3VJDA

Crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIAIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dehydrosqualene synthase
publication title Binding modes of zaragozic acid A to human squalene synthase and staphylococcal dehydrosqualene synthase
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 122
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3vjdA00
3KROA 1VG7A 5AYPA 4E9ZA 2E91A 3KRPA 4UMJA 4KPJA 1JFAA 4LFVF 5B0MA 5IK0A 3NPKA 3KRFA 4F6VA 3OABA 3ZL6A 2Z52A 3WCBA 2ZCQA 3DYGA 3M01A 3WSAA 3PH7A 4WK5A 3WEKA 2F8CF 3LVSA 4LA5A 4GP1A 4KFAA 5JV1F 1VG4A 5ER8A 4KQ5A 4N9UA 4RXDA 3WEIA 4KK2A 1N1BA 2F9KF 2Q9YA 3LG5A 3WCMA 2RAHA 2OPMA 4LZ3A 1VG2A 2AELA 2AETA 3P41A 4H5CF 2PS4A 4HD1A 3RYEA 5I1UA 4KKMA 1HM7A 3N0GA 1YJ4A 3P5PA 1RQIA 2PS5A 1KIYA 2ZY1A 5JUZF 3UCAA 2F7MF 4XQSF 3Q30A 4E9UA 4F62A 2H8OA 5B0JA 1YYUA 5AHUB 4LIXA 3VJCA 1DGPA 4EA1A 4LFEA 4LFGA 1V4KA 4JZBA 1N1ZA 3M00A 4KPDA 5ILHA 3N6KF 4JXNA 3LSNA 4LXWA 2F8ZF 1UBYA 2E8UA 3WCEA 4OKZA 4RYPA 4JVJF 3ZOUA 1WMWA 3W7FA 4PVXF 4LOBA 2AZJA 4QXSF 3RMGA 4GA3A 5DJRF 3ICKA 4OMHA 4EA2A 4JXYA 3PKOA 2E94A 1WL0A 2ZEUA 1DI1A 4MC0A 3KRCB 3BNXA 5ERNA 2E93A 3WCAA 4OKMA 1N24A 3LOMA 4LPGF 2F89F 5JA0F 1V4IA 5DGSF 5ILJA 3V1XA 4KQSA 1HX9A 1JFGA 4XQTF 2OA6A 5DHKA 5B03A 4PVYF 3VJEA 2J5CA 3OACB 1PS1A 2F94F 2J1PA 3CKEA 3IPIA 3KBKA 2PS6A 3LGKA 3P5RA 4KVIA 3WE9A 2E8VA 5JV0F 2Z4YA 4RXEA 3TC1A 2OGDA 3WEJA 3N5HF 5DJPF 3WC9A 2P1CA 3KRAB 3S9VA 2AZKA 3Q2ZA 3TFNA 3WJKA 5E8HA 1FPSA 1N23A 5IMPA 3N49F 3G4DA 4NFKF 5ERMA 5HN7A 2ONGA 3LJIA 1HXAA 4NG6A 3WCJA 4LZCA 3WEGA 4H5DF 3LGZB 5ILIA 3CC9A 5C05A 1WL1A 2AEKA 3EFQA 4Q23A 5EASA 3ACYA 1YQ7A 3KROB 3VJBA 5B0KA 3KRPB 3SDTA 3ZMBA 3RYWA 3N5JF 2Z4VA 3KRFB 3WJOA 3WCIA 4OGUA 3SDVA 4MC8A 2E90A 2E95A 3BNYA 2E8TA 3OABB 5IK9A 3M9UA 5DGMF 1EZFA 4KVDA 1YYTA 3WCDA 5DW7A 3TFPA 2Z7IA 3WEHA 3VJ9A 3ZMCA 3AQ0A 3IBAA 3Q1OA 4P0XA 3WCLA 4DXJA 3NPRA 1WKZA 5DHIA 2E4OA 2ZCSA 3DYHA 5AELA 4NUAA 1RTRA 3AQBB 4DZWA 1HXCA 3TS7A 1V4HA 3N3LF 3APZA 3LDWA 5IMNA 2FTZA 4LTVA 5IKHA 3EZ3A 2ONHA 3V66A 2PS7A 3ID0A 1YYRA 4JYXA 3PYBA 3G4FA 3N46F 4KQUA 4LUUA 5KSXF 3RBMA 1YHMA 4EA0A 5ILDA 1N22A 3N1WF 4JZXA 3M02A 4P0VA 3S4JA 1KIZA 5EATA 3NRIA 4E1EA 2J1OA 4K10A 3B7LA 1WL3A 3EGTA 5EAUA 1UBWA 5E8LA 5B0IA 2OPNA 3ACXA 2ZCOA 3TFVA 1YYSA 3N45F 5HN9A 3WJNA 4ZQ8A 5DIQF 3WCGA 2Q58A 3ADZA 3ZCDA 5ILZA 1WY0A 3LK5A 4LA6A 5B00A 5IVGA 3WCFA 1YYQA 4LLSA 5B01A 2Z7HA 3WCHA 3N3DA 3LEEA 5IK6A 4LPHF 3WSBA 3AE0A 4NFJF 3WEFA 5DZ2A 4MC3A 4RXCA 5A0KA 1VG6A 3M0GA 3ASXA 4P0WA 4N1ZF 5DGNF 2E92A 2I19A 1UBXA 4OMGA 5HN8A 4DEMF 3N1VF 3PDEA 3SDUA 1N20A 3QKCA 5CG6A 4NKFA 3LLWA 3ICZA 5DJVF 3ICMA 3VJAA 2ZCRA 4LTZA 4RXAA 5E8KA 4KUXA 3V1VA 3QQVA 3ICNA 3PYAA 5B0LA 3NF2A 3CP6A 2FORA 3KRCA 5ILYA 3DYFA 4DWBA 3AQCB 2Q9ZA 1WL2A 2E8WA 4RNQA 1HM4A 5AFXA 4NFIF 2DH4A 1YHLA 5CG5A 3OACA 3Q2QA 1HXGA 4FP4A 4DHDA 3VJDA 1UBVA 4LLTA 4KVWA 4FJQA 4LZ0A 5JV2F 3OYRA 4QPFA 2Z4WA 1ZW5A 2F92F 3ACWA 2Z4XA 2Z78A 1N21A 5EROA 3LMDA 4NKEA 3VJ8A 5H9DA 5HNAA 5B02A 3KRAA 4F6XA 4DWGA 2E8XA 2Q80A 4GAXA 3MAVA 5A0JA 2VF6A 3MZVA 2ZEVA 1V4EA 3SDQA 3WCCA 1YHKA 5IL8A 3N0FA 2Z50A 1V4JA 5IL3A 4KWDA 1VG3A 5IMIA 1RQJA 3SDRA 3LZ9A 5IKAA 4DI5A 3SAEA 5ILKA 3KB9A 4L2XF 4XQRF 5IN8A 2Z4ZA 4GP2A 3P8RA 4H5EF 2QISA 2EWGA 2AZLA 5IM1A 1YV5A 2O1OA 5A0IA 4KVYA 2PS8A 3P8LA
chains in the Genus database with same CATH superfamily
3KROA 1VG7A 5AYPA 4E9ZA 2E91A 3KRPA 4UMJA 4KPJA 1JFAA 4LFVF 5B0MA 5IK0A 3NPKA 3KRFA 4F6VA 3OABA 3ZL6A 2Z52A 3WCBA 2ZCQA 3DYGA 3M01A 3WSAA 3PH7A 4WK5A 3WEKA 2F8CF 3LVSA 4LA5A 4GP1A 4KFAA 5JV1F 1VG4A 5ER8A 4KQ5A 4N9UA 4RXDA 3WEIA 4KK2A 1N1BA 2F9KF 2Q9YA 3LG5A 3WCMA 2RAHA 2OPMA 4LZ3A 1VG2A 2AELA 2AETA 3P41A 4H5CF 2PS4A 4HD1A 3RYEA 5I1UA 4KKMA 1HM7A 3N0GA 1YJ4A 3P5PA 1RQIA 2PS5A 1KIYA 2ZY1A 5JUZF 3UCAA 2F7MF 4XQSF 3Q30A 4E9UA 4F62A 2H8OA 5B0JA 1YYUA 5AHUB 4LIXA 3VJCA 1DGPA 4EA1A 4LFEA 4LFGA 1V4KA 4JZBA 1N1ZA 3M00A 4KPDA 5ILHA 3N6KF 4JXNA 3LSNA 4LXWA 2F8ZF 1UBYA 2E8UA 3WCEA 4OKZA 4RYPA 4JVJF 3ZOUA 1WMWA 3W7FA 4PVXF 4LOBA 2AZJA 4QXSF 3RMGA 4GA3A 5DJRF 3ICKA 4OMHA 4EA2A 4JXYA 3PKOA 2E94A 1WL0A 2ZEUA 1DI1A 4MC0A 3KRCB 3BNXA 5ERNA 2E93A 3WCAA 4OKMA 1N24A 3LOMA 4LPGF 2F89F 5JA0F 1V4IA 5DGSF 5ILJA 3V1XA 4KQSA 1HX9A 1JFGA 4XQTF 2OA6A 5DHKA 5B03A 4PVYF 3VJEA 2J5CA 3OACB 1PS1A 2F94F 2J1PA 3CKEA 3IPIA 3KBKA 2PS6A 3LGKA 3P5RA 4KVIA 3WE9A 2E8VA 5JV0F 2Z4YA 4RXEA 3TC1A 2OGDA 3WEJA 3N5HF 5DJPF 3WC9A 2P1CA 3KRAB 3S9VA 2AZKA 3Q2ZA 3TFNA 3WJKA 5E8HA 1FPSA 1N23A 5IMPA 3N49F 3G4DA 4NFKF 5ERMA 5HN7A 2ONGA 3LJIA 1HXAA 4NG6A 3WCJA 4LZCA 3WEGA 4H5DF 3LGZB 5ILIA 3CC9A 5C05A 1WL1A 2AEKA 3EFQA 4Q23A 5EASA 3ACYA 1YQ7A 3KROB 3VJBA 5B0KA 3KRPB 3SDTA 3ZMBA 3RYWA 3N5JF 2Z4VA 3KRFB 3WJOA 3WCIA 4OGUA 3SDVA 4MC8A 2E90A 2E95A 3BNYA 2E8TA 3OABB 5IK9A 3M9UA 5DGMF 1EZFA 4KVDA 1YYTA 3WCDA 5DW7A 3TFPA 2Z7IA 3WEHA 3VJ9A 3ZMCA 3AQ0A 3IBAA 3Q1OA 4P0XA 3WCLA 4DXJA 3NPRA 1WKZA 5DHIA 2E4OA 2ZCSA 3DYHA 5AELA 4NUAA 1RTRA 3AQBB 4DZWA 1HXCA 3TS7A 1V4HA 3N3LF 3APZA 3LDWA 5IMNA 2FTZA 4LTVA 5IKHA 3EZ3A 2ONHA 3V66A 2PS7A 3ID0A 1YYRA 4JYXA 3PYBA 3G4FA 3N46F 4KQUA 4LUUA 5KSXF 3RBMA 1YHMA 4EA0A 5ILDA 1N22A 3N1WF 4JZXA 3M02A 4P0VA 3S4JA 1KIZA 5EATA 3NRIA 4E1EA 2J1OA 4K10A 3B7LA 1WL3A 3EGTA 5EAUA 1UBWA 5E8LA 5B0IA 2OPNA 3ACXA 2ZCOA 3TFVA 1YYSA 3N45F 5HN9A 3WJNA 4ZQ8A 5DIQF 3WCGA 2Q58A 3ADZA 3ZCDA 5ILZA 1WY0A 3LK5A 4LA6A 5B00A 5IVGA 3WCFA 1YYQA 4LLSA 5B01A 2Z7HA 3WCHA 3N3DA 3LEEA 5IK6A 4LPHF 3WSBA 3AE0A 4NFJF 3WEFA 5DZ2A 4MC3A 4RXCA 5A0KA 1VG6A 3M0GA 3ASXA 4P0WA 4N1ZF 5DGNF 2E92A 2I19A 1UBXA 4OMGA 5HN8A 4DEMF 3N1VF 3PDEA 3SDUA 1N20A 3QKCA 5CG6A 4NKFA 3LLWA 3ICZA 5DJVF 3ICMA 3VJAA 2ZCRA 4LTZA 4RXAA 5E8KA 4KUXA 3V1VA 3QQVA 3ICNA 3PYAA 5B0LA 3NF2A 3CP6A 2FORA 3KRCA 5ILYA 3DYFA 4DWBA 3AQCB 2Q9ZA 1WL2A 2E8WA 4RNQA 1HM4A 5AFXA 4NFIF 2DH4A 1YHLA 5CG5A 3OACA 3Q2QA 1HXGA 4FP4A 4DHDA 3VJDA 1UBVA 4LLTA 4KVWA 4FJQA 4LZ0A 5JV2F 3OYRA 4QPFA 2Z4WA 1ZW5A 2F92F 3ACWA 2Z4XA 2Z78A 1N21A 5EROA 3LMDA 4NKEA 3VJ8A 5H9DA 5HNAA 5B02A 3KRAA 4F6XA 4DWGA 2E8XA 2Q80A 4GAXA 3MAVA 5A0JA 2VF6A 3MZVA 2ZEVA 1V4EA 3SDQA 3WCCA 1YHKA 5IL8A 3N0FA 2Z50A 1V4JA 5IL3A 4KWDA 1VG3A 5IMIA 1RQJA 3SDRA 3LZ9A 5IKAA 4DI5A 3SAEA 5ILKA 3KB9A 4L2XF 4XQRF 5IN8A 2Z4ZA 4GP2A 3P8RA 4H5EF 2QISA 2EWGA 2AZLA 5IM1A 1YV5A 2O1OA 5A0IA 4KVYA 2PS8A 3P8LA
chains in the Genus database with same CATH topology
3KROA 1VG7A 5AYPA 4E9ZA 2E91A 3KRPA 4UMJA 4KPJA 1JFAA 4LFVF 5B0MA 5IK0A 3NPKA 3KRFA 4F6VA 3OABA 3ZL6A 2Z52A 3WCBA 2ZCQA 3DYGA 3M01A 3WSAA 3PH7A 4WK5A 3WEKA 2F8CF 3LVSA 4LA5A 4GP1A 4KFAA 5JV1F 1VG4A 5ER8A 4KQ5A 4N9UA 4RXDA 3WEIA 4KK2A 1N1BA 2F9KF 2Q9YA 3LG5A 3WCMA 2RAHA 2OPMA 4LZ3A 1VG2A 2AELA 2AETA 3P41A 4H5CF 2PS4A 4HD1A 3RYEA 5I1UA 4KKMA 1HM7A 3N0GA 1YJ4A 3P5PA 1RQIA 2PS5A 1KIYA 2ZY1A 5JUZF 3UCAA 2F7MF 4XQSF 3Q30A 4E9UA 4F62A 2H8OA 5B0JA 1YYUA 5AHUB 4LIXA 3VJCA 1DGPA 4EA1A 4LFEA 4LFGA 1V4KA 4JZBA 1N1ZA 3M00A 4KPDA 5ILHA 3N6KF 4JXNA 3LSNA 4LXWA 2F8ZF 1UBYA 2E8UA 3WCEA 4OKZA 4RYPA 4JVJF 3ZOUA 1WMWA 3W7FA 4PVXF 4LOBA 2AZJA 4QXSF 3RMGA 4GA3A 5DJRF 3ICKA 4OMHA 4EA2A 4JXYA 3PKOA 2E94A 1WL0A 2ZEUA 1DI1A 4MC0A 3KRCB 3BNXA 5ERNA 2E93A 3WCAA 4OKMA 1N24A 3LOMA 4LPGF 2F89F 5JA0F 1V4IA 5DGSF 5ILJA 3V1XA 4KQSA 1HX9A 1JFGA 4XQTF 2OA6A 5DHKA 5B03A 4PVYF 3VJEA 2J5CA 3OACB 1PS1A 2F94F 2J1PA 3CKEA 3IPIA 3KBKA 2PS6A 3LGKA 3P5RA 4KVIA 3WE9A 2E8VA 5JV0F 2Z4YA 4RXEA 3TC1A 2OGDA 3WEJA 3N5HF 5DJPF 3WC9A 2P1CA 3KRAB 3S9VA 2AZKA 3Q2ZA 3TFNA 3WJKA 5E8HA 1FPSA 1N23A 5IMPA 3N49F 3G4DA 4NFKF 5ERMA 5HN7A 2ONGA 3LJIA 1HXAA 4NG6A 3WCJA 4LZCA 3WEGA 4H5DF 3LGZB 5ILIA 3CC9A 5C05A 1WL1A 2AEKA 3EFQA 4Q23A 5EASA 3ACYA 1YQ7A 3KROB 3VJBA 5B0KA 3KRPB 3SDTA 3ZMBA 3RYWA 3N5JF 2Z4VA 3KRFB 3WJOA 3WCIA 4OGUA 3SDVA 4MC8A 2E90A 2E95A 3BNYA 2E8TA 3OABB 5IK9A 3M9UA 5DGMF 1EZFA 4KVDA 1YYTA 3WCDA 5DW7A 3TFPA 2Z7IA 3WEHA 3VJ9A 3ZMCA 3AQ0A 3IBAA 3Q1OA 4P0XA 3WCLA 4DXJA 3NPRA 1WKZA 5DHIA 2E4OA 2ZCSA 3DYHA 5AELA 4NUAA 1RTRA 3AQBB 4DZWA 1HXCA 3TS7A 1V4HA 3N3LF 3APZA 3LDWA 5IMNA 2FTZA 4LTVA 5IKHA 3EZ3A 2ONHA 3V66A 2PS7A 3ID0A 1YYRA 4JYXA 3PYBA 3G4FA 3N46F 4KQUA 4LUUA 5KSXF 3RBMA 1YHMA 4EA0A 5ILDA 1N22A 3N1WF 4JZXA 3M02A 4P0VA 3S4JA 1KIZA 5EATA 3NRIA 4E1EA 2J1OA 4K10A 3B7LA 1WL3A 3EGTA 5EAUA 1UBWA 5E8LA 5B0IA 2OPNA 3ACXA 2ZCOA 3TFVA 1YYSA 3N45F 5HN9A 3WJNA 4ZQ8A 5DIQF 3WCGA 2Q58A 3ADZA 3ZCDA 5ILZA 1WY0A 3LK5A 4LA6A 5B00A 5IVGA 3WCFA 1YYQA 4LLSA 5B01A 2Z7HA 3WCHA 3N3DA 3LEEA 5IK6A 4LPHF 3WSBA 3AE0A 4NFJF 3WEFA 5DZ2A 4MC3A 4RXCA 5A0KA 1VG6A 3M0GA 3ASXA 4P0WA 4N1ZF 5DGNF 2E92A 2I19A 1UBXA 4OMGA 5HN8A 4DEMF 3N1VF 3PDEA 3SDUA 1N20A 3QKCA 5CG6A 4NKFA 3LLWA 3ICZA 5DJVF 3ICMA 3VJAA 2ZCRA 4LTZA 4RXAA 5E8KA 4KUXA 3V1VA 3QQVA 3ICNA 3PYAA 5B0LA 3NF2A 3CP6A 2FORA 3KRCA 5ILYA 3DYFA 4DWBA 3AQCB 2Q9ZA 1WL2A 2E8WA 4RNQA 1HM4A 5AFXA 4NFIF 2DH4A 1YHLA 5CG5A 3OACA 3Q2QA 1HXGA 4FP4A 4DHDA 3VJDA 1UBVA 4LLTA 4KVWA 4FJQA 4LZ0A 5JV2F 3OYRA 4QPFA 2Z4WA 1ZW5A 2F92F 3ACWA 2Z4XA 2Z78A 1N21A 5EROA 3LMDA 4NKEA 3VJ8A 5H9DA 5HNAA 5B02A 3KRAA 4F6XA 4DWGA 2E8XA 2Q80A 4GAXA 3MAVA 5A0JA 2VF6A 3MZVA 2ZEVA 1V4EA 3SDQA 3WCCA 1YHKA 5IL8A 3N0FA 2Z50A 1V4JA 5IL3A 4KWDA 1VG3A 5IMIA 1RQJA 3SDRA 3LZ9A 5IKAA 4DI5A 3SAEA 5ILKA 3KB9A 4L2XF 4XQRF 5IN8A 2Z4ZA 4GP2A 3P8RA 4H5EF 2QISA 2EWGA 2AZLA 5IM1A 1YV5A 2O1OA 5A0IA 4KVYA 2PS8A 3P8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRO A;  1VG7 A;  5AYP A;  4E9Z A;  2E91 A;  3KRP A;  4UMJ A;  4KPJ A;  1JFA A;  4LFV F;  5B0M A;  5IK0 A;  3NPK A;  3KRF A;  4F6V A;  3OAB A;  3ZL6 A;  2Z52 A;  3WCB A;  2ZCQ A;  3DYG A;  3M01 A;  3WSA A;  3PH7 A;  4WK5 A;  3WEK A;  2F8C F;  3LVS A;  4LA5 A;  4GP1 A;  4KFA A;  5JV1 F;  1VG4 A;  5ER8 A;  4KQ5 A;  4N9U A;  4RXD A;  3WEI A;  4KK2 A;  1N1B A;  2F9K F;  2Q9Y A;  3LG5 A;  3WCM A;  2RAH A;  2OPM A;  4LZ3 A;  1VG2 A;  2AEL A;  2AET A;  3P41 A;  4H5C F;  2PS4 A;  4HD1 A;  3RYE A;  5I1U A;  4KKM A;  1HM7 A;  3N0G A;  1YJ4 A;  3P5P A;  1RQI A;  2PS5 A;  1KIY A;  2ZY1 A;  5JUZ F;  3UCA A;  2F7M F;  4XQS F;  3Q30 A;  4E9U A;  4F62 A;  2H8O A;  5B0J A;  1YYU A;  5AHU B;  4LIX A;  3VJC A;  1DGP A;  4EA1 A;  4LFE A;  4LFG A;  1V4K A;  4JZB A;  1N1Z A;  3M00 A;  4KPD A;  5ILH A;  3N6K F;  4JXN A;  3LSN A;  4LXW A;  2F8Z F;  1UBY A;  2E8U A;  3WCE A;  4OKZ A;  4RYP A;  4JVJ F;  3ZOU A;  1WMW A;  3W7F A;  4PVX F;  4LOB A;  2AZJ A;  4QXS F;  3RMG A;  4GA3 A;  5DJR F;  3ICK A;  4OMH A;  4EA2 A;  4JXY A;  3PKO A;  2E94 A;  1WL0 A;  2ZEU A;  1DI1 A;  4MC0 A;  3KRC B;  3BNX A;  5ERN A;  2E93 A;  3WCA A;  4OKM A;  1N24 A;  3LOM A;  4LPG F;  2F89 F;  5JA0 F;  1V4I A;  5DGS F;  5ILJ A;  3V1X A;  4KQS A;  1HX9 A;  1JFG A;  4XQT F;  2OA6 A;  5DHK A;  5B03 A;  4PVY F;  3VJE A;  2J5C A;  3OAC B;  1PS1 A;  2F94 F;  2J1P A;  3CKE A;  3IPI A;  3KBK A;  2PS6 A;  3LGK A;  3P5R A;  4KVI A;  3WE9 A;  2E8V A;  5JV0 F;  2Z4Y A;  4RXE A;  3TC1 A;  2OGD A;  3WEJ A;  3N5H F;  5DJP F;  3WC9 A;  2P1C A;  3KRA B;  3S9V A;  2AZK A;  3Q2Z A;  3TFN A;  3WJK A;  5E8H A;  1FPS A;  1N23 A;  5IMP A;  3N49 F;  3G4D A;  4NFK F;  5ERM A;  5HN7 A;  2ONG A;  3LJI A;  1HXA A;  4NG6 A;  3WCJ A;  4LZC A;  3WEG A;  4H5D F;  3LGZ B;  5ILI A;  3CC9 A;  5C05 A;  1WL1 A;  2AEK A;  3EFQ A;  4Q23 A;  5EAS A;  3ACY A;  1YQ7 A;  3KRO B;  3VJB A;  5B0K A;  3KRP B;  3SDT A;  3ZMB A;  3RYW A;  3N5J F;  2Z4V A;  3KRF B;  3WJO A;  3WCI A;  4OGU A;  3SDV A;  4MC8 A;  2E90 A;  2E95 A;  3BNY A;  2E8T A;  3OAB B;  5IK9 A;  3M9U A;  5DGM F;  1EZF A;  4KVD A;  1YYT A;  3WCD A;  5DW7 A;  3TFP A;  2Z7I A;  3WEH A;  3VJ9 A;  3ZMC A;  3AQ0 A;  3IBA A;  3Q1O A;  4P0X A;  3WCL A;  4DXJ A;  3NPR A;  1WKZ A;  5DHI A;  2E4O A;  2ZCS A;  3DYH A;  5AEL A;  4NUA A;  1RTR A;  3AQB B;  4DZW A;  1HXC A;  3TS7 A;  1V4H A;  3N3L F;  3APZ A;  3LDW A;  5IMN A;  2FTZ A;  4LTV A;  5IKH A;  3EZ3 A;  2ONH A;  3V66 A;  2PS7 A;  3ID0 A;  1YYR A;  4JYX A;  3PYB A;  3G4F A;  3N46 F;  4KQU A;  4LUU A;  5KSX F;  3RBM A;  1YHM A;  4EA0 A;  5ILD A;  1N22 A;  3N1W F;  4JZX A;  3M02 A;  4P0V A;  3S4J A;  1KIZ A;  5EAT A;  3NRI A;  4E1E A;  2J1O A;  4K10 A;  3B7L A;  1WL3 A;  3EGT A;  5EAU A;  1UBW A;  5E8L A;  5B0I A;  2OPN A;  3ACX A;  2ZCO A;  3TFV A;  1YYS A;  3N45 F;  5HN9 A;  3WJN A;  4ZQ8 A;  5DIQ F;  3WCG A;  2Q58 A;  3ADZ A;  3ZCD A;  5ILZ A;  1WY0 A;  3LK5 A;  4LA6 A;  5B00 A;  5IVG A;  3WCF A;  1YYQ A;  4LLS A;  5B01 A;  2Z7H A;  3WCH A;  3N3D A;  3LEE A;  5IK6 A;  4LPH F;  3WSB A;  3AE0 A;  4NFJ F;  3WEF A;  5DZ2 A;  4MC3 A;  4RXC A;  5A0K A;  1VG6 A;  3M0G A;  3ASX A;  4P0W A;  4N1Z F;  5DGN F;  2E92 A;  2I19 A;  1UBX A;  4OMG A;  5HN8 A;  4DEM F;  3N1V F;  3PDE A;  3SDU A;  1N20 A;  3QKC A;  5CG6 A;  4NKF A;  3LLW A;  3ICZ A;  5DJV F;  3ICM A;  3VJA A;  2ZCR A;  4LTZ A;  4RXA A;  5E8K A;  4KUX A;  3V1V A;  3QQV A;  3ICN A;  3PYA A;  5B0L A;  3NF2 A;  3CP6 A;  2FOR A;  3KRC A;  5ILY A;  3DYF A;  4DWB A;  3AQC B;  2Q9Z A;  1WL2 A;  2E8W A;  4RNQ A;  1HM4 A;  5AFX A;  4NFI F;  2DH4 A;  1YHL A;  5CG5 A;  3OAC A;  3Q2Q A;  1HXG A;  4FP4 A;  4DHD A;  3VJD A;  1UBV A;  4LLT A;  4KVW A;  4FJQ A;  4LZ0 A;  5JV2 F;  3OYR A;  4QPF A;  2Z4W A;  1ZW5 A;  2F92 F;  3ACW A;  2Z4X A;  2Z78 A;  1N21 A;  5ERO A;  3LMD A;  4NKE A;  3VJ8 A;  5H9D A;  5HNA A;  5B02 A;  3KRA A;  4F6X A;  4DWG A;  2E8X A;  2Q80 A;  4GAX A;  3MAV A;  5A0J A;  2VF6 A;  3MZV A;  2ZEV A;  1V4E A;  3SDQ A;  3WCC A;  1YHK A;  5IL8 A;  3N0F A;  2Z50 A;  1V4J A;  5IL3 A;  4KWD A;  1VG3 A;  5IMI A;  1RQJ A;  3SDR A;  3LZ9 A;  5IKA A;  4DI5 A;  3SAE A;  5ILK A;  3KB9 A;  4L2X F;  4XQR F;  5IN8 A;  2Z4Z A;  4GP2 A;  3P8R A;  4H5E F;  2QIS A;  2EWG A;  2AZL A;  5IM1 A;  1YV5 A;  2O1O A;  5A0I A;  4KVY A;  2PS8 A;  3P8L A; 
#chains in the Genus database with same CATH topology
 3KRO A;  1VG7 A;  5AYP A;  4E9Z A;  2E91 A;  3KRP A;  4UMJ A;  4KPJ A;  1JFA A;  4LFV F;  5B0M A;  5IK0 A;  3NPK A;  3KRF A;  4F6V A;  3OAB A;  3ZL6 A;  2Z52 A;  3WCB A;  2ZCQ A;  3DYG A;  3M01 A;  3WSA A;  3PH7 A;  4WK5 A;  3WEK A;  2F8C F;  3LVS A;  4LA5 A;  4GP1 A;  4KFA A;  5JV1 F;  1VG4 A;  5ER8 A;  4KQ5 A;  4N9U A;  4RXD A;  3WEI A;  4KK2 A;  1N1B A;  2F9K F;  2Q9Y A;  3LG5 A;  3WCM A;  2RAH A;  2OPM A;  4LZ3 A;  1VG2 A;  2AEL A;  2AET A;  3P41 A;  4H5C F;  2PS4 A;  4HD1 A;  3RYE A;  5I1U A;  4KKM A;  1HM7 A;  3N0G A;  1YJ4 A;  3P5P A;  1RQI A;  2PS5 A;  1KIY A;  2ZY1 A;  5JUZ F;  3UCA A;  2F7M F;  4XQS F;  3Q30 A;  4E9U A;  4F62 A;  2H8O A;  5B0J A;  1YYU A;  5AHU B;  4LIX A;  3VJC A;  1DGP A;  4EA1 A;  4LFE A;  4LFG A;  1V4K A;  4JZB A;  1N1Z A;  3M00 A;  4KPD A;  5ILH A;  3N6K F;  4JXN A;  3LSN A;  4LXW A;  2F8Z F;  1UBY A;  2E8U A;  3WCE A;  4OKZ A;  4RYP A;  4JVJ F;  3ZOU A;  1WMW A;  3W7F A;  4PVX F;  4LOB A;  2AZJ A;  4QXS F;  3RMG A;  4GA3 A;  5DJR F;  3ICK A;  4OMH A;  4EA2 A;  4JXY A;  3PKO A;  2E94 A;  1WL0 A;  2ZEU A;  1DI1 A;  4MC0 A;  3KRC B;  3BNX A;  5ERN A;  2E93 A;  3WCA A;  4OKM A;  1N24 A;  3LOM A;  4LPG F;  2F89 F;  5JA0 F;  1V4I A;  5DGS F;  5ILJ A;  3V1X A;  4KQS A;  1HX9 A;  1JFG A;  4XQT F;  2OA6 A;  5DHK A;  5B03 A;  4PVY F;  3VJE A;  2J5C A;  3OAC B;  1PS1 A;  2F94 F;  2J1P A;  3CKE A;  3IPI A;  3KBK A;  2PS6 A;  3LGK A;  3P5R A;  4KVI A;  3WE9 A;  2E8V A;  5JV0 F;  2Z4Y A;  4RXE A;  3TC1 A;  2OGD A;  3WEJ A;  3N5H F;  5DJP F;  3WC9 A;  2P1C A;  3KRA B;  3S9V A;  2AZK A;  3Q2Z A;  3TFN A;  3WJK A;  5E8H A;  1FPS A;  1N23 A;  5IMP A;  3N49 F;  3G4D A;  4NFK F;  5ERM A;  5HN7 A;  2ONG A;  3LJI A;  1HXA A;  4NG6 A;  3WCJ A;  4LZC A;  3WEG A;  4H5D F;  3LGZ B;  5ILI A;  3CC9 A;  5C05 A;  1WL1 A;  2AEK A;  3EFQ A;  4Q23 A;  5EAS A;  3ACY A;  1YQ7 A;  3KRO B;  3VJB A;  5B0K A;  3KRP B;  3SDT A;  3ZMB A;  3RYW A;  3N5J F;  2Z4V A;  3KRF B;  3WJO A;  3WCI A;  4OGU A;  3SDV A;  4MC8 A;  2E90 A;  2E95 A;  3BNY A;  2E8T A;  3OAB B;  5IK9 A;  3M9U A;  5DGM F;  1EZF A;  4KVD A;  1YYT A;  3WCD A;  5DW7 A;  3TFP A;  2Z7I A;  3WEH A;  3VJ9 A;  3ZMC A;  3AQ0 A;  3IBA A;  3Q1O A;  4P0X A;  3WCL A;  4DXJ A;  3NPR A;  1WKZ A;  5DHI A;  2E4O A;  2ZCS A;  3DYH A;  5AEL A;  4NUA A;  1RTR A;  3AQB B;  4DZW A;  1HXC A;  3TS7 A;  1V4H A;  3N3L F;  3APZ A;  3LDW A;  5IMN A;  2FTZ A;  4LTV A;  5IKH A;  3EZ3 A;  2ONH A;  3V66 A;  2PS7 A;  3ID0 A;  1YYR A;  4JYX A;  3PYB A;  3G4F A;  3N46 F;  4KQU A;  4LUU A;  5KSX F;  3RBM A;  1YHM A;  4EA0 A;  5ILD A;  1N22 A;  3N1W F;  4JZX A;  3M02 A;  4P0V A;  3S4J A;  1KIZ A;  5EAT A;  3NRI A;  4E1E A;  2J1O A;  4K10 A;  3B7L A;  1WL3 A;  3EGT A;  5EAU A;  1UBW A;  5E8L A;  5B0I A;  2OPN A;  3ACX A;  2ZCO A;  3TFV A;  1YYS A;  3N45 F;  5HN9 A;  3WJN A;  4ZQ8 A;  5DIQ F;  3WCG A;  2Q58 A;  3ADZ A;  3ZCD A;  5ILZ A;  1WY0 A;  3LK5 A;  4LA6 A;  5B00 A;  5IVG A;  3WCF A;  1YYQ A;  4LLS A;  5B01 A;  2Z7H A;  3WCH A;  3N3D A;  3LEE A;  5IK6 A;  4LPH F;  3WSB A;  3AE0 A;  4NFJ F;  3WEF A;  5DZ2 A;  4MC3 A;  4RXC A;  5A0K A;  1VG6 A;  3M0G A;  3ASX A;  4P0W A;  4N1Z F;  5DGN F;  2E92 A;  2I19 A;  1UBX A;  4OMG A;  5HN8 A;  4DEM F;  3N1V F;  3PDE A;  3SDU A;  1N20 A;  3QKC A;  5CG6 A;  4NKF A;  3LLW A;  3ICZ A;  5DJV F;  3ICM A;  3VJA A;  2ZCR A;  4LTZ A;  4RXA A;  5E8K A;  4KUX A;  3V1V A;  3QQV A;  3ICN A;  3PYA A;  5B0L A;  3NF2 A;  3CP6 A;  2FOR A;  3KRC A;  5ILY A;  3DYF A;  4DWB A;  3AQC B;  2Q9Z A;  1WL2 A;  2E8W A;  4RNQ A;  1HM4 A;  5AFX A;  4NFI F;  2DH4 A;  1YHL A;  5CG5 A;  3OAC A;  3Q2Q A;  1HXG A;  4FP4 A;  4DHD A;  3VJD A;  1UBV A;  4LLT A;  4KVW A;  4FJQ A;  4LZ0 A;  5JV2 F;  3OYR A;  4QPF A;  2Z4W A;  1ZW5 A;  2F92 F;  3ACW A;  2Z4X A;  2Z78 A;  1N21 A;  5ERO A;  3LMD A;  4NKE A;  3VJ8 A;  5H9D A;  5HNA A;  5B02 A;  3KRA A;  4F6X A;  4DWG A;  2E8X A;  2Q80 A;  4GAX A;  3MAV A;  5A0J A;  2VF6 A;  3MZV A;  2ZEV A;  1V4E A;  3SDQ A;  3WCC A;  1YHK A;  5IL8 A;  3N0F A;  2Z50 A;  1V4J A;  5IL3 A;  4KWD A;  1VG3 A;  5IMI A;  1RQJ A;  3SDR A;  3LZ9 A;  5IKA A;  4DI5 A;  3SAE A;  5ILK A;  3KB9 A;  4L2X F;  4XQR F;  5IN8 A;  2Z4Z A;  4GP2 A;  3P8R A;  4H5E F;  2QIS A;  2EWG A;  2AZL A;  5IM1 A;  1YV5 A;  2O1O A;  5A0I A;  4KVY A;  2PS8 A;  3P8L A; 
#chains in the Genus database with same CATH homology
 3KRO A;  1VG7 A;  5AYP A;  4E9Z A;  2E91 A;  3KRP A;  4UMJ A;  4KPJ A;  1JFA A;  4LFV F;  5B0M A;  5IK0 A;  3NPK A;  3KRF A;  4F6V A;  3OAB A;  3ZL6 A;  2Z52 A;  3WCB A;  2ZCQ A;  3DYG A;  3M01 A;  3WSA A;  3PH7 A;  4WK5 A;  3WEK A;  2F8C F;  3LVS A;  4LA5 A;  4GP1 A;  4KFA A;  5JV1 F;  1VG4 A;  5ER8 A;  4KQ5 A;  4N9U A;  4RXD A;  3WEI A;  4KK2 A;  1N1B A;  2F9K F;  2Q9Y A;  3LG5 A;  3WCM A;  2RAH A;  2OPM A;  4LZ3 A;  1VG2 A;  2AEL A;  2AET A;  3P41 A;  4H5C F;  2PS4 A;  4HD1 A;  3RYE A;  5I1U A;  4KKM A;  1HM7 A;  3N0G A;  1YJ4 A;  3P5P A;  1RQI A;  2PS5 A;  1KIY A;  2ZY1 A;  5JUZ F;  3UCA A;  2F7M F;  4XQS F;  3Q30 A;  4E9U A;  4F62 A;  2H8O A;  5B0J A;  1YYU A;  5AHU B;  4LIX A;  3VJC A;  1DGP A;  4EA1 A;  4LFE A;  4LFG A;  1V4K A;  4JZB A;  1N1Z A;  3M00 A;  4KPD A;  5ILH A;  3N6K F;  4JXN A;  3LSN A;  4LXW A;  2F8Z F;  1UBY A;  2E8U A;  3WCE A;  4OKZ A;  4RYP A;  4JVJ F;  3ZOU A;  1WMW A;  3W7F A;  4PVX F;  4LOB A;  2AZJ A;  4QXS F;  3RMG A;  4GA3 A;  5DJR F;  3ICK A;  4OMH A;  4EA2 A;  4JXY A;  3PKO A;  2E94 A;  1WL0 A;  2ZEU A;  1DI1 A;  4MC0 A;  3KRC B;  3BNX A;  5ERN A;  2E93 A;  3WCA A;  4OKM A;  1N24 A;  3LOM A;  4LPG F;  2F89 F;  5JA0 F;  1V4I A;  5DGS F;  5ILJ A;  3V1X A;  4KQS A;  1HX9 A;  1JFG A;  4XQT F;  2OA6 A;  5DHK A;  5B03 A;  4PVY F;  3VJE A;  2J5C A;  3OAC B;  1PS1 A;  2F94 F;  2J1P A;  3CKE A;  3IPI A;  3KBK A;  2PS6 A;  3LGK A;  3P5R A;  4KVI A;  3WE9 A;  2E8V A;  5JV0 F;  2Z4Y A;  4RXE A;  3TC1 A;  2OGD A;  3WEJ A;  3N5H F;  5DJP F;  3WC9 A;  2P1C A;  3KRA B;  3S9V A;  2AZK A;  3Q2Z A;  3TFN A;  3WJK A;  5E8H A;  1FPS A;  1N23 A;  5IMP A;  3N49 F;  3G4D A;  4NFK F;  5ERM A;  5HN7 A;  2ONG A;  3LJI A;  1HXA A;  4NG6 A;  3WCJ A;  4LZC A;  3WEG A;  4H5D F;  3LGZ B;  5ILI A;  3CC9 A;  5C05 A;  1WL1 A;  2AEK A;  3EFQ A;  4Q23 A;  5EAS A;  3ACY A;  1YQ7 A;  3KRO B;  3VJB A;  5B0K A;  3KRP B;  3SDT A;  3ZMB A;  3RYW A;  3N5J F;  2Z4V A;  3KRF B;  3WJO A;  3WCI A;  4OGU A;  3SDV A;  4MC8 A;  2E90 A;  2E95 A;  3BNY A;  2E8T A;  3OAB B;  5IK9 A;  3M9U A;  5DGM F;  1EZF A;  4KVD A;  1YYT A;  3WCD A;  5DW7 A;  3TFP A;  2Z7I A;  3WEH A;  3VJ9 A;  3ZMC A;  3AQ0 A;  3IBA A;  3Q1O A;  4P0X A;  3WCL A;  4DXJ A;  3NPR A;  1WKZ A;  5DHI A;  2E4O A;  2ZCS A;  3DYH A;  5AEL A;  4NUA A;  1RTR A;  3AQB B;  4DZW A;  1HXC A;  3TS7 A;  1V4H A;  3N3L F;  3APZ A;  3LDW A;  5IMN A;  2FTZ A;  4LTV A;  5IKH A;  3EZ3 A;  2ONH A;  3V66 A;  2PS7 A;  3ID0 A;  1YYR A;  4JYX A;  3PYB A;  3G4F A;  3N46 F;  4KQU A;  4LUU A;  5KSX F;  3RBM A;  1YHM A;  4EA0 A;  5ILD A;  1N22 A;  3N1W F;  4JZX A;  3M02 A;  4P0V A;  3S4J A;  1KIZ A;  5EAT A;  3NRI A;  4E1E A;  2J1O A;  4K10 A;  3B7L A;  1WL3 A;  3EGT A;  5EAU A;  1UBW A;  5E8L A;  5B0I A;  2OPN A;  3ACX A;  2ZCO A;  3TFV A;  1YYS A;  3N45 F;  5HN9 A;  3WJN A;  4ZQ8 A;  5DIQ F;  3WCG A;  2Q58 A;  3ADZ A;  3ZCD A;  5ILZ A;  1WY0 A;  3LK5 A;  4LA6 A;  5B00 A;  5IVG A;  3WCF A;  1YYQ A;  4LLS A;  5B01 A;  2Z7H A;  3WCH A;  3N3D A;  3LEE A;  5IK6 A;  4LPH F;  3WSB A;  3AE0 A;  4NFJ F;  3WEF A;  5DZ2 A;  4MC3 A;  4RXC A;  5A0K A;  1VG6 A;  3M0G A;  3ASX A;  4P0W A;  4N1Z F;  5DGN F;  2E92 A;  2I19 A;  1UBX A;  4OMG A;  5HN8 A;  4DEM F;  3N1V F;  3PDE A;  3SDU A;  1N20 A;  3QKC A;  5CG6 A;  4NKF A;  3LLW A;  3ICZ A;  5DJV F;  3ICM A;  3VJA A;  2ZCR A;  4LTZ A;  4RXA A;  5E8K A;  4KUX A;  3V1V A;  3QQV A;  3ICN A;  3PYA A;  5B0L A;  3NF2 A;  3CP6 A;  2FOR A;  3KRC A;  5ILY A;  3DYF A;  4DWB A;  3AQC B;  2Q9Z A;  1WL2 A;  2E8W A;  4RNQ A;  1HM4 A;  5AFX A;  4NFI F;  2DH4 A;  1YHL A;  5CG5 A;  3OAC A;  3Q2Q A;  1HXG A;  4FP4 A;  4DHD A;  3VJD A;  1UBV A;  4LLT A;  4KVW A;  4FJQ A;  4LZ0 A;  5JV2 F;  3OYR A;  4QPF A;  2Z4W A;  1ZW5 A;  2F92 F;  3ACW A;  2Z4X A;  2Z78 A;  1N21 A;  5ERO A;  3LMD A;  4NKE A;  3VJ8 A;  5H9D A;  5HNA A;  5B02 A;  3KRA A;  4F6X A;  4DWG A;  2E8X A;  2Q80 A;  4GAX A;  3MAV A;  5A0J A;  2VF6 A;  3MZV A;  2ZEV A;  1V4E A;  3SDQ A;  3WCC A;  1YHK A;  5IL8 A;  3N0F A;  2Z50 A;  1V4J A;  5IL3 A;  4KWD A;  1VG3 A;  5IMI A;  1RQJ A;  3SDR A;  3LZ9 A;  5IKA A;  4DI5 A;  3SAE A;  5ILK A;  3KB9 A;  4L2X F;  4XQR F;  5IN8 A;  2Z4Z A;  4GP2 A;  3P8R A;  4H5E F;  2QIS A;  2EWG A;  2AZL A;  5IM1 A;  1YV5 A;  2O1O A;  5A0I A;  4KVY A;  2PS8 A;  3P8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...