4F62A

Crystal structure of a putative farnesyl-diphosphate synthase from marinomonas sp. med121 (target efi-501980)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
291
structure length
267
Chain Sequence
VMNLKQFSTYTQSRVDQYLEQQLSDYAPANQLHNAMRYSLFGGKRIRPMLTYASAQLVGDISSLTDASAAALESIHAYSLIHDDLPAMDNPTCHIQFDEATAILAGDALQTFAFELLSNPTSAQPELAIKLIQELVVASGRNGMITGQMIDLSSENKNISLAELEQMHVHKTGALIKASVRMGALSTGQVKPEQLAKLDAYAHAIGLAFQVQDDIIDLTNKATYPKLLGLDGAKALVVRLHEQAIAQISEFGDKSQPLTDLANYIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Marinomonas sp. med121
total genus 105
structure length 267
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.5.1.-:
pdb deposition date 2012-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4f62A00
5IKAA 5HN9A 4KK2A 4KUXA 5E8KA 4RNQA 3P5RA 5ILJA 1RTRA 2F8ZF 5AELA 5CG5A 4KVIA 5DJVF 2OPMA 3ZCDA 5DHKA 3ZMBA 5IK6A 5DHIA 4KQ5A 4XQSF 2F7MF 4DHDA 3M02A 5DGSF 1N24A 3LJIA 1PS1A 3P5PA 2Z78A 2Z4XA 5B03A 3WSBA 1YQ7A 1VG4A 1KIYA 5JV1F 3VJ8A 2E8UA 3VJEA 3LLWA 1UBYA 3KB9A 3KRPB 3KRPA 5AYPA 2F92F 1UBVA 4LZCA 4WK5A 5IMPA 4KWDA 2F8CF 5IKHA 3DYFA 2ZCSA 2E8TA 4K10A 3NF2A 1RQIA 4KKMA 2E90A 4DXJA 5A0JA 4ZQ8A 3WCHA 4FP4A 4DWGA 3VJBA 4KPDA 4MC8A 3ASXA 3WEKA 1N20A 4DZWA 2PS5A 5EATA 2ZCQA 2FORA 4NFKF 1WL2A 3WJOA 3SAEA 3ADZA 4NFJF 2PS8A 2Z4YA 1YHKA 1YJ4A 3M9UA 3ICZA 5IM1A 3LMDA 1HM4A 4RXEA 1V4EA 4LFGA 4LOBA 4F6XA 3WCIA 1WY0A 1ZW5A 3QKCA 3MAVA 3WCMA 4EA1A 3ICNA 4LA6A 1WL3A 3TFPA 3CP6A 3KBKA 3PDEA 4OGUA 4KPJA 5AFXA 3ICMA 3LEEA 5IL3A 4LFEA 2OPNA 4LIXA 5DGNF 3WCCA 5KSXF 3SDUA 3N5HF 4N9UA 5HN8A 4RXAA 3MZVA 2E93A 2E95A 5A0KA 4E1EA 2ZY1A 3VJCA 3WEIA 4E9ZA 4H5DF 2ZCOA 4LTVA 4OMGA 2E4OA 1V4HA 1EZFA 3VJ9A 4KFAA 1YYRA 2VF6A 4NUAA 4RYPA 3G4FA 2E8XA 5B0IA 2E8VA 3EGTA 5DJRF 1VG3A 2AELA 1V4KA 2AETA 2ONHA 1YYTA 3TS7A 5DGMF 1YYSA 3S4JA 4F6VA 4Q23A 5EAUA 5IVGA 3PKOA 5JV2F 3V1VA 4DI5A 1WL1A 3NRIA 2J1OA 2Z4ZA 5ERMA 1V4IA 3N0FA 5ILDA 3Q2QA 1N22A 3APZA 2PS6A 3BNYA 5B0LA 2EWGA 4GAXA 5ILZA 3N3DA 3CKEA 3WEGA 1JFGA 5IK9A 3NPKA 3WEHA 3ID0A 3V66A 3IPIA 3PYBA 4UMJA 3TFVA 3N49F 4JYXA 4GA3A 2QISA 1YHLA 3M00A 5B01A 3G4DA 5B02A 1FPSA 4KVYA 3N45F 3WE9A 3SDQA 4LFVF 3QQVA 3N1VF 4LPHF 2F89F 1HXAA 3M0GA 3AQ0A 4JVJF 4QXSF 2Z52A 4RXCA 3N0GA 3SDTA 1N23A 3LK5A 3LDWA 5HN7A 4NG6A 5CG6A 3SDVA 3WEJA 5ILYA 2OA6A 2Q9ZA 5ER8A 3OACA 2Q9YA 3ZMCA 3Q30A 3BNXA 5JV0F 4N1ZF 3KRAB 3KRAA 2DH4A 3M01A 2I19A 3ACYA 3LZ9A 3P41A 5E8HA 4L2XF 3P8RA 3VJDA 3DYGA 1HXCA 2ZEUA 4MC0A 1VG7A 3WC9A 3WCEA 2Q58A 2ZCRA 4LTZA 1N1BA 3PYAA 1YYUA 4H5CF 3KRFB 3KRFA 2ZEVA 5ILHA 3LGKA 2AEKA 2F9KF 4JZXA 2Z7IA 2E94A 3DYHA 3OYRA 4KQUA 3NPRA 5H9DA 3AE0A 3WCGA 4DWBA 3RYWA 3LGZB 4GP2A 3RYEA 3KROB 3KROA 3UCAA 5I1UA 2Z7HA 5DZ2A 2F94F 2PS4A 4P0VA 3ACXA 4LXWA 5JA0F 4LZ0A 4JXYA 1KIZA 3IBAA 5IL8A 4RXDA 3WCAA 4EA2A 5DW7A 2RAHA 2OGDA 3LVSA 3Q2ZA 3WJNA 3WJKA 1WL0A 1HX9A 3WCLA 3WCDA 5JUZF 2Z50A 5IMIA 5IMNA 4LZ3A 3SDRA 1WKZA 1UBWA 3WCBA 3P8LA 3OABB 3OABA 3ZOUA 4QPFA 4LLTA 2ONGA 2FTZA 3LSNA 4MC3A 3WCJA 4OKZA 3PH7A 4LLSA 5B0JA 2P1CA 3ZL6A 4KVWA 4HD1A 3ACWA 5ILIA 4E9UA 2O1OA 5DIQF 5B0MA 4PVXF 1JFAA 4F62A 3B7LA 5EROA 2Z4WA 3LOMA 4P0XA 3WEFA 1V4JA 1N1ZA 2Z4VA 3N5JF 4JXNA 3KRCB 3KRCA 3W7FA 4JZBA 4EA0A 3OACB 3LG5A 3VJAA 4NKEA 3Q1OA 1DGPA 1DI1A 2AZKA 3RMGA 3TC1A 5DJPF 3N6KF 4H5EF 5A0IA 2H8OA 2J5CA 4KVDA 1YYQA 1RQJA 1VG6A 4OKMA 4KQSA 4NFIF 1YV5A 3N1WF 2AZLA 4FJQA 2PS7A 3V1XA 5HNAA 3TFNA 4GP1A 3AQCB 1N21A 1HXGA 5E8LA 1VG2A 3EZ3A 5B0KA 5B00A 1WMWA 3ICKA 5AHUB 5C05A 4LPGF 1UBXA 5ERNA 3N3LF 3RBMA 2E91A 5IN8A 3S9VA 4XQTF 4LUUA 3WSAA 5IK0A 3AQBB 5ILKA 2J1PA 2E8WA 4OMHA 4XQRF 1HM7A 4P0WA 1YHMA 3CC9A 3EFQA 3WCFA 2Q80A 4LA5A 4NKFA 2AZJA 5EASA 3N46F 4PVYF 2E92A 4DEMF
chains in the Genus database with same CATH superfamily
5IKAA 5HN9A 4KK2A 4KUXA 5E8KA 4RNQA 3P5RA 5ILJA 1RTRA 2F8ZF 5AELA 5CG5A 4KVIA 5DJVF 2OPMA 3ZCDA 5DHKA 3ZMBA 5IK6A 5DHIA 4KQ5A 4XQSF 2F7MF 4DHDA 3M02A 5DGSF 1N24A 3LJIA 1PS1A 3P5PA 2Z78A 2Z4XA 5B03A 3WSBA 1YQ7A 1VG4A 1KIYA 5JV1F 3VJ8A 2E8UA 3VJEA 3LLWA 1UBYA 3KB9A 3KRPB 3KRPA 5AYPA 2F92F 1UBVA 4LZCA 4WK5A 5IMPA 4KWDA 2F8CF 5IKHA 3DYFA 2ZCSA 2E8TA 4K10A 3NF2A 1RQIA 4KKMA 2E90A 4DXJA 5A0JA 4ZQ8A 3WCHA 4FP4A 4DWGA 3VJBA 4KPDA 4MC8A 3ASXA 3WEKA 1N20A 4DZWA 2PS5A 5EATA 2ZCQA 2FORA 4NFKF 1WL2A 3WJOA 3SAEA 3ADZA 4NFJF 2PS8A 2Z4YA 1YHKA 1YJ4A 3M9UA 3ICZA 5IM1A 3LMDA 1HM4A 4RXEA 1V4EA 4LFGA 4LOBA 4F6XA 3WCIA 1WY0A 1ZW5A 3QKCA 3MAVA 3WCMA 4EA1A 3ICNA 4LA6A 1WL3A 3TFPA 3CP6A 3KBKA 3PDEA 4OGUA 4KPJA 5AFXA 3ICMA 3LEEA 5IL3A 4LFEA 2OPNA 4LIXA 5DGNF 3WCCA 5KSXF 3SDUA 3N5HF 4N9UA 5HN8A 4RXAA 3MZVA 2E93A 2E95A 5A0KA 4E1EA 2ZY1A 3VJCA 3WEIA 4E9ZA 4H5DF 2ZCOA 4LTVA 4OMGA 2E4OA 1V4HA 1EZFA 3VJ9A 4KFAA 1YYRA 2VF6A 4NUAA 4RYPA 3G4FA 2E8XA 5B0IA 2E8VA 3EGTA 5DJRF 1VG3A 2AELA 1V4KA 2AETA 2ONHA 1YYTA 3TS7A 5DGMF 1YYSA 3S4JA 4F6VA 4Q23A 5EAUA 5IVGA 3PKOA 5JV2F 3V1VA 4DI5A 1WL1A 3NRIA 2J1OA 2Z4ZA 5ERMA 1V4IA 3N0FA 5ILDA 3Q2QA 1N22A 3APZA 2PS6A 3BNYA 5B0LA 2EWGA 4GAXA 5ILZA 3N3DA 3CKEA 3WEGA 1JFGA 5IK9A 3NPKA 3WEHA 3ID0A 3V66A 3IPIA 3PYBA 4UMJA 3TFVA 3N49F 4JYXA 4GA3A 2QISA 1YHLA 3M00A 5B01A 3G4DA 5B02A 1FPSA 4KVYA 3N45F 3WE9A 3SDQA 4LFVF 3QQVA 3N1VF 4LPHF 2F89F 1HXAA 3M0GA 3AQ0A 4JVJF 4QXSF 2Z52A 4RXCA 3N0GA 3SDTA 1N23A 3LK5A 3LDWA 5HN7A 4NG6A 5CG6A 3SDVA 3WEJA 5ILYA 2OA6A 2Q9ZA 5ER8A 3OACA 2Q9YA 3ZMCA 3Q30A 3BNXA 5JV0F 4N1ZF 3KRAB 3KRAA 2DH4A 3M01A 2I19A 3ACYA 3LZ9A 3P41A 5E8HA 4L2XF 3P8RA 3VJDA 3DYGA 1HXCA 2ZEUA 4MC0A 1VG7A 3WC9A 3WCEA 2Q58A 2ZCRA 4LTZA 1N1BA 3PYAA 1YYUA 4H5CF 3KRFB 3KRFA 2ZEVA 5ILHA 3LGKA 2AEKA 2F9KF 4JZXA 2Z7IA 2E94A 3DYHA 3OYRA 4KQUA 3NPRA 5H9DA 3AE0A 3WCGA 4DWBA 3RYWA 3LGZB 4GP2A 3RYEA 3KROB 3KROA 3UCAA 5I1UA 2Z7HA 5DZ2A 2F94F 2PS4A 4P0VA 3ACXA 4LXWA 5JA0F 4LZ0A 4JXYA 1KIZA 3IBAA 5IL8A 4RXDA 3WCAA 4EA2A 5DW7A 2RAHA 2OGDA 3LVSA 3Q2ZA 3WJNA 3WJKA 1WL0A 1HX9A 3WCLA 3WCDA 5JUZF 2Z50A 5IMIA 5IMNA 4LZ3A 3SDRA 1WKZA 1UBWA 3WCBA 3P8LA 3OABB 3OABA 3ZOUA 4QPFA 4LLTA 2ONGA 2FTZA 3LSNA 4MC3A 3WCJA 4OKZA 3PH7A 4LLSA 5B0JA 2P1CA 3ZL6A 4KVWA 4HD1A 3ACWA 5ILIA 4E9UA 2O1OA 5DIQF 5B0MA 4PVXF 1JFAA 4F62A 3B7LA 5EROA 2Z4WA 3LOMA 4P0XA 3WEFA 1V4JA 1N1ZA 2Z4VA 3N5JF 4JXNA 3KRCB 3KRCA 3W7FA 4JZBA 4EA0A 3OACB 3LG5A 3VJAA 4NKEA 3Q1OA 1DGPA 1DI1A 2AZKA 3RMGA 3TC1A 5DJPF 3N6KF 4H5EF 5A0IA 2H8OA 2J5CA 4KVDA 1YYQA 1RQJA 1VG6A 4OKMA 4KQSA 4NFIF 1YV5A 3N1WF 2AZLA 4FJQA 2PS7A 3V1XA 5HNAA 3TFNA 4GP1A 3AQCB 1N21A 1HXGA 5E8LA 1VG2A 3EZ3A 5B0KA 5B00A 1WMWA 3ICKA 5AHUB 5C05A 4LPGF 1UBXA 5ERNA 3N3LF 3RBMA 2E91A 5IN8A 3S9VA 4XQTF 4LUUA 3WSAA 5IK0A 3AQBB 5ILKA 2J1PA 2E8WA 4OMHA 4XQRF 1HM7A 4P0WA 1YHMA 3CC9A 3EFQA 3WCFA 2Q80A 4LA5A 4NKFA 2AZJA 5EASA 3N46F 4PVYF 2E92A 4DEMF
chains in the Genus database with same CATH topology
5IKAA 5HN9A 4KK2A 4KUXA 5E8KA 4RNQA 3P5RA 5ILJA 1RTRA 2F8ZF 5AELA 5CG5A 4KVIA 5DJVF 2OPMA 3ZCDA 5DHKA 3ZMBA 5IK6A 5DHIA 4KQ5A 4XQSF 2F7MF 4DHDA 3M02A 5DGSF 1N24A 3LJIA 1PS1A 3P5PA 2Z78A 2Z4XA 5B03A 3WSBA 1YQ7A 1VG4A 1KIYA 5JV1F 3VJ8A 2E8UA 3VJEA 3LLWA 1UBYA 3KB9A 3KRPB 3KRPA 5AYPA 2F92F 1UBVA 4LZCA 4WK5A 5IMPA 4KWDA 2F8CF 5IKHA 3DYFA 2ZCSA 2E8TA 4K10A 3NF2A 1RQIA 4KKMA 2E90A 4DXJA 5A0JA 4ZQ8A 3WCHA 4FP4A 4DWGA 3VJBA 4KPDA 4MC8A 3ASXA 3WEKA 1N20A 4DZWA 2PS5A 5EATA 2ZCQA 2FORA 4NFKF 1WL2A 3WJOA 3SAEA 3ADZA 4NFJF 2PS8A 2Z4YA 1YHKA 1YJ4A 3M9UA 3ICZA 5IM1A 3LMDA 1HM4A 4RXEA 1V4EA 4LFGA 4LOBA 4F6XA 3WCIA 1WY0A 1ZW5A 3QKCA 3MAVA 3WCMA 4EA1A 3ICNA 4LA6A 1WL3A 3TFPA 3CP6A 3KBKA 3PDEA 4OGUA 4KPJA 5AFXA 3ICMA 3LEEA 5IL3A 4LFEA 2OPNA 4LIXA 5DGNF 3WCCA 5KSXF 3SDUA 3N5HF 4N9UA 5HN8A 4RXAA 3MZVA 2E93A 2E95A 5A0KA 4E1EA 2ZY1A 3VJCA 3WEIA 4E9ZA 4H5DF 2ZCOA 4LTVA 4OMGA 2E4OA 1V4HA 1EZFA 3VJ9A 4KFAA 1YYRA 2VF6A 4NUAA 4RYPA 3G4FA 2E8XA 5B0IA 2E8VA 3EGTA 5DJRF 1VG3A 2AELA 1V4KA 2AETA 2ONHA 1YYTA 3TS7A 5DGMF 1YYSA 3S4JA 4F6VA 4Q23A 5EAUA 5IVGA 3PKOA 5JV2F 3V1VA 4DI5A 1WL1A 3NRIA 2J1OA 2Z4ZA 5ERMA 1V4IA 3N0FA 5ILDA 3Q2QA 1N22A 3APZA 2PS6A 3BNYA 5B0LA 2EWGA 4GAXA 5ILZA 3N3DA 3CKEA 3WEGA 1JFGA 5IK9A 3NPKA 3WEHA 3ID0A 3V66A 3IPIA 3PYBA 4UMJA 3TFVA 3N49F 4JYXA 4GA3A 2QISA 1YHLA 3M00A 5B01A 3G4DA 5B02A 1FPSA 4KVYA 3N45F 3WE9A 3SDQA 4LFVF 3QQVA 3N1VF 4LPHF 2F89F 1HXAA 3M0GA 3AQ0A 4JVJF 4QXSF 2Z52A 4RXCA 3N0GA 3SDTA 1N23A 3LK5A 3LDWA 5HN7A 4NG6A 5CG6A 3SDVA 3WEJA 5ILYA 2OA6A 2Q9ZA 5ER8A 3OACA 2Q9YA 3ZMCA 3Q30A 3BNXA 5JV0F 4N1ZF 3KRAB 3KRAA 2DH4A 3M01A 2I19A 3ACYA 3LZ9A 3P41A 5E8HA 4L2XF 3P8RA 3VJDA 3DYGA 1HXCA 2ZEUA 4MC0A 1VG7A 3WC9A 3WCEA 2Q58A 2ZCRA 4LTZA 1N1BA 3PYAA 1YYUA 4H5CF 3KRFB 3KRFA 2ZEVA 5ILHA 3LGKA 2AEKA 2F9KF 4JZXA 2Z7IA 2E94A 3DYHA 3OYRA 4KQUA 3NPRA 5H9DA 3AE0A 3WCGA 4DWBA 3RYWA 3LGZB 4GP2A 3RYEA 3KROB 3KROA 3UCAA 5I1UA 2Z7HA 5DZ2A 2F94F 2PS4A 4P0VA 3ACXA 4LXWA 5JA0F 4LZ0A 4JXYA 1KIZA 3IBAA 5IL8A 4RXDA 3WCAA 4EA2A 5DW7A 2RAHA 2OGDA 3LVSA 3Q2ZA 3WJNA 3WJKA 1WL0A 1HX9A 3WCLA 3WCDA 5JUZF 2Z50A 5IMIA 5IMNA 4LZ3A 3SDRA 1WKZA 1UBWA 3WCBA 3P8LA 3OABB 3OABA 3ZOUA 4QPFA 4LLTA 2ONGA 2FTZA 3LSNA 4MC3A 3WCJA 4OKZA 3PH7A 4LLSA 5B0JA 2P1CA 3ZL6A 4KVWA 4HD1A 3ACWA 5ILIA 4E9UA 2O1OA 5DIQF 5B0MA 4PVXF 1JFAA 4F62A 3B7LA 5EROA 2Z4WA 3LOMA 4P0XA 3WEFA 1V4JA 1N1ZA 2Z4VA 3N5JF 4JXNA 3KRCB 3KRCA 3W7FA 4JZBA 4EA0A 3OACB 3LG5A 3VJAA 4NKEA 3Q1OA 1DGPA 1DI1A 2AZKA 3RMGA 3TC1A 5DJPF 3N6KF 4H5EF 5A0IA 2H8OA 2J5CA 4KVDA 1YYQA 1RQJA 1VG6A 4OKMA 4KQSA 4NFIF 1YV5A 3N1WF 2AZLA 4FJQA 2PS7A 3V1XA 5HNAA 3TFNA 4GP1A 3AQCB 1N21A 1HXGA 5E8LA 1VG2A 3EZ3A 5B0KA 5B00A 1WMWA 3ICKA 5AHUB 5C05A 4LPGF 1UBXA 5ERNA 3N3LF 3RBMA 2E91A 5IN8A 3S9VA 4XQTF 4LUUA 3WSAA 5IK0A 3AQBB 5ILKA 2J1PA 2E8WA 4OMHA 4XQRF 1HM7A 4P0WA 1YHMA 3CC9A 3EFQA 3WCFA 2Q80A 4LA5A 4NKFA 2AZJA 5EASA 3N46F 4PVYF 2E92A 4DEMF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IKA A;  5HN9 A;  4KK2 A;  4KUX A;  5E8K A;  4RNQ A;  3P5R A;  5ILJ A;  1RTR A;  2F8Z F;  5AEL A;  5CG5 A;  4KVI A;  5DJV F;  2OPM A;  3ZCD A;  5DHK A;  3ZMB A;  5IK6 A;  5DHI A;  4KQ5 A;  4XQS F;  2F7M F;  4DHD A;  3M02 A;  5DGS F;  1N24 A;  3LJI A;  1PS1 A;  3P5P A;  2Z78 A;  2Z4X A;  5B03 A;  3WSB A;  1YQ7 A;  1VG4 A;  1KIY A;  5JV1 F;  3VJ8 A;  2E8U A;  3VJE A;  3LLW A;  1UBY A;  3KB9 A;  3KRP B;  3KRP A;  5AYP A;  2F92 F;  1UBV A;  4LZC A;  4WK5 A;  5IMP A;  4KWD A;  2F8C F;  5IKH A;  3DYF A;  2ZCS A;  2E8T A;  4K10 A;  3NF2 A;  1RQI A;  4KKM A;  2E90 A;  4DXJ A;  5A0J A;  4ZQ8 A;  3WCH A;  4FP4 A;  4DWG A;  3VJB A;  4KPD A;  4MC8 A;  3ASX A;  3WEK A;  1N20 A;  4DZW A;  2PS5 A;  5EAT A;  2ZCQ A;  2FOR A;  4NFK F;  1WL2 A;  3WJO A;  3SAE A;  3ADZ A;  4NFJ F;  2PS8 A;  2Z4Y A;  1YHK A;  1YJ4 A;  3M9U A;  3ICZ A;  5IM1 A;  3LMD A;  1HM4 A;  4RXE A;  1V4E A;  4LFG A;  4LOB A;  4F6X A;  3WCI A;  1WY0 A;  1ZW5 A;  3QKC A;  3MAV A;  3WCM A;  4EA1 A;  3ICN A;  4LA6 A;  1WL3 A;  3TFP A;  3CP6 A;  3KBK A;  3PDE A;  4OGU A;  4KPJ A;  5AFX A;  3ICM A;  3LEE A;  5IL3 A;  4LFE A;  2OPN A;  4LIX A;  5DGN F;  3WCC A;  5KSX F;  3SDU A;  3N5H F;  4N9U A;  5HN8 A;  4RXA A;  3MZV A;  2E93 A;  2E95 A;  5A0K A;  4E1E A;  2ZY1 A;  3VJC A;  3WEI A;  4E9Z A;  4H5D F;  2ZCO A;  4LTV A;  4OMG A;  2E4O A;  1V4H A;  1EZF A;  3VJ9 A;  4KFA A;  1YYR A;  2VF6 A;  4NUA A;  4RYP A;  3G4F A;  2E8X A;  5B0I A;  2E8V A;  3EGT A;  5DJR F;  1VG3 A;  2AEL A;  1V4K A;  2AET A;  2ONH A;  1YYT A;  3TS7 A;  5DGM F;  1YYS A;  3S4J A;  4F6V A;  4Q23 A;  5EAU A;  5IVG A;  3PKO A;  5JV2 F;  3V1V A;  4DI5 A;  1WL1 A;  3NRI A;  2J1O A;  2Z4Z A;  5ERM A;  1V4I A;  3N0F A;  5ILD A;  3Q2Q A;  1N22 A;  3APZ A;  2PS6 A;  3BNY A;  5B0L A;  2EWG A;  4GAX A;  5ILZ A;  3N3D A;  3CKE A;  3WEG A;  1JFG A;  5IK9 A;  3NPK A;  3WEH A;  3ID0 A;  3V66 A;  3IPI A;  3PYB A;  4UMJ A;  3TFV A;  3N49 F;  4JYX A;  4GA3 A;  2QIS A;  1YHL A;  3M00 A;  5B01 A;  3G4D A;  5B02 A;  1FPS A;  4KVY A;  3N45 F;  3WE9 A;  3SDQ A;  4LFV F;  3QQV A;  3N1V F;  4LPH F;  2F89 F;  1HXA A;  3M0G A;  3AQ0 A;  4JVJ F;  4QXS F;  2Z52 A;  4RXC A;  3N0G A;  3SDT A;  1N23 A;  3LK5 A;  3LDW A;  5HN7 A;  4NG6 A;  5CG6 A;  3SDV A;  3WEJ A;  5ILY A;  2OA6 A;  2Q9Z A;  5ER8 A;  3OAC A;  2Q9Y A;  3ZMC A;  3Q30 A;  3BNX A;  5JV0 F;  4N1Z F;  3KRA B;  3KRA A;  2DH4 A;  3M01 A;  2I19 A;  3ACY A;  3LZ9 A;  3P41 A;  5E8H A;  4L2X F;  3P8R A;  3VJD A;  3DYG A;  1HXC A;  2ZEU A;  4MC0 A;  1VG7 A;  3WC9 A;  3WCE A;  2Q58 A;  2ZCR A;  4LTZ A;  1N1B A;  3PYA A;  1YYU A;  4H5C F;  3KRF B;  3KRF A;  2ZEV A;  5ILH A;  3LGK A;  2AEK A;  2F9K F;  4JZX A;  2Z7I A;  2E94 A;  3DYH A;  3OYR A;  4KQU A;  3NPR A;  5H9D A;  3AE0 A;  3WCG A;  4DWB A;  3RYW A;  3LGZ B;  4GP2 A;  3RYE A;  3KRO B;  3KRO A;  3UCA A;  5I1U A;  2Z7H A;  5DZ2 A;  2F94 F;  2PS4 A;  4P0V A;  3ACX A;  4LXW A;  5JA0 F;  4LZ0 A;  4JXY A;  1KIZ A;  3IBA A;  5IL8 A;  4RXD A;  3WCA A;  4EA2 A;  5DW7 A;  2RAH A;  2OGD A;  3LVS A;  3Q2Z A;  3WJN A;  3WJK A;  1WL0 A;  1HX9 A;  3WCL A;  3WCD A;  5JUZ F;  2Z50 A;  5IMI A;  5IMN A;  4LZ3 A;  3SDR A;  1WKZ A;  1UBW A;  3WCB A;  3P8L A;  3OAB B;  3OAB A;  3ZOU A;  4QPF A;  4LLT A;  2ONG A;  2FTZ A;  3LSN A;  4MC3 A;  3WCJ A;  4OKZ A;  3PH7 A;  4LLS A;  5B0J A;  2P1C A;  3ZL6 A;  4KVW A;  4HD1 A;  3ACW A;  5ILI A;  4E9U A;  2O1O A;  5DIQ F;  5B0M A;  4PVX F;  1JFA A;  4F62 A;  3B7L A;  5ERO A;  2Z4W A;  3LOM A;  4P0X A;  3WEF A;  1V4J A;  1N1Z A;  2Z4V A;  3N5J F;  4JXN A;  3KRC B;  3KRC A;  3W7F A;  4JZB A;  4EA0 A;  3OAC B;  3LG5 A;  3VJA A;  4NKE A;  3Q1O A;  1DGP A;  1DI1 A;  2AZK A;  3RMG A;  3TC1 A;  5DJP F;  3N6K F;  4H5E F;  5A0I A;  2H8O A;  2J5C A;  4KVD A;  1YYQ A;  1RQJ A;  1VG6 A;  4OKM A;  4KQS A;  4NFI F;  1YV5 A;  3N1W F;  2AZL A;  4FJQ A;  2PS7 A;  3V1X A;  5HNA A;  3TFN A;  4GP1 A;  3AQC B;  1N21 A;  1HXG A;  5E8L A;  1VG2 A;  3EZ3 A;  5B0K A;  5B00 A;  1WMW A;  3ICK A;  5AHU B;  5C05 A;  4LPG F;  1UBX A;  5ERN A;  3N3L F;  3RBM A;  2E91 A;  5IN8 A;  3S9V A;  4XQT F;  4LUU A;  3WSA A;  5IK0 A;  3AQB B;  5ILK A;  2J1P A;  2E8W A;  4OMH A;  4XQR F;  1HM7 A;  4P0W A;  1YHM A;  3CC9 A;  3EFQ A;  3WCF A;  2Q80 A;  4LA5 A;  4NKF A;  2AZJ A;  5EAS A;  3N46 F;  4PVY F;  2E92 A;  4DEM F; 
#chains in the Genus database with same CATH topology
 5IKA A;  5HN9 A;  4KK2 A;  4KUX A;  5E8K A;  4RNQ A;  3P5R A;  5ILJ A;  1RTR A;  2F8Z F;  5AEL A;  5CG5 A;  4KVI A;  5DJV F;  2OPM A;  3ZCD A;  5DHK A;  3ZMB A;  5IK6 A;  5DHI A;  4KQ5 A;  4XQS F;  2F7M F;  4DHD A;  3M02 A;  5DGS F;  1N24 A;  3LJI A;  1PS1 A;  3P5P A;  2Z78 A;  2Z4X A;  5B03 A;  3WSB A;  1YQ7 A;  1VG4 A;  1KIY A;  5JV1 F;  3VJ8 A;  2E8U A;  3VJE A;  3LLW A;  1UBY A;  3KB9 A;  3KRP B;  3KRP A;  5AYP A;  2F92 F;  1UBV A;  4LZC A;  4WK5 A;  5IMP A;  4KWD A;  2F8C F;  5IKH A;  3DYF A;  2ZCS A;  2E8T A;  4K10 A;  3NF2 A;  1RQI A;  4KKM A;  2E90 A;  4DXJ A;  5A0J A;  4ZQ8 A;  3WCH A;  4FP4 A;  4DWG A;  3VJB A;  4KPD A;  4MC8 A;  3ASX A;  3WEK A;  1N20 A;  4DZW A;  2PS5 A;  5EAT A;  2ZCQ A;  2FOR A;  4NFK F;  1WL2 A;  3WJO A;  3SAE A;  3ADZ A;  4NFJ F;  2PS8 A;  2Z4Y A;  1YHK A;  1YJ4 A;  3M9U A;  3ICZ A;  5IM1 A;  3LMD A;  1HM4 A;  4RXE A;  1V4E A;  4LFG A;  4LOB A;  4F6X A;  3WCI A;  1WY0 A;  1ZW5 A;  3QKC A;  3MAV A;  3WCM A;  4EA1 A;  3ICN A;  4LA6 A;  1WL3 A;  3TFP A;  3CP6 A;  3KBK A;  3PDE A;  4OGU A;  4KPJ A;  5AFX A;  3ICM A;  3LEE A;  5IL3 A;  4LFE A;  2OPN A;  4LIX A;  5DGN F;  3WCC A;  5KSX F;  3SDU A;  3N5H F;  4N9U A;  5HN8 A;  4RXA A;  3MZV A;  2E93 A;  2E95 A;  5A0K A;  4E1E A;  2ZY1 A;  3VJC A;  3WEI A;  4E9Z A;  4H5D F;  2ZCO A;  4LTV A;  4OMG A;  2E4O A;  1V4H A;  1EZF A;  3VJ9 A;  4KFA A;  1YYR A;  2VF6 A;  4NUA A;  4RYP A;  3G4F A;  2E8X A;  5B0I A;  2E8V A;  3EGT A;  5DJR F;  1VG3 A;  2AEL A;  1V4K A;  2AET A;  2ONH A;  1YYT A;  3TS7 A;  5DGM F;  1YYS A;  3S4J A;  4F6V A;  4Q23 A;  5EAU A;  5IVG A;  3PKO A;  5JV2 F;  3V1V A;  4DI5 A;  1WL1 A;  3NRI A;  2J1O A;  2Z4Z A;  5ERM A;  1V4I A;  3N0F A;  5ILD A;  3Q2Q A;  1N22 A;  3APZ A;  2PS6 A;  3BNY A;  5B0L A;  2EWG A;  4GAX A;  5ILZ A;  3N3D A;  3CKE A;  3WEG A;  1JFG A;  5IK9 A;  3NPK A;  3WEH A;  3ID0 A;  3V66 A;  3IPI A;  3PYB A;  4UMJ A;  3TFV A;  3N49 F;  4JYX A;  4GA3 A;  2QIS A;  1YHL A;  3M00 A;  5B01 A;  3G4D A;  5B02 A;  1FPS A;  4KVY A;  3N45 F;  3WE9 A;  3SDQ A;  4LFV F;  3QQV A;  3N1V F;  4LPH F;  2F89 F;  1HXA A;  3M0G A;  3AQ0 A;  4JVJ F;  4QXS F;  2Z52 A;  4RXC A;  3N0G A;  3SDT A;  1N23 A;  3LK5 A;  3LDW A;  5HN7 A;  4NG6 A;  5CG6 A;  3SDV A;  3WEJ A;  5ILY A;  2OA6 A;  2Q9Z A;  5ER8 A;  3OAC A;  2Q9Y A;  3ZMC A;  3Q30 A;  3BNX A;  5JV0 F;  4N1Z F;  3KRA B;  3KRA A;  2DH4 A;  3M01 A;  2I19 A;  3ACY A;  3LZ9 A;  3P41 A;  5E8H A;  4L2X F;  3P8R A;  3VJD A;  3DYG A;  1HXC A;  2ZEU A;  4MC0 A;  1VG7 A;  3WC9 A;  3WCE A;  2Q58 A;  2ZCR A;  4LTZ A;  1N1B A;  3PYA A;  1YYU A;  4H5C F;  3KRF B;  3KRF A;  2ZEV A;  5ILH A;  3LGK A;  2AEK A;  2F9K F;  4JZX A;  2Z7I A;  2E94 A;  3DYH A;  3OYR A;  4KQU A;  3NPR A;  5H9D A;  3AE0 A;  3WCG A;  4DWB A;  3RYW A;  3LGZ B;  4GP2 A;  3RYE A;  3KRO B;  3KRO A;  3UCA A;  5I1U A;  2Z7H A;  5DZ2 A;  2F94 F;  2PS4 A;  4P0V A;  3ACX A;  4LXW A;  5JA0 F;  4LZ0 A;  4JXY A;  1KIZ A;  3IBA A;  5IL8 A;  4RXD A;  3WCA A;  4EA2 A;  5DW7 A;  2RAH A;  2OGD A;  3LVS A;  3Q2Z A;  3WJN A;  3WJK A;  1WL0 A;  1HX9 A;  3WCL A;  3WCD A;  5JUZ F;  2Z50 A;  5IMI A;  5IMN A;  4LZ3 A;  3SDR A;  1WKZ A;  1UBW A;  3WCB A;  3P8L A;  3OAB B;  3OAB A;  3ZOU A;  4QPF A;  4LLT A;  2ONG A;  2FTZ A;  3LSN A;  4MC3 A;  3WCJ A;  4OKZ A;  3PH7 A;  4LLS A;  5B0J A;  2P1C A;  3ZL6 A;  4KVW A;  4HD1 A;  3ACW A;  5ILI A;  4E9U A;  2O1O A;  5DIQ F;  5B0M A;  4PVX F;  1JFA A;  4F62 A;  3B7L A;  5ERO A;  2Z4W A;  3LOM A;  4P0X A;  3WEF A;  1V4J A;  1N1Z A;  2Z4V A;  3N5J F;  4JXN A;  3KRC B;  3KRC A;  3W7F A;  4JZB A;  4EA0 A;  3OAC B;  3LG5 A;  3VJA A;  4NKE A;  3Q1O A;  1DGP A;  1DI1 A;  2AZK A;  3RMG A;  3TC1 A;  5DJP F;  3N6K F;  4H5E F;  5A0I A;  2H8O A;  2J5C A;  4KVD A;  1YYQ A;  1RQJ A;  1VG6 A;  4OKM A;  4KQS A;  4NFI F;  1YV5 A;  3N1W F;  2AZL A;  4FJQ A;  2PS7 A;  3V1X A;  5HNA A;  3TFN A;  4GP1 A;  3AQC B;  1N21 A;  1HXG A;  5E8L A;  1VG2 A;  3EZ3 A;  5B0K A;  5B00 A;  1WMW A;  3ICK A;  5AHU B;  5C05 A;  4LPG F;  1UBX A;  5ERN A;  3N3L F;  3RBM A;  2E91 A;  5IN8 A;  3S9V A;  4XQT F;  4LUU A;  3WSA A;  5IK0 A;  3AQB B;  5ILK A;  2J1P A;  2E8W A;  4OMH A;  4XQR F;  1HM7 A;  4P0W A;  1YHM A;  3CC9 A;  3EFQ A;  3WCF A;  2Q80 A;  4LA5 A;  4NKF A;  2AZJ A;  5EAS A;  3N46 F;  4PVY F;  2E92 A;  4DEM F; 
#chains in the Genus database with same CATH homology
 5IKA A;  5HN9 A;  4KK2 A;  4KUX A;  5E8K A;  4RNQ A;  3P5R A;  5ILJ A;  1RTR A;  2F8Z F;  5AEL A;  5CG5 A;  4KVI A;  5DJV F;  2OPM A;  3ZCD A;  5DHK A;  3ZMB A;  5IK6 A;  5DHI A;  4KQ5 A;  4XQS F;  2F7M F;  4DHD A;  3M02 A;  5DGS F;  1N24 A;  3LJI A;  1PS1 A;  3P5P A;  2Z78 A;  2Z4X A;  5B03 A;  3WSB A;  1YQ7 A;  1VG4 A;  1KIY A;  5JV1 F;  3VJ8 A;  2E8U A;  3VJE A;  3LLW A;  1UBY A;  3KB9 A;  3KRP B;  3KRP A;  5AYP A;  2F92 F;  1UBV A;  4LZC A;  4WK5 A;  5IMP A;  4KWD A;  2F8C F;  5IKH A;  3DYF A;  2ZCS A;  2E8T A;  4K10 A;  3NF2 A;  1RQI A;  4KKM A;  2E90 A;  4DXJ A;  5A0J A;  4ZQ8 A;  3WCH A;  4FP4 A;  4DWG A;  3VJB A;  4KPD A;  4MC8 A;  3ASX A;  3WEK A;  1N20 A;  4DZW A;  2PS5 A;  5EAT A;  2ZCQ A;  2FOR A;  4NFK F;  1WL2 A;  3WJO A;  3SAE A;  3ADZ A;  4NFJ F;  2PS8 A;  2Z4Y A;  1YHK A;  1YJ4 A;  3M9U A;  3ICZ A;  5IM1 A;  3LMD A;  1HM4 A;  4RXE A;  1V4E A;  4LFG A;  4LOB A;  4F6X A;  3WCI A;  1WY0 A;  1ZW5 A;  3QKC A;  3MAV A;  3WCM A;  4EA1 A;  3ICN A;  4LA6 A;  1WL3 A;  3TFP A;  3CP6 A;  3KBK A;  3PDE A;  4OGU A;  4KPJ A;  5AFX A;  3ICM A;  3LEE A;  5IL3 A;  4LFE A;  2OPN A;  4LIX A;  5DGN F;  3WCC A;  5KSX F;  3SDU A;  3N5H F;  4N9U A;  5HN8 A;  4RXA A;  3MZV A;  2E93 A;  2E95 A;  5A0K A;  4E1E A;  2ZY1 A;  3VJC A;  3WEI A;  4E9Z A;  4H5D F;  2ZCO A;  4LTV A;  4OMG A;  2E4O A;  1V4H A;  1EZF A;  3VJ9 A;  4KFA A;  1YYR A;  2VF6 A;  4NUA A;  4RYP A;  3G4F A;  2E8X A;  5B0I A;  2E8V A;  3EGT A;  5DJR F;  1VG3 A;  2AEL A;  1V4K A;  2AET A;  2ONH A;  1YYT A;  3TS7 A;  5DGM F;  1YYS A;  3S4J A;  4F6V A;  4Q23 A;  5EAU A;  5IVG A;  3PKO A;  5JV2 F;  3V1V A;  4DI5 A;  1WL1 A;  3NRI A;  2J1O A;  2Z4Z A;  5ERM A;  1V4I A;  3N0F A;  5ILD A;  3Q2Q A;  1N22 A;  3APZ A;  2PS6 A;  3BNY A;  5B0L A;  2EWG A;  4GAX A;  5ILZ A;  3N3D A;  3CKE A;  3WEG A;  1JFG A;  5IK9 A;  3NPK A;  3WEH A;  3ID0 A;  3V66 A;  3IPI A;  3PYB A;  4UMJ A;  3TFV A;  3N49 F;  4JYX A;  4GA3 A;  2QIS A;  1YHL A;  3M00 A;  5B01 A;  3G4D A;  5B02 A;  1FPS A;  4KVY A;  3N45 F;  3WE9 A;  3SDQ A;  4LFV F;  3QQV A;  3N1V F;  4LPH F;  2F89 F;  1HXA A;  3M0G A;  3AQ0 A;  4JVJ F;  4QXS F;  2Z52 A;  4RXC A;  3N0G A;  3SDT A;  1N23 A;  3LK5 A;  3LDW A;  5HN7 A;  4NG6 A;  5CG6 A;  3SDV A;  3WEJ A;  5ILY A;  2OA6 A;  2Q9Z A;  5ER8 A;  3OAC A;  2Q9Y A;  3ZMC A;  3Q30 A;  3BNX A;  5JV0 F;  4N1Z F;  3KRA B;  3KRA A;  2DH4 A;  3M01 A;  2I19 A;  3ACY A;  3LZ9 A;  3P41 A;  5E8H A;  4L2X F;  3P8R A;  3VJD A;  3DYG A;  1HXC A;  2ZEU A;  4MC0 A;  1VG7 A;  3WC9 A;  3WCE A;  2Q58 A;  2ZCR A;  4LTZ A;  1N1B A;  3PYA A;  1YYU A;  4H5C F;  3KRF B;  3KRF A;  2ZEV A;  5ILH A;  3LGK A;  2AEK A;  2F9K F;  4JZX A;  2Z7I A;  2E94 A;  3DYH A;  3OYR A;  4KQU A;  3NPR A;  5H9D A;  3AE0 A;  3WCG A;  4DWB A;  3RYW A;  3LGZ B;  4GP2 A;  3RYE A;  3KRO B;  3KRO A;  3UCA A;  5I1U A;  2Z7H A;  5DZ2 A;  2F94 F;  2PS4 A;  4P0V A;  3ACX A;  4LXW A;  5JA0 F;  4LZ0 A;  4JXY A;  1KIZ A;  3IBA A;  5IL8 A;  4RXD A;  3WCA A;  4EA2 A;  5DW7 A;  2RAH A;  2OGD A;  3LVS A;  3Q2Z A;  3WJN A;  3WJK A;  1WL0 A;  1HX9 A;  3WCL A;  3WCD A;  5JUZ F;  2Z50 A;  5IMI A;  5IMN A;  4LZ3 A;  3SDR A;  1WKZ A;  1UBW A;  3WCB A;  3P8L A;  3OAB B;  3OAB A;  3ZOU A;  4QPF A;  4LLT A;  2ONG A;  2FTZ A;  3LSN A;  4MC3 A;  3WCJ A;  4OKZ A;  3PH7 A;  4LLS A;  5B0J A;  2P1C A;  3ZL6 A;  4KVW A;  4HD1 A;  3ACW A;  5ILI A;  4E9U A;  2O1O A;  5DIQ F;  5B0M A;  4PVX F;  1JFA A;  4F62 A;  3B7L A;  5ERO A;  2Z4W A;  3LOM A;  4P0X A;  3WEF A;  1V4J A;  1N1Z A;  2Z4V A;  3N5J F;  4JXN A;  3KRC B;  3KRC A;  3W7F A;  4JZB A;  4EA0 A;  3OAC B;  3LG5 A;  3VJA A;  4NKE A;  3Q1O A;  1DGP A;  1DI1 A;  2AZK A;  3RMG A;  3TC1 A;  5DJP F;  3N6K F;  4H5E F;  5A0I A;  2H8O A;  2J5C A;  4KVD A;  1YYQ A;  1RQJ A;  1VG6 A;  4OKM A;  4KQS A;  4NFI F;  1YV5 A;  3N1W F;  2AZL A;  4FJQ A;  2PS7 A;  3V1X A;  5HNA A;  3TFN A;  4GP1 A;  3AQC B;  1N21 A;  1HXG A;  5E8L A;  1VG2 A;  3EZ3 A;  5B0K A;  5B00 A;  1WMW A;  3ICK A;  5AHU B;  5C05 A;  4LPG F;  1UBX A;  5ERN A;  3N3L F;  3RBM A;  2E91 A;  5IN8 A;  3S9V A;  4XQT F;  4LUU A;  3WSA A;  5IK0 A;  3AQB B;  5ILK A;  2J1P A;  2E8W A;  4OMH A;  4XQR F;  1HM7 A;  4P0W A;  1YHM A;  3CC9 A;  3EFQ A;  3WCF A;  2Q80 A;  4LA5 A;  4NKF A;  2AZJ A;  5EAS A;  3N46 F;  4PVY F;  2E92 A;  4DEM F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...