1DI1A

Crystal structure of aristolochene synthase from penicillium roqueforti
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
300
structure length
290
Chain Sequence
TPPPTQWSYLCHPRVKEVQDEVDGYFLENWKFPSFKAVRTFLDAKFSEVTCLYFPLALDDRIHFACRLLTVLFLIDDVLEHMSFADGEAYNNRLIPISRGDVLPDRTKPEEFILYDLWESMRAHDAELANEVLEPTFVFMRAQTDRARLSIHELGHYLEYREKDVGKALLSALMRFSMGLRLSADELQDMKALEANCAKQLSVVNDIYSYDKEEEALCSAVKVLAEESKLGIPATKRVLWSMTREWETVHDEIVAEKIASPDGCSEAAKAYMKGLEYQMSGNEQWSKTTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ARISTOLOCHENE SYNTHASE
publication title Crystal structure determination of aristolochene synthase from the blue cheese mold, Penicillium roqueforti.
pubmed doi rcsb
source organism Penicillium roqueforti
total genus 114
structure length 290
sequence length 300
chains with identical sequence B
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 1999-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 1di1A00
3ZMBA 5JA0F 4NG6A 3KRAB 3IBAA 3VJ9A 4MC0A 2Z52A 4NFKF 3LLWA 1YYRA 5EROA 3LGKA 3LMDA 3P8RA 1N1ZA 2E95A 1WL0A 2E90A 3N0FA 4OGUA 3TC1A 1N20A 1N23A 4GP2A 3WE9A 3WEIA 2E8VA 4KVDA 3TFVA 1ZW5A 4KVWA 2AZJA 2OGDA 3WEHA 4DZWA 5ERNA 5IMNA 3AE0A 5ERMA 2ZCOA 1WKZA 4KKMA 4LIXA 4LTZA 3N6KF 4RNQA 2J1PA 4PVXF 4KFAA 4KPDA 2AZLA 5C05A 5A0KA 3WCEA 2PS8A 2Z4VA 4JYXA 5CG6A 4KVYA 3ZCDA 5B00A 4E9UA 3LK5A 4GP1A 4LPHF 5EASA 5ILHA 3ICZA 1N1BA 2ZEVA 4MC3A 1WY0A 3V1VA 2Z4XA 4JVJF 4F6XA 4DWGA 3WJKA 5ILZA 3OABB 3S4JA 3TFPA 3CC9A 4KPJA 4QPFA 3WJNA 3LDWA 5IL3A 4JXYA 1V4EA 5ILIA 5DJRF 1V4IA 2VF6A 2ZY1A 1WL1A 3G4DA 3N3LF 4LOBA 3PH7A 3DYHA 5DZ2A 3SDVA 2ZEUA 5ER8A 3PYBA 2FORA 5KSXF 3NRIA 4KQSA 1WL2A 5ILKA 1HM4A 4LZCA 5IKAA 1N22A 3WCCA 4LFGA 2E8XA 2H8OA 2Z7HA 4OMGA 3N45F 3QKCA 2RAHA 3G4FA 4JZXA 3KBKA 4NFJF 4XQRF 3BNYA 3SDUA 2Z4ZA 4JXNA 5I1UA 3APZA 5AHUB 2I19A 2O1OA 4LLTA 2J5CA 3RMGA 2FTZA 5AYPA 3M02A 3P8LA 4QXSF 5DGNF 5IK0A 3WSAA 1HM7A 3V1XA 4XQSF 2AEKA 4P0WA 1YQ7A 4LFEA 1JFAA 5DHKA 4DXJA 2E8TA 3KB9A 1V4KA 5IK9A 4DHDA 5ILJA 3P41A 3OACB 4NKFA 3ACYA 5B0KA 3S9VA 3WCIA 1DI1A 4RXDA 2P1CA 2Q9YA 5ILYA 4DEMF 3N3DA 3ID0A 3ZOUA 1WL3A 3MZVA 5IVGA 4KUXA 4GA3A 4NFIF 4H5EF 2Q80A 3PDEA 5DGSF 5ILDA 3KRAA 3LG5A 4HD1A 3KRCB 3WCLA 3VJEA 4LZ0A 2AZKA 5DGMF 4KWDA 1YHLA 4MC8A 3WC9A 3W7FA 5H9DA 3EZ3A 4ZQ8A 5IMIA 5CG5A 3MAVA 1FPSA 5E8LA 5IK6A 1RTRA 3NPRA 2E93A 2QISA 5DW7A 2F94F 3OACA 3NF2A 3PYAA 4H5DF 2OPNA 4LXWA 4WK5A 4LA6A 3QQVA 2Q9ZA 2ZCRA 4LLSA 3Q2QA 4OMHA 4RYPA 3VJ8A 5JV0F 4KQUA 2Z78A 5IL8A 4UMJA 3Q30A 3CP6A 4L2XF 1YV5A 3WCMA 1YHMA 5B03A 3ICKA 4NUAA 2AELA 3DYFA 5DJPF 5IN8A 1YYQA 3KROB 1HXGA 3KRFB 2Z4WA 4RXEA 3EFQA 3WCGA 3V66A 3KRCA 3WCAA 2OA6A 4P0XA 3SDRA 4EA0A 5A0JA 1VG3A 5DJVF 4NKEA 3B7LA 3ADZA 4F62A 3OABA 3Q1OA 5B0JA 5EATA 1KIYA 5HN9A 5IMPA 1UBWA 1V4HA 1HX9A 1VG4A 4XQTF 1VG7A 4P0VA 5IKHA 2E8WA 3WCHA 3VJBA 1UBVA 3RYEA 3N1VF 1RQJA 3IPIA 3AQCB 5A0IA 3BNXA 2F89F 3SDQA 3OYRA 4PVYF 3AQ0A 2ONHA 3RBMA 4K10A 2ONGA 3WEKA 2AETA 3LJIA 3LVSA 1UBXA 3KROA 2ZCSA 3M00A 3KRFA 2PS4A 5AFXA 2E94A 5IM1A 5JUZF 2Z4YA 3SDTA 4GAXA 2EWGA 3VJAA 4DWBA 1YYTA 3Q2ZA 3WCBA 4OKZA 3RYWA 4F6VA 5DIQF 3M0GA 3TFNA 4N1ZF 3WEGA 4OKMA 3KRPB 4KQ5A 3ZL6A 1UBYA 3TS7A 3LOMA 4E1EA 5JV2F 4KK2A 1YHKA 5B0LA 2E8UA 2Z7IA 3WEFA 3ZMCA 3VJDA 2J1OA 4Q23A 3AQBB 3WCDA 5B01A 5HNAA 3LZ9A 5JV1F 1JFGA 1N24A 4LA5A 4FJQA 3WCFA 5B02A 3M9UA 5EAUA 2Z50A 1WMWA 5E8HA 3N0GA 3P5RA 4EA2A 2F92F 3DYGA 2F7MF 5AELA 2F9KF 2DH4A 4LFVF 2F8ZF 2OPMA 1YYSA 4E9ZA 2E4OA 3N5JF 4LZ3A 4JZBA 3KRPA 3N5HF 3UCAA 2PS6A 5DHIA 5HN8A 4RXAA 3PKOA 3LSNA 3WCJA 3M01A 2PS7A 4FP4A 1PS1A 5HN7A 2F8CF 2Q58A 3ICNA 4N9UA 2E92A 4KVIA 1YJ4A 1V4JA 4DI5A 3ACXA 3WEJA 1VG6A 4EA1A 2PS5A 3VJCA 3N1WF 1RQIA 3WSBA 4LTVA 5E8KA 3ASXA 1KIZA 3WJOA 4H5CF 3LEEA 3N49F 5B0IA 1HXCA 3LGZB 3N46F 3NPKA 1VG2A 3ACWA 1EZFA 5B0MA 4RXCA 1DGPA 1HXAA 2E91A 3SAEA 1N21A 4LPGF 1YYUA 3CKEA 3EGTA 4LUUA 3P5PA 3ICMA 2ZCQA
chains in the Genus database with same CATH superfamily
3ZMBA 5JA0F 4NG6A 3KRAB 3IBAA 3VJ9A 4MC0A 2Z52A 4NFKF 3LLWA 1YYRA 5EROA 3LGKA 3LMDA 3P8RA 1N1ZA 2E95A 1WL0A 2E90A 3N0FA 4OGUA 3TC1A 1N20A 1N23A 4GP2A 3WE9A 3WEIA 2E8VA 4KVDA 3TFVA 1ZW5A 4KVWA 2AZJA 2OGDA 3WEHA 4DZWA 5ERNA 5IMNA 3AE0A 5ERMA 2ZCOA 1WKZA 4KKMA 4LIXA 4LTZA 3N6KF 4RNQA 2J1PA 4PVXF 4KFAA 4KPDA 2AZLA 5C05A 5A0KA 3WCEA 2PS8A 2Z4VA 4JYXA 5CG6A 4KVYA 3ZCDA 5B00A 4E9UA 3LK5A 4GP1A 4LPHF 5EASA 5ILHA 3ICZA 1N1BA 2ZEVA 4MC3A 1WY0A 3V1VA 2Z4XA 4JVJF 4F6XA 4DWGA 3WJKA 5ILZA 3OABB 3S4JA 3TFPA 3CC9A 4KPJA 4QPFA 3WJNA 3LDWA 5IL3A 4JXYA 1V4EA 5ILIA 5DJRF 1V4IA 2VF6A 2ZY1A 1WL1A 3G4DA 3N3LF 4LOBA 3PH7A 3DYHA 5DZ2A 3SDVA 2ZEUA 5ER8A 3PYBA 2FORA 5KSXF 3NRIA 4KQSA 1WL2A 5ILKA 1HM4A 4LZCA 5IKAA 1N22A 3WCCA 4LFGA 2E8XA 2H8OA 2Z7HA 4OMGA 3N45F 3QKCA 2RAHA 3G4FA 4JZXA 3KBKA 4NFJF 4XQRF 3BNYA 3SDUA 2Z4ZA 4JXNA 5I1UA 3APZA 5AHUB 2I19A 2O1OA 4LLTA 2J5CA 3RMGA 2FTZA 5AYPA 3M02A 3P8LA 4QXSF 5DGNF 5IK0A 3WSAA 1HM7A 3V1XA 4XQSF 2AEKA 4P0WA 1YQ7A 4LFEA 1JFAA 5DHKA 4DXJA 2E8TA 3KB9A 1V4KA 5IK9A 4DHDA 5ILJA 3P41A 3OACB 4NKFA 3ACYA 5B0KA 3S9VA 3WCIA 1DI1A 4RXDA 2P1CA 2Q9YA 5ILYA 4DEMF 3N3DA 3ID0A 3ZOUA 1WL3A 3MZVA 5IVGA 4KUXA 4GA3A 4NFIF 4H5EF 2Q80A 3PDEA 5DGSF 5ILDA 3KRAA 3LG5A 4HD1A 3KRCB 3WCLA 3VJEA 4LZ0A 2AZKA 5DGMF 4KWDA 1YHLA 4MC8A 3WC9A 3W7FA 5H9DA 3EZ3A 4ZQ8A 5IMIA 5CG5A 3MAVA 1FPSA 5E8LA 5IK6A 1RTRA 3NPRA 2E93A 2QISA 5DW7A 2F94F 3OACA 3NF2A 3PYAA 4H5DF 2OPNA 4LXWA 4WK5A 4LA6A 3QQVA 2Q9ZA 2ZCRA 4LLSA 3Q2QA 4OMHA 4RYPA 3VJ8A 5JV0F 4KQUA 2Z78A 5IL8A 4UMJA 3Q30A 3CP6A 4L2XF 1YV5A 3WCMA 1YHMA 5B03A 3ICKA 4NUAA 2AELA 3DYFA 5DJPF 5IN8A 1YYQA 3KROB 1HXGA 3KRFB 2Z4WA 4RXEA 3EFQA 3WCGA 3V66A 3KRCA 3WCAA 2OA6A 4P0XA 3SDRA 4EA0A 5A0JA 1VG3A 5DJVF 4NKEA 3B7LA 3ADZA 4F62A 3OABA 3Q1OA 5B0JA 5EATA 1KIYA 5HN9A 5IMPA 1UBWA 1V4HA 1HX9A 1VG4A 4XQTF 1VG7A 4P0VA 5IKHA 2E8WA 3WCHA 3VJBA 1UBVA 3RYEA 3N1VF 1RQJA 3IPIA 3AQCB 5A0IA 3BNXA 2F89F 3SDQA 3OYRA 4PVYF 3AQ0A 2ONHA 3RBMA 4K10A 2ONGA 3WEKA 2AETA 3LJIA 3LVSA 1UBXA 3KROA 2ZCSA 3M00A 3KRFA 2PS4A 5AFXA 2E94A 5IM1A 5JUZF 2Z4YA 3SDTA 4GAXA 2EWGA 3VJAA 4DWBA 1YYTA 3Q2ZA 3WCBA 4OKZA 3RYWA 4F6VA 5DIQF 3M0GA 3TFNA 4N1ZF 3WEGA 4OKMA 3KRPB 4KQ5A 3ZL6A 1UBYA 3TS7A 3LOMA 4E1EA 5JV2F 4KK2A 1YHKA 5B0LA 2E8UA 2Z7IA 3WEFA 3ZMCA 3VJDA 2J1OA 4Q23A 3AQBB 3WCDA 5B01A 5HNAA 3LZ9A 5JV1F 1JFGA 1N24A 4LA5A 4FJQA 3WCFA 5B02A 3M9UA 5EAUA 2Z50A 1WMWA 5E8HA 3N0GA 3P5RA 4EA2A 2F92F 3DYGA 2F7MF 5AELA 2F9KF 2DH4A 4LFVF 2F8ZF 2OPMA 1YYSA 4E9ZA 2E4OA 3N5JF 4LZ3A 4JZBA 3KRPA 3N5HF 3UCAA 2PS6A 5DHIA 5HN8A 4RXAA 3PKOA 3LSNA 3WCJA 3M01A 2PS7A 4FP4A 1PS1A 5HN7A 2F8CF 2Q58A 3ICNA 4N9UA 2E92A 4KVIA 1YJ4A 1V4JA 4DI5A 3ACXA 3WEJA 1VG6A 4EA1A 2PS5A 3VJCA 3N1WF 1RQIA 3WSBA 4LTVA 5E8KA 3ASXA 1KIZA 3WJOA 4H5CF 3LEEA 3N49F 5B0IA 1HXCA 3LGZB 3N46F 3NPKA 1VG2A 3ACWA 1EZFA 5B0MA 4RXCA 1DGPA 1HXAA 2E91A 3SAEA 1N21A 4LPGF 1YYUA 3CKEA 3EGTA 4LUUA 3P5PA 3ICMA 2ZCQA
chains in the Genus database with same CATH topology
3ZMBA 5JA0F 4NG6A 3KRAB 3IBAA 3VJ9A 4MC0A 2Z52A 4NFKF 3LLWA 1YYRA 5EROA 3LGKA 3LMDA 3P8RA 1N1ZA 2E95A 1WL0A 2E90A 3N0FA 4OGUA 3TC1A 1N20A 1N23A 4GP2A 3WE9A 3WEIA 2E8VA 4KVDA 3TFVA 1ZW5A 4KVWA 2AZJA 2OGDA 3WEHA 4DZWA 5ERNA 5IMNA 3AE0A 5ERMA 2ZCOA 1WKZA 4KKMA 4LIXA 4LTZA 3N6KF 4RNQA 2J1PA 4PVXF 4KFAA 4KPDA 2AZLA 5C05A 5A0KA 3WCEA 2PS8A 2Z4VA 4JYXA 5CG6A 4KVYA 3ZCDA 5B00A 4E9UA 3LK5A 4GP1A 4LPHF 5EASA 5ILHA 3ICZA 1N1BA 2ZEVA 4MC3A 1WY0A 3V1VA 2Z4XA 4JVJF 4F6XA 4DWGA 3WJKA 5ILZA 3OABB 3S4JA 3TFPA 3CC9A 4KPJA 4QPFA 3WJNA 3LDWA 5IL3A 4JXYA 1V4EA 5ILIA 5DJRF 1V4IA 2VF6A 2ZY1A 1WL1A 3G4DA 3N3LF 4LOBA 3PH7A 3DYHA 5DZ2A 3SDVA 2ZEUA 5ER8A 3PYBA 2FORA 5KSXF 3NRIA 4KQSA 1WL2A 5ILKA 1HM4A 4LZCA 5IKAA 1N22A 3WCCA 4LFGA 2E8XA 2H8OA 2Z7HA 4OMGA 3N45F 3QKCA 2RAHA 3G4FA 4JZXA 3KBKA 4NFJF 4XQRF 3BNYA 3SDUA 2Z4ZA 4JXNA 5I1UA 3APZA 5AHUB 2I19A 2O1OA 4LLTA 2J5CA 3RMGA 2FTZA 5AYPA 3M02A 3P8LA 4QXSF 5DGNF 5IK0A 3WSAA 1HM7A 3V1XA 4XQSF 2AEKA 4P0WA 1YQ7A 4LFEA 1JFAA 5DHKA 4DXJA 2E8TA 3KB9A 1V4KA 5IK9A 4DHDA 5ILJA 3P41A 3OACB 4NKFA 3ACYA 5B0KA 3S9VA 3WCIA 1DI1A 4RXDA 2P1CA 2Q9YA 5ILYA 4DEMF 3N3DA 3ID0A 3ZOUA 1WL3A 3MZVA 5IVGA 4KUXA 4GA3A 4NFIF 4H5EF 2Q80A 3PDEA 5DGSF 5ILDA 3KRAA 3LG5A 4HD1A 3KRCB 3WCLA 3VJEA 4LZ0A 2AZKA 5DGMF 4KWDA 1YHLA 4MC8A 3WC9A 3W7FA 5H9DA 3EZ3A 4ZQ8A 5IMIA 5CG5A 3MAVA 1FPSA 5E8LA 5IK6A 1RTRA 3NPRA 2E93A 2QISA 5DW7A 2F94F 3OACA 3NF2A 3PYAA 4H5DF 2OPNA 4LXWA 4WK5A 4LA6A 3QQVA 2Q9ZA 2ZCRA 4LLSA 3Q2QA 4OMHA 4RYPA 3VJ8A 5JV0F 4KQUA 2Z78A 5IL8A 4UMJA 3Q30A 3CP6A 4L2XF 1YV5A 3WCMA 1YHMA 5B03A 3ICKA 4NUAA 2AELA 3DYFA 5DJPF 5IN8A 1YYQA 3KROB 1HXGA 3KRFB 2Z4WA 4RXEA 3EFQA 3WCGA 3V66A 3KRCA 3WCAA 2OA6A 4P0XA 3SDRA 4EA0A 5A0JA 1VG3A 5DJVF 4NKEA 3B7LA 3ADZA 4F62A 3OABA 3Q1OA 5B0JA 5EATA 1KIYA 5HN9A 5IMPA 1UBWA 1V4HA 1HX9A 1VG4A 4XQTF 1VG7A 4P0VA 5IKHA 2E8WA 3WCHA 3VJBA 1UBVA 3RYEA 3N1VF 1RQJA 3IPIA 3AQCB 5A0IA 3BNXA 2F89F 3SDQA 3OYRA 4PVYF 3AQ0A 2ONHA 3RBMA 4K10A 2ONGA 3WEKA 2AETA 3LJIA 3LVSA 1UBXA 3KROA 2ZCSA 3M00A 3KRFA 2PS4A 5AFXA 2E94A 5IM1A 5JUZF 2Z4YA 3SDTA 4GAXA 2EWGA 3VJAA 4DWBA 1YYTA 3Q2ZA 3WCBA 4OKZA 3RYWA 4F6VA 5DIQF 3M0GA 3TFNA 4N1ZF 3WEGA 4OKMA 3KRPB 4KQ5A 3ZL6A 1UBYA 3TS7A 3LOMA 4E1EA 5JV2F 4KK2A 1YHKA 5B0LA 2E8UA 2Z7IA 3WEFA 3ZMCA 3VJDA 2J1OA 4Q23A 3AQBB 3WCDA 5B01A 5HNAA 3LZ9A 5JV1F 1JFGA 1N24A 4LA5A 4FJQA 3WCFA 5B02A 3M9UA 5EAUA 2Z50A 1WMWA 5E8HA 3N0GA 3P5RA 4EA2A 2F92F 3DYGA 2F7MF 5AELA 2F9KF 2DH4A 4LFVF 2F8ZF 2OPMA 1YYSA 4E9ZA 2E4OA 3N5JF 4LZ3A 4JZBA 3KRPA 3N5HF 3UCAA 2PS6A 5DHIA 5HN8A 4RXAA 3PKOA 3LSNA 3WCJA 3M01A 2PS7A 4FP4A 1PS1A 5HN7A 2F8CF 2Q58A 3ICNA 4N9UA 2E92A 4KVIA 1YJ4A 1V4JA 4DI5A 3ACXA 3WEJA 1VG6A 4EA1A 2PS5A 3VJCA 3N1WF 1RQIA 3WSBA 4LTVA 5E8KA 3ASXA 1KIZA 3WJOA 4H5CF 3LEEA 3N49F 5B0IA 1HXCA 3LGZB 3N46F 3NPKA 1VG2A 3ACWA 1EZFA 5B0MA 4RXCA 1DGPA 1HXAA 2E91A 3SAEA 1N21A 4LPGF 1YYUA 3CKEA 3EGTA 4LUUA 3P5PA 3ICMA 2ZCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZMB A;  5JA0 F;  4NG6 A;  3KRA B;  3IBA A;  3VJ9 A;  4MC0 A;  2Z52 A;  4NFK F;  3LLW A;  1YYR A;  5ERO A;  3LGK A;  3LMD A;  3P8R A;  1N1Z A;  2E95 A;  1WL0 A;  2E90 A;  3N0F A;  4OGU A;  3TC1 A;  1N20 A;  1N23 A;  4GP2 A;  3WE9 A;  3WEI A;  2E8V A;  4KVD A;  3TFV A;  1ZW5 A;  4KVW A;  2AZJ A;  2OGD A;  3WEH A;  4DZW A;  5ERN A;  5IMN A;  3AE0 A;  5ERM A;  2ZCO A;  1WKZ A;  4KKM A;  4LIX A;  4LTZ A;  3N6K F;  4RNQ A;  2J1P A;  4PVX F;  4KFA A;  4KPD A;  2AZL A;  5C05 A;  5A0K A;  3WCE A;  2PS8 A;  2Z4V A;  4JYX A;  5CG6 A;  4KVY A;  3ZCD A;  5B00 A;  4E9U A;  3LK5 A;  4GP1 A;  4LPH F;  5EAS A;  5ILH A;  3ICZ A;  1N1B A;  2ZEV A;  4MC3 A;  1WY0 A;  3V1V A;  2Z4X A;  4JVJ F;  4F6X A;  4DWG A;  3WJK A;  5ILZ A;  3OAB B;  3S4J A;  3TFP A;  3CC9 A;  4KPJ A;  4QPF A;  3WJN A;  3LDW A;  5IL3 A;  4JXY A;  1V4E A;  5ILI A;  5DJR F;  1V4I A;  2VF6 A;  2ZY1 A;  1WL1 A;  3G4D A;  3N3L F;  4LOB A;  3PH7 A;  3DYH A;  5DZ2 A;  3SDV A;  2ZEU A;  5ER8 A;  3PYB A;  2FOR A;  5KSX F;  3NRI A;  4KQS A;  1WL2 A;  5ILK A;  1HM4 A;  4LZC A;  5IKA A;  1N22 A;  3WCC A;  4LFG A;  2E8X A;  2H8O A;  2Z7H A;  4OMG A;  3N45 F;  3QKC A;  2RAH A;  3G4F A;  4JZX A;  3KBK A;  4NFJ F;  4XQR F;  3BNY A;  3SDU A;  2Z4Z A;  4JXN A;  5I1U A;  3APZ A;  5AHU B;  2I19 A;  2O1O A;  4LLT A;  2J5C A;  3RMG A;  2FTZ A;  5AYP A;  3M02 A;  3P8L A;  4QXS F;  5DGN F;  5IK0 A;  3WSA A;  1HM7 A;  3V1X A;  4XQS F;  2AEK A;  4P0W A;  1YQ7 A;  4LFE A;  1JFA A;  5DHK A;  4DXJ A;  2E8T A;  3KB9 A;  1V4K A;  5IK9 A;  4DHD A;  5ILJ A;  3P41 A;  3OAC B;  4NKF A;  3ACY A;  5B0K A;  3S9V A;  3WCI A;  1DI1 A;  4RXD A;  2P1C A;  2Q9Y A;  5ILY A;  4DEM F;  3N3D A;  3ID0 A;  3ZOU A;  1WL3 A;  3MZV A;  5IVG A;  4KUX A;  4GA3 A;  4NFI F;  4H5E F;  2Q80 A;  3PDE A;  5DGS F;  5ILD A;  3KRA A;  3LG5 A;  4HD1 A;  3KRC B;  3WCL A;  3VJE A;  4LZ0 A;  2AZK A;  5DGM F;  4KWD A;  1YHL A;  4MC8 A;  3WC9 A;  3W7F A;  5H9D A;  3EZ3 A;  4ZQ8 A;  5IMI A;  5CG5 A;  3MAV A;  1FPS A;  5E8L A;  5IK6 A;  1RTR A;  3NPR A;  2E93 A;  2QIS A;  5DW7 A;  2F94 F;  3OAC A;  3NF2 A;  3PYA A;  4H5D F;  2OPN A;  4LXW A;  4WK5 A;  4LA6 A;  3QQV A;  2Q9Z A;  2ZCR A;  4LLS A;  3Q2Q A;  4OMH A;  4RYP A;  3VJ8 A;  5JV0 F;  4KQU A;  2Z78 A;  5IL8 A;  4UMJ A;  3Q30 A;  3CP6 A;  4L2X F;  1YV5 A;  3WCM A;  1YHM A;  5B03 A;  3ICK A;  4NUA A;  2AEL A;  3DYF A;  5DJP F;  5IN8 A;  1YYQ A;  3KRO B;  1HXG A;  3KRF B;  2Z4W A;  4RXE A;  3EFQ A;  3WCG A;  3V66 A;  3KRC A;  3WCA A;  2OA6 A;  4P0X A;  3SDR A;  4EA0 A;  5A0J A;  1VG3 A;  5DJV F;  4NKE A;  3B7L A;  3ADZ A;  4F62 A;  3OAB A;  3Q1O A;  5B0J A;  5EAT A;  1KIY A;  5HN9 A;  5IMP A;  1UBW A;  1V4H A;  1HX9 A;  1VG4 A;  4XQT F;  1VG7 A;  4P0V A;  5IKH A;  2E8W A;  3WCH A;  3VJB A;  1UBV A;  3RYE A;  3N1V F;  1RQJ A;  3IPI A;  3AQC B;  5A0I A;  3BNX A;  2F89 F;  3SDQ A;  3OYR A;  4PVY F;  3AQ0 A;  2ONH A;  3RBM A;  4K10 A;  2ONG A;  3WEK A;  2AET A;  3LJI A;  3LVS A;  1UBX A;  3KRO A;  2ZCS A;  3M00 A;  3KRF A;  2PS4 A;  5AFX A;  2E94 A;  5IM1 A;  5JUZ F;  2Z4Y A;  3SDT A;  4GAX A;  2EWG A;  3VJA A;  4DWB A;  1YYT A;  3Q2Z A;  3WCB A;  4OKZ A;  3RYW A;  4F6V A;  5DIQ F;  3M0G A;  3TFN A;  4N1Z F;  3WEG A;  4OKM A;  3KRP B;  4KQ5 A;  3ZL6 A;  1UBY A;  3TS7 A;  3LOM A;  4E1E A;  5JV2 F;  4KK2 A;  1YHK A;  5B0L A;  2E8U A;  2Z7I A;  3WEF A;  3ZMC A;  3VJD A;  2J1O A;  4Q23 A;  3AQB B;  3WCD A;  5B01 A;  5HNA A;  3LZ9 A;  5JV1 F;  1JFG A;  1N24 A;  4LA5 A;  4FJQ A;  3WCF A;  5B02 A;  3M9U A;  5EAU A;  2Z50 A;  1WMW A;  5E8H A;  3N0G A;  3P5R A;  4EA2 A;  2F92 F;  3DYG A;  2F7M F;  5AEL A;  2F9K F;  2DH4 A;  4LFV F;  2F8Z F;  2OPM A;  1YYS A;  4E9Z A;  2E4O A;  3N5J F;  4LZ3 A;  4JZB A;  3KRP A;  3N5H F;  3UCA A;  2PS6 A;  5DHI A;  5HN8 A;  4RXA A;  3PKO A;  3LSN A;  3WCJ A;  3M01 A;  2PS7 A;  4FP4 A;  1PS1 A;  5HN7 A;  2F8C F;  2Q58 A;  3ICN A;  4N9U A;  2E92 A;  4KVI A;  1YJ4 A;  1V4J A;  4DI5 A;  3ACX A;  3WEJ A;  1VG6 A;  4EA1 A;  2PS5 A;  3VJC A;  3N1W F;  1RQI A;  3WSB A;  4LTV A;  5E8K A;  3ASX A;  1KIZ A;  3WJO A;  4H5C F;  3LEE A;  3N49 F;  5B0I A;  1HXC A;  3LGZ B;  3N46 F;  3NPK A;  1VG2 A;  3ACW A;  1EZF A;  5B0M A;  4RXC A;  1DGP A;  1HXA A;  2E91 A;  3SAE A;  1N21 A;  4LPG F;  1YYU A;  3CKE A;  3EGT A;  4LUU A;  3P5P A;  3ICM A;  2ZCQ A; 
#chains in the Genus database with same CATH topology
 3ZMB A;  5JA0 F;  4NG6 A;  3KRA B;  3IBA A;  3VJ9 A;  4MC0 A;  2Z52 A;  4NFK F;  3LLW A;  1YYR A;  5ERO A;  3LGK A;  3LMD A;  3P8R A;  1N1Z A;  2E95 A;  1WL0 A;  2E90 A;  3N0F A;  4OGU A;  3TC1 A;  1N20 A;  1N23 A;  4GP2 A;  3WE9 A;  3WEI A;  2E8V A;  4KVD A;  3TFV A;  1ZW5 A;  4KVW A;  2AZJ A;  2OGD A;  3WEH A;  4DZW A;  5ERN A;  5IMN A;  3AE0 A;  5ERM A;  2ZCO A;  1WKZ A;  4KKM A;  4LIX A;  4LTZ A;  3N6K F;  4RNQ A;  2J1P A;  4PVX F;  4KFA A;  4KPD A;  2AZL A;  5C05 A;  5A0K A;  3WCE A;  2PS8 A;  2Z4V A;  4JYX A;  5CG6 A;  4KVY A;  3ZCD A;  5B00 A;  4E9U A;  3LK5 A;  4GP1 A;  4LPH F;  5EAS A;  5ILH A;  3ICZ A;  1N1B A;  2ZEV A;  4MC3 A;  1WY0 A;  3V1V A;  2Z4X A;  4JVJ F;  4F6X A;  4DWG A;  3WJK A;  5ILZ A;  3OAB B;  3S4J A;  3TFP A;  3CC9 A;  4KPJ A;  4QPF A;  3WJN A;  3LDW A;  5IL3 A;  4JXY A;  1V4E A;  5ILI A;  5DJR F;  1V4I A;  2VF6 A;  2ZY1 A;  1WL1 A;  3G4D A;  3N3L F;  4LOB A;  3PH7 A;  3DYH A;  5DZ2 A;  3SDV A;  2ZEU A;  5ER8 A;  3PYB A;  2FOR A;  5KSX F;  3NRI A;  4KQS A;  1WL2 A;  5ILK A;  1HM4 A;  4LZC A;  5IKA A;  1N22 A;  3WCC A;  4LFG A;  2E8X A;  2H8O A;  2Z7H A;  4OMG A;  3N45 F;  3QKC A;  2RAH A;  3G4F A;  4JZX A;  3KBK A;  4NFJ F;  4XQR F;  3BNY A;  3SDU A;  2Z4Z A;  4JXN A;  5I1U A;  3APZ A;  5AHU B;  2I19 A;  2O1O A;  4LLT A;  2J5C A;  3RMG A;  2FTZ A;  5AYP A;  3M02 A;  3P8L A;  4QXS F;  5DGN F;  5IK0 A;  3WSA A;  1HM7 A;  3V1X A;  4XQS F;  2AEK A;  4P0W A;  1YQ7 A;  4LFE A;  1JFA A;  5DHK A;  4DXJ A;  2E8T A;  3KB9 A;  1V4K A;  5IK9 A;  4DHD A;  5ILJ A;  3P41 A;  3OAC B;  4NKF A;  3ACY A;  5B0K A;  3S9V A;  3WCI A;  1DI1 A;  4RXD A;  2P1C A;  2Q9Y A;  5ILY A;  4DEM F;  3N3D A;  3ID0 A;  3ZOU A;  1WL3 A;  3MZV A;  5IVG A;  4KUX A;  4GA3 A;  4NFI F;  4H5E F;  2Q80 A;  3PDE A;  5DGS F;  5ILD A;  3KRA A;  3LG5 A;  4HD1 A;  3KRC B;  3WCL A;  3VJE A;  4LZ0 A;  2AZK A;  5DGM F;  4KWD A;  1YHL A;  4MC8 A;  3WC9 A;  3W7F A;  5H9D A;  3EZ3 A;  4ZQ8 A;  5IMI A;  5CG5 A;  3MAV A;  1FPS A;  5E8L A;  5IK6 A;  1RTR A;  3NPR A;  2E93 A;  2QIS A;  5DW7 A;  2F94 F;  3OAC A;  3NF2 A;  3PYA A;  4H5D F;  2OPN A;  4LXW A;  4WK5 A;  4LA6 A;  3QQV A;  2Q9Z A;  2ZCR A;  4LLS A;  3Q2Q A;  4OMH A;  4RYP A;  3VJ8 A;  5JV0 F;  4KQU A;  2Z78 A;  5IL8 A;  4UMJ A;  3Q30 A;  3CP6 A;  4L2X F;  1YV5 A;  3WCM A;  1YHM A;  5B03 A;  3ICK A;  4NUA A;  2AEL A;  3DYF A;  5DJP F;  5IN8 A;  1YYQ A;  3KRO B;  1HXG A;  3KRF B;  2Z4W A;  4RXE A;  3EFQ A;  3WCG A;  3V66 A;  3KRC A;  3WCA A;  2OA6 A;  4P0X A;  3SDR A;  4EA0 A;  5A0J A;  1VG3 A;  5DJV F;  4NKE A;  3B7L A;  3ADZ A;  4F62 A;  3OAB A;  3Q1O A;  5B0J A;  5EAT A;  1KIY A;  5HN9 A;  5IMP A;  1UBW A;  1V4H A;  1HX9 A;  1VG4 A;  4XQT F;  1VG7 A;  4P0V A;  5IKH A;  2E8W A;  3WCH A;  3VJB A;  1UBV A;  3RYE A;  3N1V F;  1RQJ A;  3IPI A;  3AQC B;  5A0I A;  3BNX A;  2F89 F;  3SDQ A;  3OYR A;  4PVY F;  3AQ0 A;  2ONH A;  3RBM A;  4K10 A;  2ONG A;  3WEK A;  2AET A;  3LJI A;  3LVS A;  1UBX A;  3KRO A;  2ZCS A;  3M00 A;  3KRF A;  2PS4 A;  5AFX A;  2E94 A;  5IM1 A;  5JUZ F;  2Z4Y A;  3SDT A;  4GAX A;  2EWG A;  3VJA A;  4DWB A;  1YYT A;  3Q2Z A;  3WCB A;  4OKZ A;  3RYW A;  4F6V A;  5DIQ F;  3M0G A;  3TFN A;  4N1Z F;  3WEG A;  4OKM A;  3KRP B;  4KQ5 A;  3ZL6 A;  1UBY A;  3TS7 A;  3LOM A;  4E1E A;  5JV2 F;  4KK2 A;  1YHK A;  5B0L A;  2E8U A;  2Z7I A;  3WEF A;  3ZMC A;  3VJD A;  2J1O A;  4Q23 A;  3AQB B;  3WCD A;  5B01 A;  5HNA A;  3LZ9 A;  5JV1 F;  1JFG A;  1N24 A;  4LA5 A;  4FJQ A;  3WCF A;  5B02 A;  3M9U A;  5EAU A;  2Z50 A;  1WMW A;  5E8H A;  3N0G A;  3P5R A;  4EA2 A;  2F92 F;  3DYG A;  2F7M F;  5AEL A;  2F9K F;  2DH4 A;  4LFV F;  2F8Z F;  2OPM A;  1YYS A;  4E9Z A;  2E4O A;  3N5J F;  4LZ3 A;  4JZB A;  3KRP A;  3N5H F;  3UCA A;  2PS6 A;  5DHI A;  5HN8 A;  4RXA A;  3PKO A;  3LSN A;  3WCJ A;  3M01 A;  2PS7 A;  4FP4 A;  1PS1 A;  5HN7 A;  2F8C F;  2Q58 A;  3ICN A;  4N9U A;  2E92 A;  4KVI A;  1YJ4 A;  1V4J A;  4DI5 A;  3ACX A;  3WEJ A;  1VG6 A;  4EA1 A;  2PS5 A;  3VJC A;  3N1W F;  1RQI A;  3WSB A;  4LTV A;  5E8K A;  3ASX A;  1KIZ A;  3WJO A;  4H5C F;  3LEE A;  3N49 F;  5B0I A;  1HXC A;  3LGZ B;  3N46 F;  3NPK A;  1VG2 A;  3ACW A;  1EZF A;  5B0M A;  4RXC A;  1DGP A;  1HXA A;  2E91 A;  3SAE A;  1N21 A;  4LPG F;  1YYU A;  3CKE A;  3EGT A;  4LUU A;  3P5P A;  3ICM A;  2ZCQ A; 
#chains in the Genus database with same CATH homology
 3ZMB A;  5JA0 F;  4NG6 A;  3KRA B;  3IBA A;  3VJ9 A;  4MC0 A;  2Z52 A;  4NFK F;  3LLW A;  1YYR A;  5ERO A;  3LGK A;  3LMD A;  3P8R A;  1N1Z A;  2E95 A;  1WL0 A;  2E90 A;  3N0F A;  4OGU A;  3TC1 A;  1N20 A;  1N23 A;  4GP2 A;  3WE9 A;  3WEI A;  2E8V A;  4KVD A;  3TFV A;  1ZW5 A;  4KVW A;  2AZJ A;  2OGD A;  3WEH A;  4DZW A;  5ERN A;  5IMN A;  3AE0 A;  5ERM A;  2ZCO A;  1WKZ A;  4KKM A;  4LIX A;  4LTZ A;  3N6K F;  4RNQ A;  2J1P A;  4PVX F;  4KFA A;  4KPD A;  2AZL A;  5C05 A;  5A0K A;  3WCE A;  2PS8 A;  2Z4V A;  4JYX A;  5CG6 A;  4KVY A;  3ZCD A;  5B00 A;  4E9U A;  3LK5 A;  4GP1 A;  4LPH F;  5EAS A;  5ILH A;  3ICZ A;  1N1B A;  2ZEV A;  4MC3 A;  1WY0 A;  3V1V A;  2Z4X A;  4JVJ F;  4F6X A;  4DWG A;  3WJK A;  5ILZ A;  3OAB B;  3S4J A;  3TFP A;  3CC9 A;  4KPJ A;  4QPF A;  3WJN A;  3LDW A;  5IL3 A;  4JXY A;  1V4E A;  5ILI A;  5DJR F;  1V4I A;  2VF6 A;  2ZY1 A;  1WL1 A;  3G4D A;  3N3L F;  4LOB A;  3PH7 A;  3DYH A;  5DZ2 A;  3SDV A;  2ZEU A;  5ER8 A;  3PYB A;  2FOR A;  5KSX F;  3NRI A;  4KQS A;  1WL2 A;  5ILK A;  1HM4 A;  4LZC A;  5IKA A;  1N22 A;  3WCC A;  4LFG A;  2E8X A;  2H8O A;  2Z7H A;  4OMG A;  3N45 F;  3QKC A;  2RAH A;  3G4F A;  4JZX A;  3KBK A;  4NFJ F;  4XQR F;  3BNY A;  3SDU A;  2Z4Z A;  4JXN A;  5I1U A;  3APZ A;  5AHU B;  2I19 A;  2O1O A;  4LLT A;  2J5C A;  3RMG A;  2FTZ A;  5AYP A;  3M02 A;  3P8L A;  4QXS F;  5DGN F;  5IK0 A;  3WSA A;  1HM7 A;  3V1X A;  4XQS F;  2AEK A;  4P0W A;  1YQ7 A;  4LFE A;  1JFA A;  5DHK A;  4DXJ A;  2E8T A;  3KB9 A;  1V4K A;  5IK9 A;  4DHD A;  5ILJ A;  3P41 A;  3OAC B;  4NKF A;  3ACY A;  5B0K A;  3S9V A;  3WCI A;  1DI1 A;  4RXD A;  2P1C A;  2Q9Y A;  5ILY A;  4DEM F;  3N3D A;  3ID0 A;  3ZOU A;  1WL3 A;  3MZV A;  5IVG A;  4KUX A;  4GA3 A;  4NFI F;  4H5E F;  2Q80 A;  3PDE A;  5DGS F;  5ILD A;  3KRA A;  3LG5 A;  4HD1 A;  3KRC B;  3WCL A;  3VJE A;  4LZ0 A;  2AZK A;  5DGM F;  4KWD A;  1YHL A;  4MC8 A;  3WC9 A;  3W7F A;  5H9D A;  3EZ3 A;  4ZQ8 A;  5IMI A;  5CG5 A;  3MAV A;  1FPS A;  5E8L A;  5IK6 A;  1RTR A;  3NPR A;  2E93 A;  2QIS A;  5DW7 A;  2F94 F;  3OAC A;  3NF2 A;  3PYA A;  4H5D F;  2OPN A;  4LXW A;  4WK5 A;  4LA6 A;  3QQV A;  2Q9Z A;  2ZCR A;  4LLS A;  3Q2Q A;  4OMH A;  4RYP A;  3VJ8 A;  5JV0 F;  4KQU A;  2Z78 A;  5IL8 A;  4UMJ A;  3Q30 A;  3CP6 A;  4L2X F;  1YV5 A;  3WCM A;  1YHM A;  5B03 A;  3ICK A;  4NUA A;  2AEL A;  3DYF A;  5DJP F;  5IN8 A;  1YYQ A;  3KRO B;  1HXG A;  3KRF B;  2Z4W A;  4RXE A;  3EFQ A;  3WCG A;  3V66 A;  3KRC A;  3WCA A;  2OA6 A;  4P0X A;  3SDR A;  4EA0 A;  5A0J A;  1VG3 A;  5DJV F;  4NKE A;  3B7L A;  3ADZ A;  4F62 A;  3OAB A;  3Q1O A;  5B0J A;  5EAT A;  1KIY A;  5HN9 A;  5IMP A;  1UBW A;  1V4H A;  1HX9 A;  1VG4 A;  4XQT F;  1VG7 A;  4P0V A;  5IKH A;  2E8W A;  3WCH A;  3VJB A;  1UBV A;  3RYE A;  3N1V F;  1RQJ A;  3IPI A;  3AQC B;  5A0I A;  3BNX A;  2F89 F;  3SDQ A;  3OYR A;  4PVY F;  3AQ0 A;  2ONH A;  3RBM A;  4K10 A;  2ONG A;  3WEK A;  2AET A;  3LJI A;  3LVS A;  1UBX A;  3KRO A;  2ZCS A;  3M00 A;  3KRF A;  2PS4 A;  5AFX A;  2E94 A;  5IM1 A;  5JUZ F;  2Z4Y A;  3SDT A;  4GAX A;  2EWG A;  3VJA A;  4DWB A;  1YYT A;  3Q2Z A;  3WCB A;  4OKZ A;  3RYW A;  4F6V A;  5DIQ F;  3M0G A;  3TFN A;  4N1Z F;  3WEG A;  4OKM A;  3KRP B;  4KQ5 A;  3ZL6 A;  1UBY A;  3TS7 A;  3LOM A;  4E1E A;  5JV2 F;  4KK2 A;  1YHK A;  5B0L A;  2E8U A;  2Z7I A;  3WEF A;  3ZMC A;  3VJD A;  2J1O A;  4Q23 A;  3AQB B;  3WCD A;  5B01 A;  5HNA A;  3LZ9 A;  5JV1 F;  1JFG A;  1N24 A;  4LA5 A;  4FJQ A;  3WCF A;  5B02 A;  3M9U A;  5EAU A;  2Z50 A;  1WMW A;  5E8H A;  3N0G A;  3P5R A;  4EA2 A;  2F92 F;  3DYG A;  2F7M F;  5AEL A;  2F9K F;  2DH4 A;  4LFV F;  2F8Z F;  2OPM A;  1YYS A;  4E9Z A;  2E4O A;  3N5J F;  4LZ3 A;  4JZB A;  3KRP A;  3N5H F;  3UCA A;  2PS6 A;  5DHI A;  5HN8 A;  4RXA A;  3PKO A;  3LSN A;  3WCJ A;  3M01 A;  2PS7 A;  4FP4 A;  1PS1 A;  5HN7 A;  2F8C F;  2Q58 A;  3ICN A;  4N9U A;  2E92 A;  4KVI A;  1YJ4 A;  1V4J A;  4DI5 A;  3ACX A;  3WEJ A;  1VG6 A;  4EA1 A;  2PS5 A;  3VJC A;  3N1W F;  1RQI A;  3WSB A;  4LTV A;  5E8K A;  3ASX A;  1KIZ A;  3WJO A;  4H5C F;  3LEE A;  3N49 F;  5B0I A;  1HXC A;  3LGZ B;  3N46 F;  3NPK A;  1VG2 A;  3ACW A;  1EZF A;  5B0M A;  4RXC A;  1DGP A;  1HXA A;  2E91 A;  3SAE A;  1N21 A;  4LPG F;  1YYU A;  3CKE A;  3EGT A;  4LUU A;  3P5P A;  3ICM A;  2ZCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...