3VJDA

Crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIAIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title Binding modes of zaragozic acid A to human squalene synthase and staphylococcal dehydrosqualene synthase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 122
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3vjdA00
1V4KA 2Z4WA 3KRPA 5DIQF 5B02A 1HXCA 3ICMA 3M00A 4LXWA 2PS4A 4XQSF 1YYTA 5EROA 3V66A 3VJAA 5B03A 3N0GA 3ADZA 4LLSA 2Z52A 4NFJF 3KRCA 4LUUA 1N24A 4GAXA 3QKCA 3WCCA 3WEGA 3SDVA 4RNQA 3WJOA 2E8XA 4F6XA 5B01A 3ICZA 2PS7A 1N21A 2PS8A 2EWGA 4RXCA 2E8VA 3WEFA 3N0FA 3ICNA 2H8OA 4LIXA 1VG2A 4QPFA 2ONGA 3WE9A 3VJ8A 2Z7HA 3TFNA 3LOMA 4QXSF 3KB9A 2PS5A 5ILDA 3EZ3A 5ILZA 2Z4YA 2E95A 4Q23A 3WEHA 3P41A 1V4EA 3VJBA 5IL3A 2E91A 4KVYA 4EA2A 2OPMA 4NFKF 5B0JA 3Q30A 3B7LA 3AQBB 4FP4A 1JFAA 1N23A 3PKOA 5HNAA 1YHLA 4XQTF 4PVXF 3TFVA 1UBYA 3N5JF 5IMIA 4EA0A 4OMHA 5DGSF 2OPNA 3WCDA 3OYRA 2F92F 1V4HA 4OMGA 4WK5A 5E8KA 4KUXA 3M0GA 3TC1A 3KRAB 3ZL6A 3LDWA 3PYBA 5DW7A 4NFIF 5ILHA 4MC3A 4KWDA 1VG7A 4FJQA 1WY0A 2AZJA 2F89F 4MC8A 5E8HA 1WMWA 4NKFA 4NKEA 3ACXA 2ZCOA 4K10A 2ZCRA 5DJRF 3OABA 4NUAA 4F62A 5DZ2A 1PS1A 3AQ0A 4KVWA 1WKZA 5A0IA 2QISA 3NPKA 3KRPB 3ZOUA 5AFXA 3WCBA 3VJCA 3LJIA 5IKHA 2J5CA 5IN8A 3WCLA 5B0MA 4LFGA 4KPDA 1YJ4A 1RQJA 3KRCB 2E92A 5B00A 2ZEUA 5ILKA 5B0IA 2Z78A 4OKMA 1VG6A 2J1OA 3MZVA 1HXGA 4L2XF 4N1ZF 4LA6A 2DH4A 5ILJA 2Z4ZA 4JZBA 1VG3A 4GP2A 1ZW5A 2E94A 4P0XA 3IPIA 2F8ZF 2F8CF 5AHUB 4DEMF 1HX9A 4JXYA 1N20A 3LSNA 4LTVA 3PDEA 2E8UA 2OGDA 5A0JA 3M9UA 5JA0F 3LVSA 4RYPA 3P5PA 3DYFA 1YYQA 2OA6A 3WEIA 3WJNA 2AELA 4DWBA 4DZWA 3P5RA 2Q9ZA 5IMNA 4P0VA 5CG6A 5JUZF 4DXJA 3CKEA 4F6VA 2AETA 4H5DF 3ASXA 3AE0A 4N9UA 1UBXA 2Z4XA 2F94F 5DJPF 2VF6A 3PH7A 3LLWA 5DJVF 1N22A 3WEKA 1UBVA 2ZCSA 5KSXF 5EATA 3TS7A 4LPGF 5JV2F 3ZMBA 5ER8A 2E4OA 1WL1A 2PS6A 5ERNA 5H9DA 3WC9A 2FTZA 3OACA 5IKAA 2O1OA 2Z7IA 2ZEVA 3P8RA 4UMJA 3LZ9A 5E8LA 2F7MF 3WCEA 4GP1A 4KVDA 3N5HF 3S9VA 4XQRF 3WEJA 3N46F 1YHKA 3VJ9A 3NRIA 4KQ5A 3N3DA 3TFPA 3VJEA 1RTRA 4LPHF 2Q58A 3OABB 4LZCA 3WSBA 5JV1F 4ZQ8A 3LG5A 4KFAA 5IK0A 4JVJF 4RXAA 3WSAA 4KQUA 3WCJA 5AYPA 4JXNA 4HD1A 3BNXA 3RYWA 2ZY1A 5HN9A 4DI5A 3SDRA 3Q2QA 4OGUA 1YQ7A 3SDUA 1DI1A 1KIYA 3KRFA 3NF2A 2RAHA 3KROB 4RXEA 3AQCB 3N49F 3M02A 2AEKA 1UBWA 2I19A 3KROA 3V1XA 3QQVA 4LFEA 4LTZA 3EGTA 1WL0A 4LOBA 5HN7A 3RMGA 5DGNF 3SDQA 1DGPA 3EFQA 3Q1OA 1V4IA 4P0WA 1JFGA 3LGZB 2Q80A 1HM4A 1RQIA 2AZKA 1FPSA 3NPRA 1HM7A 5B0LA 5ERMA 5HN8A 3WCIA 3VJDA 3ZMCA 5A0KA 3P8LA 3BNYA 1WL2A 3MAVA 1YYSA 3IBAA 4PVYF 1N1ZA 2E8TA 3N45F 2Z50A 2E93A 3W7FA 4H5CF 4LZ0A 5IMPA 5IK9A 4DHDA 3WCAA 3N1WF 5ILYA 3N6KF 4E9ZA 4H5EF 4KKMA 4EA1A 4KVIA 4JYXA 5CG5A 2E90A 1YYRA 3N1VF 5AELA 4LLTA 3KBKA 4LA5A 4NG6A 3CP6A 5IVGA 3G4DA 4LFVF 3OACB 2Q9YA 3DYHA 5ILIA 5EASA 5B0KA 3V1VA 3ACYA 2Z4VA 4DWGA 3N3LF 4E9UA 1VG4A 3RBMA 4RXDA 3RYEA 3Q2ZA 1N1BA 4OKZA 5DHKA 3ID0A 3ZCDA 2F9KF 5IL8A 2P1CA 2ONHA 3WCGA 3LEEA 3G4FA 5DHIA 2FORA 1YYUA 2J1PA 2AZLA 2E8WA 5JV0F 5IM1A 3LGKA 1V4JA 5IK6A 4MC0A 3KRAA 1YHMA 3APZA 4E1EA 1YV5A 3LK5A 3SDTA 1KIZA 3ICKA 3M01A 5I1UA 4KPJA 5C05A 4LZ3A 5DGMF 1EZFA 3CC9A 3KRFB 3S4JA 3WJKA 3LMDA 3WCHA 1WL3A 4KQSA 2ZCQA 3ACWA 3DYGA 4JZXA 3UCAA 3WCFA 3WCMA 4KK2A 4GA3A 5EAUA 3SAEA 1HXAA 3PYAA
chains in the Genus database with same CATH superfamily
1V4KA 2Z4WA 3KRPA 5DIQF 5B02A 1HXCA 3ICMA 3M00A 4LXWA 2PS4A 4XQSF 1YYTA 5EROA 3V66A 3VJAA 5B03A 3N0GA 3ADZA 4LLSA 2Z52A 4NFJF 3KRCA 4LUUA 1N24A 4GAXA 3QKCA 3WCCA 3WEGA 3SDVA 4RNQA 3WJOA 2E8XA 4F6XA 5B01A 3ICZA 2PS7A 1N21A 2PS8A 2EWGA 4RXCA 2E8VA 3WEFA 3N0FA 3ICNA 2H8OA 4LIXA 1VG2A 4QPFA 2ONGA 3WE9A 3VJ8A 2Z7HA 3TFNA 3LOMA 4QXSF 3KB9A 2PS5A 5ILDA 3EZ3A 5ILZA 2Z4YA 2E95A 4Q23A 3WEHA 3P41A 1V4EA 3VJBA 5IL3A 2E91A 4KVYA 4EA2A 2OPMA 4NFKF 5B0JA 3Q30A 3B7LA 3AQBB 4FP4A 1JFAA 1N23A 3PKOA 5HNAA 1YHLA 4XQTF 4PVXF 3TFVA 1UBYA 3N5JF 5IMIA 4EA0A 4OMHA 5DGSF 2OPNA 3WCDA 3OYRA 2F92F 1V4HA 4OMGA 4WK5A 5E8KA 4KUXA 3M0GA 3TC1A 3KRAB 3ZL6A 3LDWA 3PYBA 5DW7A 4NFIF 5ILHA 4MC3A 4KWDA 1VG7A 4FJQA 1WY0A 2AZJA 2F89F 4MC8A 5E8HA 1WMWA 4NKFA 4NKEA 3ACXA 2ZCOA 4K10A 2ZCRA 5DJRF 3OABA 4NUAA 4F62A 5DZ2A 1PS1A 3AQ0A 4KVWA 1WKZA 5A0IA 2QISA 3NPKA 3KRPB 3ZOUA 5AFXA 3WCBA 3VJCA 3LJIA 5IKHA 2J5CA 5IN8A 3WCLA 5B0MA 4LFGA 4KPDA 1YJ4A 1RQJA 3KRCB 2E92A 5B00A 2ZEUA 5ILKA 5B0IA 2Z78A 4OKMA 1VG6A 2J1OA 3MZVA 1HXGA 4L2XF 4N1ZF 4LA6A 2DH4A 5ILJA 2Z4ZA 4JZBA 1VG3A 4GP2A 1ZW5A 2E94A 4P0XA 3IPIA 2F8ZF 2F8CF 5AHUB 4DEMF 1HX9A 4JXYA 1N20A 3LSNA 4LTVA 3PDEA 2E8UA 2OGDA 5A0JA 3M9UA 5JA0F 3LVSA 4RYPA 3P5PA 3DYFA 1YYQA 2OA6A 3WEIA 3WJNA 2AELA 4DWBA 4DZWA 3P5RA 2Q9ZA 5IMNA 4P0VA 5CG6A 5JUZF 4DXJA 3CKEA 4F6VA 2AETA 4H5DF 3ASXA 3AE0A 4N9UA 1UBXA 2Z4XA 2F94F 5DJPF 2VF6A 3PH7A 3LLWA 5DJVF 1N22A 3WEKA 1UBVA 2ZCSA 5KSXF 5EATA 3TS7A 4LPGF 5JV2F 3ZMBA 5ER8A 2E4OA 1WL1A 2PS6A 5ERNA 5H9DA 3WC9A 2FTZA 3OACA 5IKAA 2O1OA 2Z7IA 2ZEVA 3P8RA 4UMJA 3LZ9A 5E8LA 2F7MF 3WCEA 4GP1A 4KVDA 3N5HF 3S9VA 4XQRF 3WEJA 3N46F 1YHKA 3VJ9A 3NRIA 4KQ5A 3N3DA 3TFPA 3VJEA 1RTRA 4LPHF 2Q58A 3OABB 4LZCA 3WSBA 5JV1F 4ZQ8A 3LG5A 4KFAA 5IK0A 4JVJF 4RXAA 3WSAA 4KQUA 3WCJA 5AYPA 4JXNA 4HD1A 3BNXA 3RYWA 2ZY1A 5HN9A 4DI5A 3SDRA 3Q2QA 4OGUA 1YQ7A 3SDUA 1DI1A 1KIYA 3KRFA 3NF2A 2RAHA 3KROB 4RXEA 3AQCB 3N49F 3M02A 2AEKA 1UBWA 2I19A 3KROA 3V1XA 3QQVA 4LFEA 4LTZA 3EGTA 1WL0A 4LOBA 5HN7A 3RMGA 5DGNF 3SDQA 1DGPA 3EFQA 3Q1OA 1V4IA 4P0WA 1JFGA 3LGZB 2Q80A 1HM4A 1RQIA 2AZKA 1FPSA 3NPRA 1HM7A 5B0LA 5ERMA 5HN8A 3WCIA 3VJDA 3ZMCA 5A0KA 3P8LA 3BNYA 1WL2A 3MAVA 1YYSA 3IBAA 4PVYF 1N1ZA 2E8TA 3N45F 2Z50A 2E93A 3W7FA 4H5CF 4LZ0A 5IMPA 5IK9A 4DHDA 3WCAA 3N1WF 5ILYA 3N6KF 4E9ZA 4H5EF 4KKMA 4EA1A 4KVIA 4JYXA 5CG5A 2E90A 1YYRA 3N1VF 5AELA 4LLTA 3KBKA 4LA5A 4NG6A 3CP6A 5IVGA 3G4DA 4LFVF 3OACB 2Q9YA 3DYHA 5ILIA 5EASA 5B0KA 3V1VA 3ACYA 2Z4VA 4DWGA 3N3LF 4E9UA 1VG4A 3RBMA 4RXDA 3RYEA 3Q2ZA 1N1BA 4OKZA 5DHKA 3ID0A 3ZCDA 2F9KF 5IL8A 2P1CA 2ONHA 3WCGA 3LEEA 3G4FA 5DHIA 2FORA 1YYUA 2J1PA 2AZLA 2E8WA 5JV0F 5IM1A 3LGKA 1V4JA 5IK6A 4MC0A 3KRAA 1YHMA 3APZA 4E1EA 1YV5A 3LK5A 3SDTA 1KIZA 3ICKA 3M01A 5I1UA 4KPJA 5C05A 4LZ3A 5DGMF 1EZFA 3CC9A 3KRFB 3S4JA 3WJKA 3LMDA 3WCHA 1WL3A 4KQSA 2ZCQA 3ACWA 3DYGA 4JZXA 3UCAA 3WCFA 3WCMA 4KK2A 4GA3A 5EAUA 3SAEA 1HXAA 3PYAA
chains in the Genus database with same CATH topology
1V4KA 2Z4WA 3KRPA 5DIQF 5B02A 1HXCA 3ICMA 3M00A 4LXWA 2PS4A 4XQSF 1YYTA 5EROA 3V66A 3VJAA 5B03A 3N0GA 3ADZA 4LLSA 2Z52A 4NFJF 3KRCA 4LUUA 1N24A 4GAXA 3QKCA 3WCCA 3WEGA 3SDVA 4RNQA 3WJOA 2E8XA 4F6XA 5B01A 3ICZA 2PS7A 1N21A 2PS8A 2EWGA 4RXCA 2E8VA 3WEFA 3N0FA 3ICNA 2H8OA 4LIXA 1VG2A 4QPFA 2ONGA 3WE9A 3VJ8A 2Z7HA 3TFNA 3LOMA 4QXSF 3KB9A 2PS5A 5ILDA 3EZ3A 5ILZA 2Z4YA 2E95A 4Q23A 3WEHA 3P41A 1V4EA 3VJBA 5IL3A 2E91A 4KVYA 4EA2A 2OPMA 4NFKF 5B0JA 3Q30A 3B7LA 3AQBB 4FP4A 1JFAA 1N23A 3PKOA 5HNAA 1YHLA 4XQTF 4PVXF 3TFVA 1UBYA 3N5JF 5IMIA 4EA0A 4OMHA 5DGSF 2OPNA 3WCDA 3OYRA 2F92F 1V4HA 4OMGA 4WK5A 5E8KA 4KUXA 3M0GA 3TC1A 3KRAB 3ZL6A 3LDWA 3PYBA 5DW7A 4NFIF 5ILHA 4MC3A 4KWDA 1VG7A 4FJQA 1WY0A 2AZJA 2F89F 4MC8A 5E8HA 1WMWA 4NKFA 4NKEA 3ACXA 2ZCOA 4K10A 2ZCRA 5DJRF 3OABA 4NUAA 4F62A 5DZ2A 1PS1A 3AQ0A 4KVWA 1WKZA 5A0IA 2QISA 3NPKA 3KRPB 3ZOUA 5AFXA 3WCBA 3VJCA 3LJIA 5IKHA 2J5CA 5IN8A 3WCLA 5B0MA 4LFGA 4KPDA 1YJ4A 1RQJA 3KRCB 2E92A 5B00A 2ZEUA 5ILKA 5B0IA 2Z78A 4OKMA 1VG6A 2J1OA 3MZVA 1HXGA 4L2XF 4N1ZF 4LA6A 2DH4A 5ILJA 2Z4ZA 4JZBA 1VG3A 4GP2A 1ZW5A 2E94A 4P0XA 3IPIA 2F8ZF 2F8CF 5AHUB 4DEMF 1HX9A 4JXYA 1N20A 3LSNA 4LTVA 3PDEA 2E8UA 2OGDA 5A0JA 3M9UA 5JA0F 3LVSA 4RYPA 3P5PA 3DYFA 1YYQA 2OA6A 3WEIA 3WJNA 2AELA 4DWBA 4DZWA 3P5RA 2Q9ZA 5IMNA 4P0VA 5CG6A 5JUZF 4DXJA 3CKEA 4F6VA 2AETA 4H5DF 3ASXA 3AE0A 4N9UA 1UBXA 2Z4XA 2F94F 5DJPF 2VF6A 3PH7A 3LLWA 5DJVF 1N22A 3WEKA 1UBVA 2ZCSA 5KSXF 5EATA 3TS7A 4LPGF 5JV2F 3ZMBA 5ER8A 2E4OA 1WL1A 2PS6A 5ERNA 5H9DA 3WC9A 2FTZA 3OACA 5IKAA 2O1OA 2Z7IA 2ZEVA 3P8RA 4UMJA 3LZ9A 5E8LA 2F7MF 3WCEA 4GP1A 4KVDA 3N5HF 3S9VA 4XQRF 3WEJA 3N46F 1YHKA 3VJ9A 3NRIA 4KQ5A 3N3DA 3TFPA 3VJEA 1RTRA 4LPHF 2Q58A 3OABB 4LZCA 3WSBA 5JV1F 4ZQ8A 3LG5A 4KFAA 5IK0A 4JVJF 4RXAA 3WSAA 4KQUA 3WCJA 5AYPA 4JXNA 4HD1A 3BNXA 3RYWA 2ZY1A 5HN9A 4DI5A 3SDRA 3Q2QA 4OGUA 1YQ7A 3SDUA 1DI1A 1KIYA 3KRFA 3NF2A 2RAHA 3KROB 4RXEA 3AQCB 3N49F 3M02A 2AEKA 1UBWA 2I19A 3KROA 3V1XA 3QQVA 4LFEA 4LTZA 3EGTA 1WL0A 4LOBA 5HN7A 3RMGA 5DGNF 3SDQA 1DGPA 3EFQA 3Q1OA 1V4IA 4P0WA 1JFGA 3LGZB 2Q80A 1HM4A 1RQIA 2AZKA 1FPSA 3NPRA 1HM7A 5B0LA 5ERMA 5HN8A 3WCIA 3VJDA 3ZMCA 5A0KA 3P8LA 3BNYA 1WL2A 3MAVA 1YYSA 3IBAA 4PVYF 1N1ZA 2E8TA 3N45F 2Z50A 2E93A 3W7FA 4H5CF 4LZ0A 5IMPA 5IK9A 4DHDA 3WCAA 3N1WF 5ILYA 3N6KF 4E9ZA 4H5EF 4KKMA 4EA1A 4KVIA 4JYXA 5CG5A 2E90A 1YYRA 3N1VF 5AELA 4LLTA 3KBKA 4LA5A 4NG6A 3CP6A 5IVGA 3G4DA 4LFVF 3OACB 2Q9YA 3DYHA 5ILIA 5EASA 5B0KA 3V1VA 3ACYA 2Z4VA 4DWGA 3N3LF 4E9UA 1VG4A 3RBMA 4RXDA 3RYEA 3Q2ZA 1N1BA 4OKZA 5DHKA 3ID0A 3ZCDA 2F9KF 5IL8A 2P1CA 2ONHA 3WCGA 3LEEA 3G4FA 5DHIA 2FORA 1YYUA 2J1PA 2AZLA 2E8WA 5JV0F 5IM1A 3LGKA 1V4JA 5IK6A 4MC0A 3KRAA 1YHMA 3APZA 4E1EA 1YV5A 3LK5A 3SDTA 1KIZA 3ICKA 3M01A 5I1UA 4KPJA 5C05A 4LZ3A 5DGMF 1EZFA 3CC9A 3KRFB 3S4JA 3WJKA 3LMDA 3WCHA 1WL3A 4KQSA 2ZCQA 3ACWA 3DYGA 4JZXA 3UCAA 3WCFA 3WCMA 4KK2A 4GA3A 5EAUA 3SAEA 1HXAA 3PYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V4K A;  2Z4W A;  3KRP A;  5DIQ F;  5B02 A;  1HXC A;  3ICM A;  3M00 A;  4LXW A;  2PS4 A;  4XQS F;  1YYT A;  5ERO A;  3V66 A;  3VJA A;  5B03 A;  3N0G A;  3ADZ A;  4LLS A;  2Z52 A;  4NFJ F;  3KRC A;  4LUU A;  1N24 A;  4GAX A;  3QKC A;  3WCC A;  3WEG A;  3SDV A;  4RNQ A;  3WJO A;  2E8X A;  4F6X A;  5B01 A;  3ICZ A;  2PS7 A;  1N21 A;  2PS8 A;  2EWG A;  4RXC A;  2E8V A;  3WEF A;  3N0F A;  3ICN A;  2H8O A;  4LIX A;  1VG2 A;  4QPF A;  2ONG A;  3WE9 A;  3VJ8 A;  2Z7H A;  3TFN A;  3LOM A;  4QXS F;  3KB9 A;  2PS5 A;  5ILD A;  3EZ3 A;  5ILZ A;  2Z4Y A;  2E95 A;  4Q23 A;  3WEH A;  3P41 A;  1V4E A;  3VJB A;  5IL3 A;  2E91 A;  4KVY A;  4EA2 A;  2OPM A;  4NFK F;  5B0J A;  3Q30 A;  3B7L A;  3AQB B;  4FP4 A;  1JFA A;  1N23 A;  3PKO A;  5HNA A;  1YHL A;  4XQT F;  4PVX F;  3TFV A;  1UBY A;  3N5J F;  5IMI A;  4EA0 A;  4OMH A;  5DGS F;  2OPN A;  3WCD A;  3OYR A;  2F92 F;  1V4H A;  4OMG A;  4WK5 A;  5E8K A;  4KUX A;  3M0G A;  3TC1 A;  3KRA B;  3ZL6 A;  3LDW A;  3PYB A;  5DW7 A;  4NFI F;  5ILH A;  4MC3 A;  4KWD A;  1VG7 A;  4FJQ A;  1WY0 A;  2AZJ A;  2F89 F;  4MC8 A;  5E8H A;  1WMW A;  4NKF A;  4NKE A;  3ACX A;  2ZCO A;  4K10 A;  2ZCR A;  5DJR F;  3OAB A;  4NUA A;  4F62 A;  5DZ2 A;  1PS1 A;  3AQ0 A;  4KVW A;  1WKZ A;  5A0I A;  2QIS A;  3NPK A;  3KRP B;  3ZOU A;  5AFX A;  3WCB A;  3VJC A;  3LJI A;  5IKH A;  2J5C A;  5IN8 A;  3WCL A;  5B0M A;  4LFG A;  4KPD A;  1YJ4 A;  1RQJ A;  3KRC B;  2E92 A;  5B00 A;  2ZEU A;  5ILK A;  5B0I A;  2Z78 A;  4OKM A;  1VG6 A;  2J1O A;  3MZV A;  1HXG A;  4L2X F;  4N1Z F;  4LA6 A;  2DH4 A;  5ILJ A;  2Z4Z A;  4JZB A;  1VG3 A;  4GP2 A;  1ZW5 A;  2E94 A;  4P0X A;  3IPI A;  2F8Z F;  2F8C F;  5AHU B;  4DEM F;  1HX9 A;  4JXY A;  1N20 A;  3LSN A;  4LTV A;  3PDE A;  2E8U A;  2OGD A;  5A0J A;  3M9U A;  5JA0 F;  3LVS A;  4RYP A;  3P5P A;  3DYF A;  1YYQ A;  2OA6 A;  3WEI A;  3WJN A;  2AEL A;  4DWB A;  4DZW A;  3P5R A;  2Q9Z A;  5IMN A;  4P0V A;  5CG6 A;  5JUZ F;  4DXJ A;  3CKE A;  4F6V A;  2AET A;  4H5D F;  3ASX A;  3AE0 A;  4N9U A;  1UBX A;  2Z4X A;  2F94 F;  5DJP F;  2VF6 A;  3PH7 A;  3LLW A;  5DJV F;  1N22 A;  3WEK A;  1UBV A;  2ZCS A;  5KSX F;  5EAT A;  3TS7 A;  4LPG F;  5JV2 F;  3ZMB A;  5ER8 A;  2E4O A;  1WL1 A;  2PS6 A;  5ERN A;  5H9D A;  3WC9 A;  2FTZ A;  3OAC A;  5IKA A;  2O1O A;  2Z7I A;  2ZEV A;  3P8R A;  4UMJ A;  3LZ9 A;  5E8L A;  2F7M F;  3WCE A;  4GP1 A;  4KVD A;  3N5H F;  3S9V A;  4XQR F;  3WEJ A;  3N46 F;  1YHK A;  3VJ9 A;  3NRI A;  4KQ5 A;  3N3D A;  3TFP A;  3VJE A;  1RTR A;  4LPH F;  2Q58 A;  3OAB B;  4LZC A;  3WSB A;  5JV1 F;  4ZQ8 A;  3LG5 A;  4KFA A;  5IK0 A;  4JVJ F;  4RXA A;  3WSA A;  4KQU A;  3WCJ A;  5AYP A;  4JXN A;  4HD1 A;  3BNX A;  3RYW A;  2ZY1 A;  5HN9 A;  4DI5 A;  3SDR A;  3Q2Q A;  4OGU A;  1YQ7 A;  3SDU A;  1DI1 A;  1KIY A;  3KRF A;  3NF2 A;  2RAH A;  3KRO B;  4RXE A;  3AQC B;  3N49 F;  3M02 A;  2AEK A;  1UBW A;  2I19 A;  3KRO A;  3V1X A;  3QQV A;  4LFE A;  4LTZ A;  3EGT A;  1WL0 A;  4LOB A;  5HN7 A;  3RMG A;  5DGN F;  3SDQ A;  1DGP A;  3EFQ A;  3Q1O A;  1V4I A;  4P0W A;  1JFG A;  3LGZ B;  2Q80 A;  1HM4 A;  1RQI A;  2AZK A;  1FPS A;  3NPR A;  1HM7 A;  5B0L A;  5ERM A;  5HN8 A;  3WCI A;  3VJD A;  3ZMC A;  5A0K A;  3P8L A;  3BNY A;  1WL2 A;  3MAV A;  1YYS A;  3IBA A;  4PVY F;  1N1Z A;  2E8T A;  3N45 F;  2Z50 A;  2E93 A;  3W7F A;  4H5C F;  4LZ0 A;  5IMP A;  5IK9 A;  4DHD A;  3WCA A;  3N1W F;  5ILY A;  3N6K F;  4E9Z A;  4H5E F;  4KKM A;  4EA1 A;  4KVI A;  4JYX A;  5CG5 A;  2E90 A;  1YYR A;  3N1V F;  5AEL A;  4LLT A;  3KBK A;  4LA5 A;  4NG6 A;  3CP6 A;  5IVG A;  3G4D A;  4LFV F;  3OAC B;  2Q9Y A;  3DYH A;  5ILI A;  5EAS A;  5B0K A;  3V1V A;  3ACY A;  2Z4V A;  4DWG A;  3N3L F;  4E9U A;  1VG4 A;  3RBM A;  4RXD A;  3RYE A;  3Q2Z A;  1N1B A;  4OKZ A;  5DHK A;  3ID0 A;  3ZCD A;  2F9K F;  5IL8 A;  2P1C A;  2ONH A;  3WCG A;  3LEE A;  3G4F A;  5DHI A;  2FOR A;  1YYU A;  2J1P A;  2AZL A;  2E8W A;  5JV0 F;  5IM1 A;  3LGK A;  1V4J A;  5IK6 A;  4MC0 A;  3KRA A;  1YHM A;  3APZ A;  4E1E A;  1YV5 A;  3LK5 A;  3SDT A;  1KIZ A;  3ICK A;  3M01 A;  5I1U A;  4KPJ A;  5C05 A;  4LZ3 A;  5DGM F;  1EZF A;  3CC9 A;  3KRF B;  3S4J A;  3WJK A;  3LMD A;  3WCH A;  1WL3 A;  4KQS A;  2ZCQ A;  3ACW A;  3DYG A;  4JZX A;  3UCA A;  3WCF A;  3WCM A;  4KK2 A;  4GA3 A;  5EAU A;  3SAE A;  1HXA A;  3PYA A; 
#chains in the Genus database with same CATH topology
 1V4K A;  2Z4W A;  3KRP A;  5DIQ F;  5B02 A;  1HXC A;  3ICM A;  3M00 A;  4LXW A;  2PS4 A;  4XQS F;  1YYT A;  5ERO A;  3V66 A;  3VJA A;  5B03 A;  3N0G A;  3ADZ A;  4LLS A;  2Z52 A;  4NFJ F;  3KRC A;  4LUU A;  1N24 A;  4GAX A;  3QKC A;  3WCC A;  3WEG A;  3SDV A;  4RNQ A;  3WJO A;  2E8X A;  4F6X A;  5B01 A;  3ICZ A;  2PS7 A;  1N21 A;  2PS8 A;  2EWG A;  4RXC A;  2E8V A;  3WEF A;  3N0F A;  3ICN A;  2H8O A;  4LIX A;  1VG2 A;  4QPF A;  2ONG A;  3WE9 A;  3VJ8 A;  2Z7H A;  3TFN A;  3LOM A;  4QXS F;  3KB9 A;  2PS5 A;  5ILD A;  3EZ3 A;  5ILZ A;  2Z4Y A;  2E95 A;  4Q23 A;  3WEH A;  3P41 A;  1V4E A;  3VJB A;  5IL3 A;  2E91 A;  4KVY A;  4EA2 A;  2OPM A;  4NFK F;  5B0J A;  3Q30 A;  3B7L A;  3AQB B;  4FP4 A;  1JFA A;  1N23 A;  3PKO A;  5HNA A;  1YHL A;  4XQT F;  4PVX F;  3TFV A;  1UBY A;  3N5J F;  5IMI A;  4EA0 A;  4OMH A;  5DGS F;  2OPN A;  3WCD A;  3OYR A;  2F92 F;  1V4H A;  4OMG A;  4WK5 A;  5E8K A;  4KUX A;  3M0G A;  3TC1 A;  3KRA B;  3ZL6 A;  3LDW A;  3PYB A;  5DW7 A;  4NFI F;  5ILH A;  4MC3 A;  4KWD A;  1VG7 A;  4FJQ A;  1WY0 A;  2AZJ A;  2F89 F;  4MC8 A;  5E8H A;  1WMW A;  4NKF A;  4NKE A;  3ACX A;  2ZCO A;  4K10 A;  2ZCR A;  5DJR F;  3OAB A;  4NUA A;  4F62 A;  5DZ2 A;  1PS1 A;  3AQ0 A;  4KVW A;  1WKZ A;  5A0I A;  2QIS A;  3NPK A;  3KRP B;  3ZOU A;  5AFX A;  3WCB A;  3VJC A;  3LJI A;  5IKH A;  2J5C A;  5IN8 A;  3WCL A;  5B0M A;  4LFG A;  4KPD A;  1YJ4 A;  1RQJ A;  3KRC B;  2E92 A;  5B00 A;  2ZEU A;  5ILK A;  5B0I A;  2Z78 A;  4OKM A;  1VG6 A;  2J1O A;  3MZV A;  1HXG A;  4L2X F;  4N1Z F;  4LA6 A;  2DH4 A;  5ILJ A;  2Z4Z A;  4JZB A;  1VG3 A;  4GP2 A;  1ZW5 A;  2E94 A;  4P0X A;  3IPI A;  2F8Z F;  2F8C F;  5AHU B;  4DEM F;  1HX9 A;  4JXY A;  1N20 A;  3LSN A;  4LTV A;  3PDE A;  2E8U A;  2OGD A;  5A0J A;  3M9U A;  5JA0 F;  3LVS A;  4RYP A;  3P5P A;  3DYF A;  1YYQ A;  2OA6 A;  3WEI A;  3WJN A;  2AEL A;  4DWB A;  4DZW A;  3P5R A;  2Q9Z A;  5IMN A;  4P0V A;  5CG6 A;  5JUZ F;  4DXJ A;  3CKE A;  4F6V A;  2AET A;  4H5D F;  3ASX A;  3AE0 A;  4N9U A;  1UBX A;  2Z4X A;  2F94 F;  5DJP F;  2VF6 A;  3PH7 A;  3LLW A;  5DJV F;  1N22 A;  3WEK A;  1UBV A;  2ZCS A;  5KSX F;  5EAT A;  3TS7 A;  4LPG F;  5JV2 F;  3ZMB A;  5ER8 A;  2E4O A;  1WL1 A;  2PS6 A;  5ERN A;  5H9D A;  3WC9 A;  2FTZ A;  3OAC A;  5IKA A;  2O1O A;  2Z7I A;  2ZEV A;  3P8R A;  4UMJ A;  3LZ9 A;  5E8L A;  2F7M F;  3WCE A;  4GP1 A;  4KVD A;  3N5H F;  3S9V A;  4XQR F;  3WEJ A;  3N46 F;  1YHK A;  3VJ9 A;  3NRI A;  4KQ5 A;  3N3D A;  3TFP A;  3VJE A;  1RTR A;  4LPH F;  2Q58 A;  3OAB B;  4LZC A;  3WSB A;  5JV1 F;  4ZQ8 A;  3LG5 A;  4KFA A;  5IK0 A;  4JVJ F;  4RXA A;  3WSA A;  4KQU A;  3WCJ A;  5AYP A;  4JXN A;  4HD1 A;  3BNX A;  3RYW A;  2ZY1 A;  5HN9 A;  4DI5 A;  3SDR A;  3Q2Q A;  4OGU A;  1YQ7 A;  3SDU A;  1DI1 A;  1KIY A;  3KRF A;  3NF2 A;  2RAH A;  3KRO B;  4RXE A;  3AQC B;  3N49 F;  3M02 A;  2AEK A;  1UBW A;  2I19 A;  3KRO A;  3V1X A;  3QQV A;  4LFE A;  4LTZ A;  3EGT A;  1WL0 A;  4LOB A;  5HN7 A;  3RMG A;  5DGN F;  3SDQ A;  1DGP A;  3EFQ A;  3Q1O A;  1V4I A;  4P0W A;  1JFG A;  3LGZ B;  2Q80 A;  1HM4 A;  1RQI A;  2AZK A;  1FPS A;  3NPR A;  1HM7 A;  5B0L A;  5ERM A;  5HN8 A;  3WCI A;  3VJD A;  3ZMC A;  5A0K A;  3P8L A;  3BNY A;  1WL2 A;  3MAV A;  1YYS A;  3IBA A;  4PVY F;  1N1Z A;  2E8T A;  3N45 F;  2Z50 A;  2E93 A;  3W7F A;  4H5C F;  4LZ0 A;  5IMP A;  5IK9 A;  4DHD A;  3WCA A;  3N1W F;  5ILY A;  3N6K F;  4E9Z A;  4H5E F;  4KKM A;  4EA1 A;  4KVI A;  4JYX A;  5CG5 A;  2E90 A;  1YYR A;  3N1V F;  5AEL A;  4LLT A;  3KBK A;  4LA5 A;  4NG6 A;  3CP6 A;  5IVG A;  3G4D A;  4LFV F;  3OAC B;  2Q9Y A;  3DYH A;  5ILI A;  5EAS A;  5B0K A;  3V1V A;  3ACY A;  2Z4V A;  4DWG A;  3N3L F;  4E9U A;  1VG4 A;  3RBM A;  4RXD A;  3RYE A;  3Q2Z A;  1N1B A;  4OKZ A;  5DHK A;  3ID0 A;  3ZCD A;  2F9K F;  5IL8 A;  2P1C A;  2ONH A;  3WCG A;  3LEE A;  3G4F A;  5DHI A;  2FOR A;  1YYU A;  2J1P A;  2AZL A;  2E8W A;  5JV0 F;  5IM1 A;  3LGK A;  1V4J A;  5IK6 A;  4MC0 A;  3KRA A;  1YHM A;  3APZ A;  4E1E A;  1YV5 A;  3LK5 A;  3SDT A;  1KIZ A;  3ICK A;  3M01 A;  5I1U A;  4KPJ A;  5C05 A;  4LZ3 A;  5DGM F;  1EZF A;  3CC9 A;  3KRF B;  3S4J A;  3WJK A;  3LMD A;  3WCH A;  1WL3 A;  4KQS A;  2ZCQ A;  3ACW A;  3DYG A;  4JZX A;  3UCA A;  3WCF A;  3WCM A;  4KK2 A;  4GA3 A;  5EAU A;  3SAE A;  1HXA A;  3PYA A; 
#chains in the Genus database with same CATH homology
 1V4K A;  2Z4W A;  3KRP A;  5DIQ F;  5B02 A;  1HXC A;  3ICM A;  3M00 A;  4LXW A;  2PS4 A;  4XQS F;  1YYT A;  5ERO A;  3V66 A;  3VJA A;  5B03 A;  3N0G A;  3ADZ A;  4LLS A;  2Z52 A;  4NFJ F;  3KRC A;  4LUU A;  1N24 A;  4GAX A;  3QKC A;  3WCC A;  3WEG A;  3SDV A;  4RNQ A;  3WJO A;  2E8X A;  4F6X A;  5B01 A;  3ICZ A;  2PS7 A;  1N21 A;  2PS8 A;  2EWG A;  4RXC A;  2E8V A;  3WEF A;  3N0F A;  3ICN A;  2H8O A;  4LIX A;  1VG2 A;  4QPF A;  2ONG A;  3WE9 A;  3VJ8 A;  2Z7H A;  3TFN A;  3LOM A;  4QXS F;  3KB9 A;  2PS5 A;  5ILD A;  3EZ3 A;  5ILZ A;  2Z4Y A;  2E95 A;  4Q23 A;  3WEH A;  3P41 A;  1V4E A;  3VJB A;  5IL3 A;  2E91 A;  4KVY A;  4EA2 A;  2OPM A;  4NFK F;  5B0J A;  3Q30 A;  3B7L A;  3AQB B;  4FP4 A;  1JFA A;  1N23 A;  3PKO A;  5HNA A;  1YHL A;  4XQT F;  4PVX F;  3TFV A;  1UBY A;  3N5J F;  5IMI A;  4EA0 A;  4OMH A;  5DGS F;  2OPN A;  3WCD A;  3OYR A;  2F92 F;  1V4H A;  4OMG A;  4WK5 A;  5E8K A;  4KUX A;  3M0G A;  3TC1 A;  3KRA B;  3ZL6 A;  3LDW A;  3PYB A;  5DW7 A;  4NFI F;  5ILH A;  4MC3 A;  4KWD A;  1VG7 A;  4FJQ A;  1WY0 A;  2AZJ A;  2F89 F;  4MC8 A;  5E8H A;  1WMW A;  4NKF A;  4NKE A;  3ACX A;  2ZCO A;  4K10 A;  2ZCR A;  5DJR F;  3OAB A;  4NUA A;  4F62 A;  5DZ2 A;  1PS1 A;  3AQ0 A;  4KVW A;  1WKZ A;  5A0I A;  2QIS A;  3NPK A;  3KRP B;  3ZOU A;  5AFX A;  3WCB A;  3VJC A;  3LJI A;  5IKH A;  2J5C A;  5IN8 A;  3WCL A;  5B0M A;  4LFG A;  4KPD A;  1YJ4 A;  1RQJ A;  3KRC B;  2E92 A;  5B00 A;  2ZEU A;  5ILK A;  5B0I A;  2Z78 A;  4OKM A;  1VG6 A;  2J1O A;  3MZV A;  1HXG A;  4L2X F;  4N1Z F;  4LA6 A;  2DH4 A;  5ILJ A;  2Z4Z A;  4JZB A;  1VG3 A;  4GP2 A;  1ZW5 A;  2E94 A;  4P0X A;  3IPI A;  2F8Z F;  2F8C F;  5AHU B;  4DEM F;  1HX9 A;  4JXY A;  1N20 A;  3LSN A;  4LTV A;  3PDE A;  2E8U A;  2OGD A;  5A0J A;  3M9U A;  5JA0 F;  3LVS A;  4RYP A;  3P5P A;  3DYF A;  1YYQ A;  2OA6 A;  3WEI A;  3WJN A;  2AEL A;  4DWB A;  4DZW A;  3P5R A;  2Q9Z A;  5IMN A;  4P0V A;  5CG6 A;  5JUZ F;  4DXJ A;  3CKE A;  4F6V A;  2AET A;  4H5D F;  3ASX A;  3AE0 A;  4N9U A;  1UBX A;  2Z4X A;  2F94 F;  5DJP F;  2VF6 A;  3PH7 A;  3LLW A;  5DJV F;  1N22 A;  3WEK A;  1UBV A;  2ZCS A;  5KSX F;  5EAT A;  3TS7 A;  4LPG F;  5JV2 F;  3ZMB A;  5ER8 A;  2E4O A;  1WL1 A;  2PS6 A;  5ERN A;  5H9D A;  3WC9 A;  2FTZ A;  3OAC A;  5IKA A;  2O1O A;  2Z7I A;  2ZEV A;  3P8R A;  4UMJ A;  3LZ9 A;  5E8L A;  2F7M F;  3WCE A;  4GP1 A;  4KVD A;  3N5H F;  3S9V A;  4XQR F;  3WEJ A;  3N46 F;  1YHK A;  3VJ9 A;  3NRI A;  4KQ5 A;  3N3D A;  3TFP A;  3VJE A;  1RTR A;  4LPH F;  2Q58 A;  3OAB B;  4LZC A;  3WSB A;  5JV1 F;  4ZQ8 A;  3LG5 A;  4KFA A;  5IK0 A;  4JVJ F;  4RXA A;  3WSA A;  4KQU A;  3WCJ A;  5AYP A;  4JXN A;  4HD1 A;  3BNX A;  3RYW A;  2ZY1 A;  5HN9 A;  4DI5 A;  3SDR A;  3Q2Q A;  4OGU A;  1YQ7 A;  3SDU A;  1DI1 A;  1KIY A;  3KRF A;  3NF2 A;  2RAH A;  3KRO B;  4RXE A;  3AQC B;  3N49 F;  3M02 A;  2AEK A;  1UBW A;  2I19 A;  3KRO A;  3V1X A;  3QQV A;  4LFE A;  4LTZ A;  3EGT A;  1WL0 A;  4LOB A;  5HN7 A;  3RMG A;  5DGN F;  3SDQ A;  1DGP A;  3EFQ A;  3Q1O A;  1V4I A;  4P0W A;  1JFG A;  3LGZ B;  2Q80 A;  1HM4 A;  1RQI A;  2AZK A;  1FPS A;  3NPR A;  1HM7 A;  5B0L A;  5ERM A;  5HN8 A;  3WCI A;  3VJD A;  3ZMC A;  5A0K A;  3P8L A;  3BNY A;  1WL2 A;  3MAV A;  1YYS A;  3IBA A;  4PVY F;  1N1Z A;  2E8T A;  3N45 F;  2Z50 A;  2E93 A;  3W7F A;  4H5C F;  4LZ0 A;  5IMP A;  5IK9 A;  4DHD A;  3WCA A;  3N1W F;  5ILY A;  3N6K F;  4E9Z A;  4H5E F;  4KKM A;  4EA1 A;  4KVI A;  4JYX A;  5CG5 A;  2E90 A;  1YYR A;  3N1V F;  5AEL A;  4LLT A;  3KBK A;  4LA5 A;  4NG6 A;  3CP6 A;  5IVG A;  3G4D A;  4LFV F;  3OAC B;  2Q9Y A;  3DYH A;  5ILI A;  5EAS A;  5B0K A;  3V1V A;  3ACY A;  2Z4V A;  4DWG A;  3N3L F;  4E9U A;  1VG4 A;  3RBM A;  4RXD A;  3RYE A;  3Q2Z A;  1N1B A;  4OKZ A;  5DHK A;  3ID0 A;  3ZCD A;  2F9K F;  5IL8 A;  2P1C A;  2ONH A;  3WCG A;  3LEE A;  3G4F A;  5DHI A;  2FOR A;  1YYU A;  2J1P A;  2AZL A;  2E8W A;  5JV0 F;  5IM1 A;  3LGK A;  1V4J A;  5IK6 A;  4MC0 A;  3KRA A;  1YHM A;  3APZ A;  4E1E A;  1YV5 A;  3LK5 A;  3SDT A;  1KIZ A;  3ICK A;  3M01 A;  5I1U A;  4KPJ A;  5C05 A;  4LZ3 A;  5DGM F;  1EZF A;  3CC9 A;  3KRF B;  3S4J A;  3WJK A;  3LMD A;  3WCH A;  1WL3 A;  4KQS A;  2ZCQ A;  3ACW A;  3DYG A;  4JZX A;  3UCA A;  3WCF A;  3WCM A;  4KK2 A;  4GA3 A;  5EAU A;  3SAE A;  1HXA A;  3PYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...