 3N6KF 2OGDA 3NPKA 2E90A 2FORA 2AZKA 2ONGA 3KB9A 3DYGA 3KRAA 5B0KA 3WCCA 2J5CA 1VG6A 1HXAA 3WCFA 5CG6A 3TFPA 4LTVA 4KUXA 5IMNA 1N23A 1WY0A 3OACA 5ERNA 4LFEA 3V1VA 4KKMA 3WSBA 4P0VA 2F92F 2J1OA 4DEMF 3AE0A 4PVYF 2E8UA 1EZFA 1VG2A 3SDTA 4H5DF 2ZCSA 4KVIA 5DHIA 3WCHA 3WCAA 3N3DA 3SDVA 3LK5A 3WE9A 5HN9A 4HD1A 3APZA 5B02A 5AHUB 4L2XF 3OABA 4LA5A 4EA2A 5JV2F 3W7FA 2Z50A 2ZEUA 3BNYA 3LG5A 3N1VF 4LLTA 5E8HA 1WL3A 5B0JA 1N1BA 3VJ8A 4KK2A 2O1OA 5DJPF 2OA6A 2Z7HA 1PS1A 5EROA 5IK0A 3P8RA 4ZQ8A 2J1PA 3KBKA 4LZ0A 1V4IA 4KPDA 3S4JA 5B0LA 4UMJA 4KPJA 4XQRF 3IBAA 3P5PA 5DZ2A 3OACB 2AZLA 3WEJA 3SDQA 5E8LA 3VJDA 2Z4VA 5A0KA 1WMWA 4KVYA 1HM4A 4LA6A 5A0IA 3MAVA 4OGUA 2E95A 3ICMA 3WEGA 2F9KF 3EFQA 1YHMA 3TS7A 3VJ9A 3WSAA 3WCBA 2Z78A 3AQCB 3S9VA 3WJOA 2E8TA 3SDUA 4QXSF 1YV5A 2RAHA 5E8KA 3SAEA 4GP2A 4KQSA 3ICZA 2Z4XA 1DGPA 2E4OA 5ER8A 3QKCA 3N0FA 3N3LF 2E94A 5DHKA 3ICNA 3M00A 3P41A 3TFNA 3RYEA 3N5JF 1UBYA 5EATA 2PS5A 4P0WA 2PS4A 2AZJA 4LUUA 3PYAA 1V4KA 3CC9A 1HM7A 4MC3A 5IMIA 4RXCA 4RNQA 4NKFA 3G4DA 1N22A 2E8WA 1N24A 2ZEVA 5HNAA 5ILDA 5IKHA 3N46F 3VJCA 1UBVA 3WCEA 4LFVF 4JZXA 4JZBA 1ZW5A 5DJRF 4N1ZF 5AFXA 1V4EA 4DXJA 3WEFA 3WJKA 4DZWA 4NUAA 1YHKA 4LZ3A 3VJBA 2FTZA 5C05A 3B7LA 3P5RA 3ZMCA 5HN7A 4NG6A 1JFAA 3M9UA 3PDEA 4H5CF 4DHDA 2Z4ZA 2P1CA 4OKZA 5AYPA 3WCIA 1HX9A 5IMPA 3M0GA 1RQIA 4LIXA 5IVGA 4FJQA 3LEEA 4LOBA 3Q2ZA 3IPIA 3PKOA 2ZCOA 5JUZF 4N9UA 4NFKF 1YYUA 2PS8A 2Q58A 4OMHA 3KRAB 5DGMF 2DH4A 5AELA 3KROA 3KRPA 4LPHF 5B00A 4DWGA 4E9UA 3CP6A 5H9DA 5ILKA 2F8CF 5B0MA 5JA0F 3RYWA 5IL8A 4KQ5A 4E9ZA 3Q2QA 4OMGA 5KSXF 1V4HA 3ASXA 1HXGA 2H8OA 4LPGF 5B0IA 4Q23A 1YYTA 5ILZA 3DYHA 3LOMA 4E1EA 3N5HF 5ILHA 1VG7A 4NFIF 5JV1F 3UCAA 3WCMA 3N45F 2F7MF 3N0GA 2ONHA 3ZCDA 3EGTA 2AETA 1JFGA 2Z52A 1UBXA 1N20A 3OABB 4KFAA 4RXEA 3LZ9A 4RYPA 4JYXA 3P8LA 3AQBB 3WCDA 5CG5A 3V66A 4NFJF 2E8XA 1RQJA 2E93A 3WEIA 3TFVA 4OKMA 4WK5A 4MC8A 5DGNF 5IK9A 3WCLA 5A0JA 3QQVA 4KVWA 3M01A 3G4FA 2ZCQA 4F6VA 3VJAA 4NKEA 3ZL6A 4KQUA 3WEKA 3RBMA 5DW7A 2ZY1A 4JXNA 5ERMA 2Z4WA 3BNXA 2E92A 1UBWA 5EAUA 4KWDA 4F6XA 3NRIA 3KROB 3KRPB 5IK6A 2AELA 3ZMBA 3EZ3A 3LGKA 3WCGA 3WJNA 5ILJA 3WC9A 5DGSF 3PYBA 3KRFA 3AQ0A 1KIZA 3LSNA 4JXYA 4H5EF 3VJEA 3Q30A 4RXDA 3LDWA 4QPFA 1WL0A 2Z4YA 2OPMA 1WL2A
chains in the Genus database with same CATH superfamily
4RXAA 4FP4A 2E8VA 2OPNA 3ACWA 1V4JA 4LZCA 3OYRA 5IL3A 3Q1OA 4GAXA 3ADZA 1KIYA 3V1XA 4GP1A 3ACXA 3KRCA 4LFGA 4DI5A 5IM1A 1WKZA 5IN8A 2Q9YA 3LVSA 4MC0A 4F62A 2PS6A 3ACYA 5DIQF 5ILIA 3RMGA 1YYSA 3LLWA 5IKAA 5DJVF 3ZOUA 1YYRA 4K10A 1YHLA 1YYQA 3PH7A 2VF6A 3SDRA 3N49F 4LXWA 3ID0A 2EWGA 1N21A 3NPRA 3M02A 1VG3A 3NF2A 1RTRA 2Q80A 5JV0F 1FPSA 2QISA 2ZCRA 1N1ZA 3WCJA 5I1UA 5HN8A 1HXCA 3CKEA 4LTZA 2PS7A 3MZVA 3KRFB 3N1WF 2F94F 4P0XA 4PVXF 4XQSF 1DI1A 2Z7IA 3DYFA 1YQ7A 3TC1A 3LJIA 1YJ4A 1WL1A 4XQTF 4EA1A 2Q9ZA 5B03A 2I19A 5EASA 1VG4A 3ICKA 4GA3A 4DWBA 4LLSA 4JVJF 4EA0A 2E91A 3LMDA 2F8ZF 3LGZB 3KRCB 3WEHA 5B01A 2F89F 4KVDA 2AEKA 5ILYA 3N6KF 2OGDA 3NPKA 2E90A 2FORA 2AZKA 2ONGA 3KB9A 3DYGA 3KRAA 5B0KA 3WCCA 2J5CA 1VG6A 1HXAA 3WCFA 5CG6A 3TFPA 4LTVA 4KUXA 5IMNA 1N23A 1WY0A 3OACA 5ERNA 4LFEA 3V1VA 4KKMA 3WSBA 4P0VA 2F92F 2J1OA 4DEMF 3AE0A 4PVYF 2E8UA 1EZFA 1VG2A 3SDTA 4H5DF 2ZCSA 4KVIA 5DHIA 3WCHA 3WCAA 3N3DA 3SDVA 3LK5A 3WE9A 5HN9A 4HD1A 3APZA 5B02A 5AHUB 4L2XF 3OABA 4LA5A 4EA2A 5JV2F 3W7FA 2Z50A 2ZEUA 3BNYA 3LG5A 3N1VF 4LLTA 5E8HA 1WL3A 5B0JA 1N1BA 3VJ8A 4KK2A 2O1OA 5DJPF 2OA6A 2Z7HA 1PS1A 5EROA 5IK0A 3P8RA 4ZQ8A 2J1PA 3KBKA 4LZ0A 1V4IA 4KPDA 3S4JA 5B0LA 4UMJA 4KPJA 4XQRF 3IBAA 3P5PA 5DZ2A 3OACB 2AZLA 3WEJA 3SDQA 5E8LA 3VJDA 2Z4VA 5A0KA 1WMWA 4KVYA 1HM4A 4LA6A 5A0IA 3MAVA 4OGUA 2E95A 3ICMA 3WEGA 2F9KF 3EFQA 1YHMA 3TS7A 3VJ9A 3WSAA 3WCBA 2Z78A 3AQCB 3S9VA 3WJOA 2E8TA 3SDUA 4QXSF 1YV5A 2RAHA 5E8KA 3SAEA 4GP2A 4KQSA 3ICZA 2Z4XA 1DGPA 2E4OA 5ER8A 3QKCA 3N0FA 3N3LF 2E94A 5DHKA 3ICNA 3M00A 3P41A 3TFNA 3RYEA 3N5JF 1UBYA 5EATA 2PS5A 4P0WA 2PS4A 2AZJA 4LUUA 3PYAA 1V4KA 3CC9A 1HM7A 4MC3A 5IMIA 4RXCA 4RNQA 4NKFA 3G4DA 1N22A 2E8WA 1N24A 2ZEVA 5HNAA 5ILDA 5IKHA 3N46F 3VJCA 1UBVA 3WCEA 4LFVF 4JZXA 4JZBA 1ZW5A 5DJRF 4N1ZF 5AFXA 1V4EA 4DXJA 3WEFA 3WJKA 4DZWA 4NUAA 1YHKA 4LZ3A 3VJBA 2FTZA 5C05A 3B7LA 3P5RA 3ZMCA 5HN7A 4NG6A 1JFAA 3M9UA 3PDEA 4H5CF 4DHDA 2Z4ZA 2P1CA 4OKZA 5AYPA 3WCIA 1HX9A 5IMPA 3M0GA 1RQIA 4LIXA 5IVGA 4FJQA 3LEEA 4LOBA 3Q2ZA 3IPIA 3PKOA 2ZCOA 5JUZF 4N9UA 4NFKF 1YYUA 2PS8A 2Q58A 4OMHA 3KRAB 5DGMF 2DH4A 5AELA 3KROA 3KRPA 4LPHF 5B00A 4DWGA 4E9UA 3CP6A 5H9DA 5ILKA 2F8CF 5B0MA 5JA0F 3RYWA 5IL8A 4KQ5A 4E9ZA 3Q2QA 4OMGA 5KSXF 1V4HA 3ASXA 1HXGA 2H8OA 4LPGF 5B0IA 4Q23A 1YYTA 5ILZA 3DYHA 3LOMA 4E1EA 3N5HF 5ILHA 1VG7A 4NFIF 5JV1F 3UCAA 3WCMA 3N45F 2F7MF 3N0GA 2ONHA 3ZCDA 3EGTA 2AETA 1JFGA 2Z52A 1UBXA 1N20A 3OABB 4KFAA 4RXEA 3LZ9A 4RYPA 4JYXA 3P8LA 3AQBB 3WCDA 5CG5A 3V66A 4NFJF 2E8XA 1RQJA 2E93A 3WEIA 3TFVA 4OKMA 4WK5A 4MC8A 5DGNF 5IK9A 3WCLA 5A0JA 3QQVA 4KVWA 3M01A 3G4FA 2ZCQA 4F6VA 3VJAA 4NKEA 3ZL6A 4KQUA 3WEKA 3RBMA 5DW7A 2ZY1A 4JXNA 5ERMA 2Z4WA 3BNXA 2E92A 1UBWA 5EAUA 4KWDA 4F6XA 3NRIA 3KROB 3KRPB 5IK6A 2AELA 3ZMBA 3EZ3A 3LGKA 3WCGA 3WJNA 5ILJA 3WC9A 5DGSF 3PYBA 3KRFA 3AQ0A 1KIZA 3LSNA 4JXYA 4H5EF 3VJEA 3Q30A 4RXDA 3LDWA 4QPFA 1WL0A 2Z4YA 2OPMA 1WL2A
chains in the Genus database with same CATH topology
4RXAA 4FP4A 2E8VA 2OPNA 3ACWA 1V4JA 4LZCA 3OYRA 5IL3A 3Q1OA 4GAXA 3ADZA 1KIYA 3V1XA 4GP1A 3ACXA 3KRCA 4LFGA 4DI5A 5IM1A 1WKZA 5IN8A 2Q9YA 3LVSA 4MC0A 4F62A 2PS6A 3ACYA 5DIQF 5ILIA 3RMGA 1YYSA 3LLWA 5IKAA 5DJVF 3ZOUA 1YYRA 4K10A 1YHLA 1YYQA 3PH7A 2VF6A 3SDRA 3N49F 4LXWA 3ID0A 2EWGA 1N21A 3NPRA 3M02A 1VG3A 3NF2A 1RTRA 2Q80A 5JV0F 1FPSA 2QISA 2ZCRA 1N1ZA 3WCJA 5I1UA 5HN8A 1HXCA 3CKEA 4LTZA 2PS7A 3MZVA 3KRFB 3N1WF 2F94F 4P0XA 4PVXF 4XQSF 1DI1A 2Z7IA 3DYFA 1YQ7A 3TC1A 3LJIA 1YJ4A 1WL1A 4XQTF 4EA1A 2Q9ZA 5B03A 2I19A 5EASA 1VG4A 3ICKA 4GA3A 4DWBA 4LLSA 4JVJF 4EA0A 2E91A 3LMDA 2F8ZF 3LGZB 3KRCB 3WEHA 5B01A 2F89F 4KVDA 2AEKA 5ILYA 3N6KF 2OGDA 3NPKA 2E90A 2FORA 2AZKA 2ONGA 3KB9A 3DYGA 3KRAA 5B0KA 3WCCA 2J5CA 1VG6A 1HXAA 3WCFA 5CG6A 3TFPA 4LTVA 4KUXA 5IMNA 1N23A 1WY0A 3OACA 5ERNA 4LFEA 3V1VA 4KKMA 3WSBA 4P0VA 2F92F 2J1OA 4DEMF 3AE0A 4PVYF 2E8UA 1EZFA 1VG2A 3SDTA 4H5DF 2ZCSA 4KVIA 5DHIA 3WCHA 3WCAA 3N3DA 3SDVA 3LK5A 3WE9A 5HN9A 4HD1A 3APZA 5B02A 5AHUB 4L2XF 3OABA 4LA5A 4EA2A 5JV2F 3W7FA 2Z50A 2ZEUA 3BNYA 3LG5A 3N1VF 4LLTA 5E8HA 1WL3A 5B0JA 1N1BA 3VJ8A 4KK2A 2O1OA 5DJPF 2OA6A 2Z7HA 1PS1A 5EROA 5IK0A 3P8RA 4ZQ8A 2J1PA 3KBKA 4LZ0A 1V4IA 4KPDA 3S4JA 5B0LA 4UMJA 4KPJA 4XQRF 3IBAA 3P5PA 5DZ2A 3OACB 2AZLA 3WEJA 3SDQA 5E8LA 3VJDA 2Z4VA 5A0KA 1WMWA 4KVYA 1HM4A 4LA6A 5A0IA 3MAVA 4OGUA 2E95A 3ICMA 3WEGA 2F9KF 3EFQA 1YHMA 3TS7A 3VJ9A 3WSAA 3WCBA 2Z78A 3AQCB 3S9VA 3WJOA 2E8TA 3SDUA 4QXSF 1YV5A 2RAHA 5E8KA 3SAEA 4GP2A 4KQSA 3ICZA 2Z4XA 1DGPA 2E4OA 5ER8A 3QKCA 3N0FA 3N3LF 2E94A 5DHKA 3ICNA 3M00A 3P41A 3TFNA 3RYEA 3N5JF 1UBYA 5EATA 2PS5A 4P0WA 2PS4A 2AZJA 4LUUA 3PYAA 1V4KA 3CC9A 1HM7A 4MC3A 5IMIA 4RXCA 4RNQA 4NKFA 3G4DA 1N22A 2E8WA 1N24A 2ZEVA 5HNAA 5ILDA 5IKHA 3N46F 3VJCA 1UBVA 3WCEA 4LFVF 4JZXA 4JZBA 1ZW5A 5DJRF 4N1ZF 5AFXA 1V4EA 4DXJA 3WEFA 3WJKA 4DZWA 4NUAA 1YHKA 4LZ3A 3VJBA 2FTZA 5C05A 3B7LA 3P5RA 3ZMCA 5HN7A 4NG6A 1JFAA 3M9UA 3PDEA 4H5CF 4DHDA 2Z4ZA 2P1CA 4OKZA 5AYPA 3WCIA 1HX9A 5IMPA 3M0GA 1RQIA 4LIXA 5IVGA 4FJQA 3LEEA 4LOBA 3Q2ZA 3IPIA 3PKOA 2ZCOA 5JUZF 4N9UA 4NFKF 1YYUA 2PS8A 2Q58A 4OMHA 3KRAB 5DGMF 2DH4A 5AELA 3KROA 3KRPA 4LPHF 5B00A 4DWGA 4E9UA 3CP6A 5H9DA 5ILKA 2F8CF 5B0MA 5JA0F 3RYWA 5IL8A 4KQ5A 4E9ZA 3Q2QA 4OMGA 5KSXF 1V4HA 3ASXA 1HXGA 2H8OA 4LPGF 5B0IA 4Q23A 1YYTA 5ILZA 3DYHA 3LOMA 4E1EA 3N5HF 5ILHA 1VG7A 4NFIF 5JV1F 3UCAA 3WCMA 3N45F 2F7MF 3N0GA 2ONHA 3ZCDA 3EGTA 2AETA 1JFGA 2Z52A 1UBXA 1N20A 3OABB 4KFAA 4RXEA 3LZ9A 4RYPA 4JYXA 3P8LA 3AQBB 3WCDA 5CG5A 3V66A 4NFJF 2E8XA 1RQJA 2E93A 3WEIA 3TFVA 4OKMA 4WK5A 4MC8A 5DGNF 5IK9A 3WCLA 5A0JA 3QQVA 4KVWA 3M01A 3G4FA 2ZCQA 4F6VA 3VJAA 4NKEA 3ZL6A 4KQUA 3WEKA 3RBMA 5DW7A 2ZY1A 4JXNA 5ERMA 2Z4WA 3BNXA 2E92A 1UBWA 5EAUA 4KWDA 4F6XA 3NRIA 3KROB 3KRPB 5IK6A 2AELA 3ZMBA 3EZ3A 3LGKA 3WCGA 3WJNA 5ILJA 3WC9A 5DGSF 3PYBA 3KRFA 3AQ0A 1KIZA 3LSNA 4JXYA 4H5EF 3VJEA 3Q30A 4RXDA 3LDWA 4QPFA 1WL0A 2Z4YA 2OPMA 1WL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RXA A;  4FP4 A;  2E8V A;  2OPN A;  3ACW A;  1V4J A;  4LZC A;  3OYR A;  5IL3 A;  3Q1O A;  4GAX A;  3ADZ A;  1KIY A;  3V1X A;  4GP1 A;  3ACX A;  3KRC A;  4LFG A;  4DI5 A;  5IM1 A;  1WKZ A;  5IN8 A;  2Q9Y A;  3LVS A;  4MC0 A;  4F62 A;  2PS6 A;  3ACY A;  5DIQ F;  5ILI A;  3RMG A;  1YYS A;  3LLW A;  5IKA A;  5DJV F;  3ZOU A;  1YYR A;  4K10 A;  1YHL A;  1YYQ A;  3PH7 A;  2VF6 A;  3SDR A;  3N49 F;  4LXW A;  3ID0 A;  2EWG A;  1N21 A;  3NPR A;  3M02 A;  1VG3 A;  3NF2 A;  1RTR A;  2Q80 A;  5JV0 F;  1FPS A;  2QIS A;  2ZCR A;  1N1Z A;  3WCJ A;  5I1U A;  5HN8 A;  1HXC A;  3CKE A;  4LTZ A;  2PS7 A;  3MZV A;  3KRF B;  3N1W F;  2F94 F;  4P0X A;  4PVX F;  4XQS F;  1DI1 A;  2Z7I A;  3DYF A;  1YQ7 A;  3TC1 A;  3LJI A;  1YJ4 A;  1WL1 A;  4XQT F;  4EA1 A;  2Q9Z A;  5B03 A;  2I19 A;  5EAS A;  1VG4 A;  3ICK A;  4GA3 A;  4DWB A;  4LLS A;  4JVJ F;  4EA0 A;  2E91 A;  3LMD A;  2F8Z F;  3LGZ B;  3KRC B;  3WEH A;  5B01 A;  2F89 F;  4KVD A;  2AEK A;  5ILY A;  3N6K F;  2OGD A;  3NPK A;  2E90 A;  2FOR A;  2AZK A;  2ONG A;  3KB9 A;  3DYG A;  3KRA A;  5B0K A;  3WCC A;  2J5C A;  1VG6 A;  1HXA A;  3WCF A;  5CG6 A;  3TFP A;  4LTV A;  4KUX A;  5IMN A;  1N23 A;  1WY0 A;  3OAC A;  5ERN A;  4LFE A;  3V1V A;  4KKM A;  3WSB A;  4P0V A;  2F92 F;  2J1O A;  4DEM F;  3AE0 A;  4PVY F;  2E8U A;  1EZF A;  1VG2 A;  3SDT A;  4H5D F;  2ZCS A;  4KVI A;  5DHI A;  3WCH A;  3WCA A;  3N3D A;  3SDV A;  3LK5 A;  3WE9 A;  5HN9 A;  4HD1 A;  3APZ A;  5B02 A;  5AHU B;  4L2X F;  3OAB A;  4LA5 A;  4EA2 A;  5JV2 F;  3W7F A;  2Z50 A;  2ZEU A;  3BNY A;  3LG5 A;  3N1V F;  4LLT A;  5E8H A;  1WL3 A;  5B0J A;  1N1B A;  3VJ8 A;  4KK2 A;  2O1O A;  5DJP F;  2OA6 A;  2Z7H A;  1PS1 A;  5ERO A;  5IK0 A;  3P8R A;  4ZQ8 A;  2J1P A;  3KBK A;  4LZ0 A;  1V4I A;  4KPD A;  3S4J A;  5B0L A;  4UMJ A;  4KPJ A;  4XQR F;  3IBA A;  3P5P A;  5DZ2 A;  3OAC B;  2AZL A;  3WEJ A;  3SDQ A;  5E8L A;  3VJD A;  2Z4V A;  5A0K A;  1WMW A;  4KVY A;  1HM4 A;  4LA6 A;  5A0I A;  3MAV A;  4OGU A;  2E95 A;  3ICM A;  3WEG A;  2F9K F;  3EFQ A;  1YHM A;  3TS7 A;  3VJ9 A;  3WSA A;  3WCB A;  2Z78 A;  3AQC B;  3S9V A;  3WJO A;  2E8T A;  3SDU A;  4QXS F;  1YV5 A;  2RAH A;  5E8K A;  3SAE A;  4GP2 A;  4KQS A;  3ICZ A;  2Z4X A;  1DGP A;  2E4O A;  5ER8 A;  3QKC A;  3N0F A;  3N3L F;  2E94 A;  5DHK A;  3ICN A;  3M00 A;  3P41 A;  3TFN A;  3RYE A;  3N5J F;  1UBY A;  5EAT A;  2PS5 A;  4P0W A;  2PS4 A;  2AZJ A;  4LUU A;  3PYA A;  1V4K A;  3CC9 A;  1HM7 A;  4MC3 A;  5IMI A;  4RXC A;  4RNQ A;  4NKF A;  3G4D A;  1N22 A;  2E8W A;  1N24 A;  2ZEV A;  5HNA A;  5ILD A;  5IKH A;  3N46 F;  3VJC A;  1UBV A;  3WCE A;  4LFV F;  4JZX A;  4JZB A;  1ZW5 A;  5DJR F;  4N1Z F;  5AFX A;  1V4E A;  4DXJ A;  3WEF A;  3WJK A;  4DZW A;  4NUA A;  1YHK A;  4LZ3 A;  3VJB A;  2FTZ A;  5C05 A;  3B7L A;  3P5R A;  3ZMC A;  5HN7 A;  4NG6 A;  1JFA A;  3M9U A;  3PDE A;  4H5C F;  4DHD A;  2Z4Z A;  2P1C A;  4OKZ A;  5AYP A;  3WCI A;  1HX9 A;  5IMP A;  3M0G A;  1RQI A;  4LIX A;  5IVG A;  4FJQ A;  3LEE A;  4LOB A;  3Q2Z A;  3IPI A;  3PKO A;  2ZCO A;  5JUZ F;  4N9U A;  4NFK F;  1YYU A;  2PS8 A;  2Q58 A;  4OMH A;  3KRA B;  5DGM F;  2DH4 A;  5AEL A;  3KRO A;  3KRP A;  4LPH F;  5B00 A;  4DWG A;  4E9U A;  3CP6 A;  5H9D A;  5ILK A;  2F8C F;  5B0M A;  5JA0 F;  3RYW A;  5IL8 A;  4KQ5 A;  4E9Z A;  3Q2Q A;  4OMG A;  5KSX F;  1V4H A;  3ASX A;  1HXG A;  2H8O A;  4LPG F;  5B0I A;  4Q23 A;  1YYT A;  5ILZ A;  3DYH A;  3LOM A;  4E1E A;  3N5H F;  5ILH A;  1VG7 A;  4NFI F;  5JV1 F;  3UCA A;  3WCM A;  3N45 F;  2F7M F;  3N0G A;  2ONH A;  3ZCD A;  3EGT A;  2AET A;  1JFG A;  2Z52 A;  1UBX A;  1N20 A;  3OAB B;  4KFA A;  4RXE A;  3LZ9 A;  4RYP A;  4JYX A;  3P8L A;  3AQB B;  3WCD A;  5CG5 A;  3V66 A;  4NFJ F;  2E8X A;  1RQJ A;  2E93 A;  3WEI A;  3TFV A;  4OKM A;  4WK5 A;  4MC8 A;  5DGN F;  5IK9 A;  3WCL A;  5A0J A;  3QQV A;  4KVW A;  3M01 A;  3G4F A;  2ZCQ A;  4F6V A;  3VJA A;  4NKE A;  3ZL6 A;  4KQU A;  3WEK A;  3RBM A;  5DW7 A;  2ZY1 A;  4JXN A;  5ERM A;  2Z4W A;  3BNX A;  2E92 A;  1UBW A;  5EAU A;  4KWD A;  4F6X A;  3NRI A;  3KRO B;  3KRP B;  5IK6 A;  2AEL A;  3ZMB A;  3EZ3 A;  3LGK A;  3WCG A;  3WJN A;  5ILJ A;  3WC9 A;  5DGS F;  3PYB A;  3KRF A;  3AQ0 A;  1KIZ A;  3LSN A;  4JXY A;  4H5E F;  3VJE A;  3Q30 A;  4RXD A;  3LDW A;  4QPF A;  1WL0 A;  2Z4Y A;  2OPM A;  1WL2 A; 
#chains in the Genus database with same CATH topology
 4RXA A;  4FP4 A;  2E8V A;  2OPN A;  3ACW A;  1V4J A;  4LZC A;  3OYR A;  5IL3 A;  3Q1O A;  4GAX A;  3ADZ A;  1KIY A;  3V1X A;  4GP1 A;  3ACX A;  3KRC A;  4LFG A;  4DI5 A;  5IM1 A;  1WKZ A;  5IN8 A;  2Q9Y A;  3LVS A;  4MC0 A;  4F62 A;  2PS6 A;  3ACY A;  5DIQ F;  5ILI A;  3RMG A;  1YYS A;  3LLW A;  5IKA A;  5DJV F;  3ZOU A;  1YYR A;  4K10 A;  1YHL A;  1YYQ A;  3PH7 A;  2VF6 A;  3SDR A;  3N49 F;  4LXW A;  3ID0 A;  2EWG A;  1N21 A;  3NPR A;  3M02 A;  1VG3 A;  3NF2 A;  1RTR A;  2Q80 A;  5JV0 F;  1FPS A;  2QIS A;  2ZCR A;  1N1Z A;  3WCJ A;  5I1U A;  5HN8 A;  1HXC A;  3CKE A;  4LTZ A;  2PS7 A;  3MZV A;  3KRF B;  3N1W F;  2F94 F;  4P0X A;  4PVX F;  4XQS F;  1DI1 A;  2Z7I A;  3DYF A;  1YQ7 A;  3TC1 A;  3LJI A;  1YJ4 A;  1WL1 A;  4XQT F;  4EA1 A;  2Q9Z A;  5B03 A;  2I19 A;  5EAS A;  1VG4 A;  3ICK A;  4GA3 A;  4DWB A;  4LLS A;  4JVJ F;  4EA0 A;  2E91 A;  3LMD A;  2F8Z F;  3LGZ B;  3KRC B;  3WEH A;  5B01 A;  2F89 F;  4KVD A;  2AEK A;  5ILY A;  3N6K F;  2OGD A;  3NPK A;  2E90 A;  2FOR A;  2AZK A;  2ONG A;  3KB9 A;  3DYG A;  3KRA A;  5B0K A;  3WCC A;  2J5C A;  1VG6 A;  1HXA A;  3WCF A;  5CG6 A;  3TFP A;  4LTV A;  4KUX A;  5IMN A;  1N23 A;  1WY0 A;  3OAC A;  5ERN A;  4LFE A;  3V1V A;  4KKM A;  3WSB A;  4P0V A;  2F92 F;  2J1O A;  4DEM F;  3AE0 A;  4PVY F;  2E8U A;  1EZF A;  1VG2 A;  3SDT A;  4H5D F;  2ZCS A;  4KVI A;  5DHI A;  3WCH A;  3WCA A;  3N3D A;  3SDV A;  3LK5 A;  3WE9 A;  5HN9 A;  4HD1 A;  3APZ A;  5B02 A;  5AHU B;  4L2X F;  3OAB A;  4LA5 A;  4EA2 A;  5JV2 F;  3W7F A;  2Z50 A;  2ZEU A;  3BNY A;  3LG5 A;  3N1V F;  4LLT A;  5E8H A;  1WL3 A;  5B0J A;  1N1B A;  3VJ8 A;  4KK2 A;  2O1O A;  5DJP F;  2OA6 A;  2Z7H A;  1PS1 A;  5ERO A;  5IK0 A;  3P8R A;  4ZQ8 A;  2J1P A;  3KBK A;  4LZ0 A;  1V4I A;  4KPD A;  3S4J A;  5B0L A;  4UMJ A;  4KPJ A;  4XQR F;  3IBA A;  3P5P A;  5DZ2 A;  3OAC B;  2AZL A;  3WEJ A;  3SDQ A;  5E8L A;  3VJD A;  2Z4V A;  5A0K A;  1WMW A;  4KVY A;  1HM4 A;  4LA6 A;  5A0I A;  3MAV A;  4OGU A;  2E95 A;  3ICM A;  3WEG A;  2F9K F;  3EFQ A;  1YHM A;  3TS7 A;  3VJ9 A;  3WSA A;  3WCB A;  2Z78 A;  3AQC B;  3S9V A;  3WJO A;  2E8T A;  3SDU A;  4QXS F;  1YV5 A;  2RAH A;  5E8K A;  3SAE A;  4GP2 A;  4KQS A;  3ICZ A;  2Z4X A;  1DGP A;  2E4O A;  5ER8 A;  3QKC A;  3N0F A;  3N3L F;  2E94 A;  5DHK A;  3ICN A;  3M00 A;  3P41 A;  3TFN A;  3RYE A;  3N5J F;  1UBY A;  5EAT A;  2PS5 A;  4P0W A;  2PS4 A;  2AZJ A;  4LUU A;  3PYA A;  1V4K A;  3CC9 A;  1HM7 A;  4MC3 A;  5IMI A;  4RXC A;  4RNQ A;  4NKF A;  3G4D A;  1N22 A;  2E8W A;  1N24 A;  2ZEV A;  5HNA A;  5ILD A;  5IKH A;  3N46 F;  3VJC A;  1UBV A;  3WCE A;  4LFV F;  4JZX A;  4JZB A;  1ZW5 A;  5DJR F;  4N1Z F;  5AFX A;  1V4E A;  4DXJ A;  3WEF A;  3WJK A;  4DZW A;  4NUA A;  1YHK A;  4LZ3 A;  3VJB A;  2FTZ A;  5C05 A;  3B7L A;  3P5R A;  3ZMC A;  5HN7 A;  4NG6 A;  1JFA A;  3M9U A;  3PDE A;  4H5C F;  4DHD A;  2Z4Z A;  2P1C A;  4OKZ A;  5AYP A;  3WCI A;  1HX9 A;  5IMP A;  3M0G A;  1RQI A;  4LIX A;  5IVG A;  4FJQ A;  3LEE A;  4LOB A;  3Q2Z A;  3IPI A;  3PKO A;  2ZCO A;  5JUZ F;  4N9U A;  4NFK F;  1YYU A;  2PS8 A;  2Q58 A;  4OMH A;  3KRA B;  5DGM F;  2DH4 A;  5AEL A;  3KRO A;  3KRP A;  4LPH F;  5B00 A;  4DWG A;  4E9U A;  3CP6 A;  5H9D A;  5ILK A;  2F8C F;  5B0M A;  5JA0 F;  3RYW A;  5IL8 A;  4KQ5 A;  4E9Z A;  3Q2Q A;  4OMG A;  5KSX F;  1V4H A;  3ASX A;  1HXG A;  2H8O A;  4LPG F;  5B0I A;  4Q23 A;  1YYT A;  5ILZ A;  3DYH A;  3LOM A;  4E1E A;  3N5H F;  5ILH A;  1VG7 A;  4NFI F;  5JV1 F;  3UCA A;  3WCM A;  3N45 F;  2F7M F;  3N0G A;  2ONH A;  3ZCD A;  3EGT A;  2AET A;  1JFG A;  2Z52 A;  1UBX A;  1N20 A;  3OAB B;  4KFA A;  4RXE A;  3LZ9 A;  4RYP A;  4JYX A;  3P8L A;  3AQB B;  3WCD A;  5CG5 A;  3V66 A;  4NFJ F;  2E8X A;  1RQJ A;  2E93 A;  3WEI A;  3TFV A;  4OKM A;  4WK5 A;  4MC8 A;  5DGN F;  5IK9 A;  3WCL A;  5A0J A;  3QQV A;  4KVW A;  3M01 A;  3G4F A;  2ZCQ A;  4F6V A;  3VJA A;  4NKE A;  3ZL6 A;  4KQU A;  3WEK A;  3RBM A;  5DW7 A;  2ZY1 A;  4JXN A;  5ERM A;  2Z4W A;  3BNX A;  2E92 A;  1UBW A;  5EAU A;  4KWD A;  4F6X A;  3NRI A;  3KRO B;  3KRP B;  5IK6 A;  2AEL A;  3ZMB A;  3EZ3 A;  3LGK A;  3WCG A;  3WJN A;  5ILJ A;  3WC9 A;  5DGS F;  3PYB A;  3KRF A;  3AQ0 A;  1KIZ A;  3LSN A;  4JXY A;  4H5E F;  3VJE A;  3Q30 A;  4RXD A;  3LDW A;  4QPF A;  1WL0 A;  2Z4Y A;  2OPM A;  1WL2 A; 
#chains in the Genus database with same CATH homology
 4RXA A;  4FP4 A;  2E8V A;  2OPN A;  3ACW A;  1V4J A;  4LZC A;  3OYR A;  5IL3 A;  3Q1O A;  4GAX A;  3ADZ A;  1KIY A;  3V1X A;  4GP1 A;  3ACX A;  3KRC A;  4LFG A;  4DI5 A;  5IM1 A;  1WKZ A;  5IN8 A;  2Q9Y A;  3LVS A;  4MC0 A;  4F62 A;  2PS6 A;  3ACY A;  5DIQ F;  5ILI A;  3RMG A;  1YYS A;  3LLW A;  5IKA A;  5DJV F;  3ZOU A;  1YYR A;  4K10 A;  1YHL A;  1YYQ A;  3PH7 A;  2VF6 A;  3SDR A;  3N49 F;  4LXW A;  3ID0 A;  2EWG A;  1N21 A;  3NPR A;  3M02 A;  1VG3 A;  3NF2 A;  1RTR A;  2Q80 A;  5JV0 F;  1FPS A;  2QIS A;  2ZCR A;  1N1Z A;  3WCJ A;  5I1U A;  5HN8 A;  1HXC A;  3CKE A;  4LTZ A;  2PS7 A;  3MZV A;  3KRF B;  3N1W F;  2F94 F;  4P0X A;  4PVX F;  4XQS F;  1DI1 A;  2Z7I A;  3DYF A;  1YQ7 A;  3TC1 A;  3LJI A;  1YJ4 A;  1WL1 A;  4XQT F;  4EA1 A;  2Q9Z A;  5B03 A;  2I19 A;  5EAS A;  1VG4 A;  3ICK A;  4GA3 A;  4DWB A;  4LLS A;  4JVJ F;  4EA0 A;  2E91 A;  3LMD A;  2F8Z F;  3LGZ B;  3KRC B;  3WEH A;  5B01 A;  2F89 F;  4KVD A;  2AEK A;  5ILY A;  3N6K F;  2OGD A;  3NPK A;  2E90 A;  2FOR A;  2AZK A;  2ONG A;  3KB9 A;  3DYG A;  3KRA A;  5B0K A;  3WCC A;  2J5C A;  1VG6 A;  1HXA A;  3WCF A;  5CG6 A;  3TFP A;  4LTV A;  4KUX A;  5IMN A;  1N23 A;  1WY0 A;  3OAC A;  5ERN A;  4LFE A;  3V1V A;  4KKM A;  3WSB A;  4P0V A;  2F92 F;  2J1O A;  4DEM F;  3AE0 A;  4PVY F;  2E8U A;  1EZF A;  1VG2 A;  3SDT A;  4H5D F;  2ZCS A;  4KVI A;  5DHI A;  3WCH A;  3WCA A;  3N3D A;  3SDV A;  3LK5 A;  3WE9 A;  5HN9 A;  4HD1 A;  3APZ A;  5B02 A;  5AHU B;  4L2X F;  3OAB A;  4LA5 A;  4EA2 A;  5JV2 F;  3W7F A;  2Z50 A;  2ZEU A;  3BNY A;  3LG5 A;  3N1V F;  4LLT A;  5E8H A;  1WL3 A;  5B0J A;  1N1B A;  3VJ8 A;  4KK2 A;  2O1O A;  5DJP F;  2OA6 A;  2Z7H A;  1PS1 A;  5ERO A;  5IK0 A;  3P8R A;  4ZQ8 A;  2J1P A;  3KBK A;  4LZ0 A;  1V4I A;  4KPD A;  3S4J A;  5B0L A;  4UMJ A;  4KPJ A;  4XQR F;  3IBA A;  3P5P A;  5DZ2 A;  3OAC B;  2AZL A;  3WEJ A;  3SDQ A;  5E8L A;  3VJD A;  2Z4V A;  5A0K A;  1WMW A;  4KVY A;  1HM4 A;  4LA6 A;  5A0I A;  3MAV A;  4OGU A;  2E95 A;  3ICM A;  3WEG A;  2F9K F;  3EFQ A;  1YHM A;  3TS7 A;  3VJ9 A;  3WSA A;  3WCB A;  2Z78 A;  3AQC B;  3S9V A;  3WJO A;  2E8T A;  3SDU A;  4QXS F;  1YV5 A;  2RAH A;  5E8K A;  3SAE A;  4GP2 A;  4KQS A;  3ICZ A;  2Z4X A;  1DGP A;  2E4O A;  5ER8 A;  3QKC A;  3N0F A;  3N3L F;  2E94 A;  5DHK A;  3ICN A;  3M00 A;  3P41 A;  3TFN A;  3RYE A;  3N5J F;  1UBY A;  5EAT A;  2PS5 A;  4P0W A;  2PS4 A;  2AZJ A;  4LUU A;  3PYA A;  1V4K A;  3CC9 A;  1HM7 A;  4MC3 A;  5IMI A;  4RXC A;  4RNQ A;  4NKF A;  3G4D A;  1N22 A;  2E8W A;  1N24 A;  2ZEV A;  5HNA A;  5ILD A;  5IKH A;  3N46 F;  3VJC A;  1UBV A;  3WCE A;  4LFV F;  4JZX A;  4JZB A;  1ZW5 A;  5DJR F;  4N1Z F;  5AFX A;  1V4E A;  4DXJ A;  3WEF A;  3WJK A;  4DZW A;  4NUA A;  1YHK A;  4LZ3 A;  3VJB A;  2FTZ A;  5C05 A;  3B7L A;  3P5R A;  3ZMC A;  5HN7 A;  4NG6 A;  1JFA A;  3M9U A;  3PDE A;  4H5C F;  4DHD A;  2Z4Z A;  2P1C A;  4OKZ A;  5AYP A;  3WCI A;  1HX9 A;  5IMP A;  3M0G A;  1RQI A;  4LIX A;  5IVG A;  4FJQ A;  3LEE A;  4LOB A;  3Q2Z A;  3IPI A;  3PKO A;  2ZCO A;  5JUZ F;  4N9U A;  4NFK F;  1YYU A;  2PS8 A;  2Q58 A;  4OMH A;  3KRA B;  5DGM F;  2DH4 A;  5AEL A;  3KRO A;  3KRP A;  4LPH F;  5B00 A;  4DWG A;  4E9U A;  3CP6 A;  5H9D A;  5ILK A;  2F8C F;  5B0M A;  5JA0 F;  3RYW A;  5IL8 A;  4KQ5 A;  4E9Z A;  3Q2Q A;  4OMG A;  5KSX F;  1V4H A;  3ASX A;  1HXG A;  2H8O A;  4LPG F;  5B0I A;  4Q23 A;  1YYT A;  5ILZ A;  3DYH A;  3LOM A;  4E1E A;  3N5H F;  5ILH A;  1VG7 A;  4NFI F;  5JV1 F;  3UCA A;  3WCM A;  3N45 F;  2F7M F;  3N0G A;  2ONH A;  3ZCD A;  3EGT A;  2AET A;  1JFG A;  2Z52 A;  1UBX A;  1N20 A;  3OAB B;  4KFA A;  4RXE A;  3LZ9 A;  4RYP A;  4JYX A;  3P8L A;  3AQB B;  3WCD A;  5CG5 A;  3V66 A;  4NFJ F;  2E8X A;  1RQJ A;  2E93 A;  3WEI A;  3TFV A;  4OKM A;  4WK5 A;  4MC8 A;  5DGN F;  5IK9 A;  3WCL A;  5A0J A;  3QQV A;  4KVW A;  3M01 A;  3G4F A;  2ZCQ A;  4F6V A;  3VJA A;  4NKE A;  3ZL6 A;  4KQU A;  3WEK A;  3RBM A;  5DW7 A;  2ZY1 A;  4JXN A;  5ERM A;  2Z4W A;  3BNX A;  2E92 A;  1UBW A;  5EAU A;  4KWD A;  4F6X A;  3NRI A;  3KRO B;  3KRP B;  5IK6 A;  2AEL A;  3ZMB A;  3EZ3 A;  3LGK A;  3WCG A;  3WJN A;  5ILJ A;  3WC9 A;  5DGS F;  3PYB A;  3KRF A;  3AQ0 A;  1KIZ A;  3LSN A;  4JXY A;  4H5E F;  3VJE A;  3Q30 A;  4RXD A;  3LDW A;  4QPF A;  1WL0 A;  2Z4Y A;  2OPM A;  1WL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...