3KROB

Mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, ipp, and dmaspp (ii)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
259
structure length
259
Chain Sequence
MQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLTDGSRPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALEELGGFHGKNAELMSSLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranyl diphosphate synthase large subunit
publication title Structure of a heterotetrameric geranyl pyrophosphate synthase from mint (Mentha piperita) reveals intersubunit regulation
pubmed doi rcsb
source organism Mentha x piperita
molecule tags Transferase
total genus 94
structure length 259
sequence length 259
chains with identical sequence C
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2009-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3kroB00
3LOMA 1YHKA 3MAVA 3WCBA 2Z4ZA 5IK6A 4GA3A 3WE9A 4XQRF 1UBXA 4N1ZF 1YHLA 3WC9A 2FORA 4WK5A 2ZEUA 3ZOUA 3SDVA 1VG2A 4KVYA 3PDEA 4KVIA 5E8HA 3M0GA 5ILIA 5B01A 1YHMA 5B0JA 5I1UA 3CKEA 3WCHA 5AHUB 5ILYA 4H5EF 4DXJA 4LIXA 3SDQA 5ILKA 4LA6A 1N23A 4KPJA 3N3LF 1HX9A 5ILZA 5HN9A 3WCIA 3KRCA 3TFPA 3VJ8A 3Q2ZA 2Z78A 3M02A 3WCEA 4KVWA 1HM7A 2J1OA 4RXDA 3APZA 2Q80A 3KROB 3N1VF 5ERMA 3P5RA 3N0FA 4E1EA 3N45F 3KBKA 1N21A 4KUXA 1RTRA 3M01A 3PYAA 2E90A 5ILHA 4NKFA 4E9ZA 3LZ9A 1V4IA 3WJOA 4OGUA 3N0GA 3OABA 5AYPA 5B00A 2PS8A 4P0XA 2AZLA 2PS6A 4LA5A 3ICNA 2ONGA 4KK2A 5DHIA 2I19A 1V4EA 3WEIA 3EZ3A 3N5JF 3WEFA 3KB9A 3OYRA 4LUUA 3RMGA 2Q58A 4JZXA 4RXCA 1VG7A 3KRAA 4OMHA 3V66A 5CG6A 1HXCA 3TFVA 3ICZA 5A0IA 1WL0A 3BNYA 1RQJA 3LSNA 3W7FA 5IN8A 3G4DA 3NPKA 4JXYA 4UMJA 4LLSA 4JZBA 3KRCB 1UBVA 3ZMBA 3PYBA 1HXAA 3KRFA 5A0KA 4EA1A 1V4KA 3SDTA 5IMNA 5EAUA 3BNXA 5HN8A 1JFAA 3AE0A 1YYSA 3ID0A 3VJEA 4MC3A 4JVJF 3ZMCA 3WEGA 3LDWA 3LVSA 3PH7A 5E8LA 4LOBA 4Q23A 2AEKA 1ZW5A 4E9UA 3WCGA 2F9KF 4NFIF 1VG3A 4JXNA 5IKAA 4DZWA 3RYWA 2Z4XA 4KQ5A 4LZ0A 3N6KF 3LMDA 3PKOA 5IVGA 1UBYA 1YQ7A 4JYXA 3P8RA 2H8OA 2EWGA 5DHKA 3DYGA 5IKHA 5DJRF 3WEJA 4LLTA 4NKEA 5EROA 5DGSF 2ZEVA 3QQVA 3ADZA 3OACA 3VJCA 2RAHA 5IMPA 3LLWA 2E93A 1VG6A 2E8UA 1WL2A 1WY0A 3WSAA 5JV0F 3S4JA 4LFGA 1FPSA 4DHDA 2PS5A 3S9VA 3DYFA 2ONHA 4OKMA 5IL3A 4NFKF 3VJDA 3Q30A 2E94A 5ERNA 3WJKA 5KSXF 3ZCDA 3V1VA 3N46F 2Q9ZA 5A0JA 1KIZA 3P8LA 5H9DA 4N9UA 4KQUA 4KVDA 2Z4WA 4K10A 4LXWA 4RXAA 2OPMA 2ZCSA 4P0VA 3NF2A 1VG4A 2DH4A 4EA2A 3EGTA 5AELA 5B03A 5ER8A 3VJ9A 4NFJF 2E8WA 5B0IA 5HNAA 2OPNA 4MC8A 1RQIA 3EFQA 4GP1A 3MZVA 3CP6A 3WEHA 2E4OA 5ILJA 4KQSA 3Q1OA 4DEMF 3IBAA 5DZ2A 1N1BA 4LPHF 2E92A 5JUZF 3NRIA 1HM4A 1N24A 5IK0A 3SDRA 4QXSF 4LTZA 2F92F 4KFAA 5JV1F 2FTZA 3UCAA 4L2XF 2OA6A 4RYPA 2AETA 3LG5A 4MC0A 1YYUA 3VJBA 1YYTA 5B02A 3VJAA 2Q9YA 3G4FA 3SAEA 3OABB 5DGMF 5B0KA 4F6VA 2Z7IA 4LPGF 3KROA 5JV2F 3DYHA 3WEKA 2E95A 2AELA 5EATA 2ZCQA 3ACWA 4NG6A 4PVYF 4KWDA 5IM1A 1N20A 1YYQA 4EA0A 2E8VA 3SDUA 1DGPA 3KRAB 3AQCB 1N22A 1YJ4A 3WSBA 2PS4A 2E8TA 3Q2QA 3KRPA 4LFEA 2QISA 2F7MF 5IK9A 3P41A 3N5HF 3TC1A 1YYRA 4XQSF 4H5DF 1WKZA 5HN7A 3KRFB 2F8CF 4FJQA 4H5CF 4ZQ8A 2VF6A 3ASXA 3IPIA 2O1OA 4LZ3A 2F89F 3CC9A 4KKMA 2ZY1A 3NPRA 4GP2A 3V1XA 1N1ZA 3ACYA 5IL8A 1EZFA 5IMIA 3AQBB 3LGZB 5ILDA 3N1WF 2E8XA 3WJNA 5AFXA 2Z52A 3RYEA 3N49F 4GAXA 4XQTF 4LTVA 4F62A 2Z50A 5DIQF 5JA0F 3TFNA 1WL1A 2AZJA 2J5CA 1DI1A 5DJPF 3RBMA 4FP4A 3ICKA 5B0MA 3B7LA 3P5PA 4DI5A 2J1PA 4NUAA 2PS7A 4RXEA 3OACB 3TS7A 5E8KA 3KRPB 5CG5A 4KPDA 5C05A 3QKCA 4OMGA 1JFGA 2F94F 3WCDA 3WCMA 3LEEA 2E91A 3ACXA 4QPFA 3LK5A 3WCLA 1PS1A 1HXGA 3M9UA 1YV5A 2ZCRA 5DGNF 3ZL6A 4LZCA 2Z7HA 4LFVF 4DWBA 4PVXF 4RNQA 2AZKA 2P1CA 1KIYA 1WMWA 2Z4VA 5EASA 5B0LA 2ZCOA 3ICMA 3WCJA 3WCAA 5DW7A 1UBWA 3LGKA 3WCCA 3LJIA 2OGDA 3M00A 1V4JA 1V4HA 1WL3A 3AQ0A 4F6XA 4HD1A 5DJVF 4OKZA 4P0WA 2Z4YA 3N3DA 4DWGA 2F8ZF 3WCFA
chains in the Genus database with same CATH superfamily
3LOMA 1YHKA 3MAVA 3WCBA 2Z4ZA 5IK6A 4GA3A 3WE9A 4XQRF 1UBXA 4N1ZF 1YHLA 3WC9A 2FORA 4WK5A 2ZEUA 3ZOUA 3SDVA 1VG2A 4KVYA 3PDEA 4KVIA 5E8HA 3M0GA 5ILIA 5B01A 1YHMA 5B0JA 5I1UA 3CKEA 3WCHA 5AHUB 5ILYA 4H5EF 4DXJA 4LIXA 3SDQA 5ILKA 4LA6A 1N23A 4KPJA 3N3LF 1HX9A 5ILZA 5HN9A 3WCIA 3KRCA 3TFPA 3VJ8A 3Q2ZA 2Z78A 3M02A 3WCEA 4KVWA 1HM7A 2J1OA 4RXDA 3APZA 2Q80A 3KROB 3N1VF 5ERMA 3P5RA 3N0FA 4E1EA 3N45F 3KBKA 1N21A 4KUXA 1RTRA 3M01A 3PYAA 2E90A 5ILHA 4NKFA 4E9ZA 3LZ9A 1V4IA 3WJOA 4OGUA 3N0GA 3OABA 5AYPA 5B00A 2PS8A 4P0XA 2AZLA 2PS6A 4LA5A 3ICNA 2ONGA 4KK2A 5DHIA 2I19A 1V4EA 3WEIA 3EZ3A 3N5JF 3WEFA 3KB9A 3OYRA 4LUUA 3RMGA 2Q58A 4JZXA 4RXCA 1VG7A 3KRAA 4OMHA 3V66A 5CG6A 1HXCA 3TFVA 3ICZA 5A0IA 1WL0A 3BNYA 1RQJA 3LSNA 3W7FA 5IN8A 3G4DA 3NPKA 4JXYA 4UMJA 4LLSA 4JZBA 3KRCB 1UBVA 3ZMBA 3PYBA 1HXAA 3KRFA 5A0KA 4EA1A 1V4KA 3SDTA 5IMNA 5EAUA 3BNXA 5HN8A 1JFAA 3AE0A 1YYSA 3ID0A 3VJEA 4MC3A 4JVJF 3ZMCA 3WEGA 3LDWA 3LVSA 3PH7A 5E8LA 4LOBA 4Q23A 2AEKA 1ZW5A 4E9UA 3WCGA 2F9KF 4NFIF 1VG3A 4JXNA 5IKAA 4DZWA 3RYWA 2Z4XA 4KQ5A 4LZ0A 3N6KF 3LMDA 3PKOA 5IVGA 1UBYA 1YQ7A 4JYXA 3P8RA 2H8OA 2EWGA 5DHKA 3DYGA 5IKHA 5DJRF 3WEJA 4LLTA 4NKEA 5EROA 5DGSF 2ZEVA 3QQVA 3ADZA 3OACA 3VJCA 2RAHA 5IMPA 3LLWA 2E93A 1VG6A 2E8UA 1WL2A 1WY0A 3WSAA 5JV0F 3S4JA 4LFGA 1FPSA 4DHDA 2PS5A 3S9VA 3DYFA 2ONHA 4OKMA 5IL3A 4NFKF 3VJDA 3Q30A 2E94A 5ERNA 3WJKA 5KSXF 3ZCDA 3V1VA 3N46F 2Q9ZA 5A0JA 1KIZA 3P8LA 5H9DA 4N9UA 4KQUA 4KVDA 2Z4WA 4K10A 4LXWA 4RXAA 2OPMA 2ZCSA 4P0VA 3NF2A 1VG4A 2DH4A 4EA2A 3EGTA 5AELA 5B03A 5ER8A 3VJ9A 4NFJF 2E8WA 5B0IA 5HNAA 2OPNA 4MC8A 1RQIA 3EFQA 4GP1A 3MZVA 3CP6A 3WEHA 2E4OA 5ILJA 4KQSA 3Q1OA 4DEMF 3IBAA 5DZ2A 1N1BA 4LPHF 2E92A 5JUZF 3NRIA 1HM4A 1N24A 5IK0A 3SDRA 4QXSF 4LTZA 2F92F 4KFAA 5JV1F 2FTZA 3UCAA 4L2XF 2OA6A 4RYPA 2AETA 3LG5A 4MC0A 1YYUA 3VJBA 1YYTA 5B02A 3VJAA 2Q9YA 3G4FA 3SAEA 3OABB 5DGMF 5B0KA 4F6VA 2Z7IA 4LPGF 3KROA 5JV2F 3DYHA 3WEKA 2E95A 2AELA 5EATA 2ZCQA 3ACWA 4NG6A 4PVYF 4KWDA 5IM1A 1N20A 1YYQA 4EA0A 2E8VA 3SDUA 1DGPA 3KRAB 3AQCB 1N22A 1YJ4A 3WSBA 2PS4A 2E8TA 3Q2QA 3KRPA 4LFEA 2QISA 2F7MF 5IK9A 3P41A 3N5HF 3TC1A 1YYRA 4XQSF 4H5DF 1WKZA 5HN7A 3KRFB 2F8CF 4FJQA 4H5CF 4ZQ8A 2VF6A 3ASXA 3IPIA 2O1OA 4LZ3A 2F89F 3CC9A 4KKMA 2ZY1A 3NPRA 4GP2A 3V1XA 1N1ZA 3ACYA 5IL8A 1EZFA 5IMIA 3AQBB 3LGZB 5ILDA 3N1WF 2E8XA 3WJNA 5AFXA 2Z52A 3RYEA 3N49F 4GAXA 4XQTF 4LTVA 4F62A 2Z50A 5DIQF 5JA0F 3TFNA 1WL1A 2AZJA 2J5CA 1DI1A 5DJPF 3RBMA 4FP4A 3ICKA 5B0MA 3B7LA 3P5PA 4DI5A 2J1PA 4NUAA 2PS7A 4RXEA 3OACB 3TS7A 5E8KA 3KRPB 5CG5A 4KPDA 5C05A 3QKCA 4OMGA 1JFGA 2F94F 3WCDA 3WCMA 3LEEA 2E91A 3ACXA 4QPFA 3LK5A 3WCLA 1PS1A 1HXGA 3M9UA 1YV5A 2ZCRA 5DGNF 3ZL6A 4LZCA 2Z7HA 4LFVF 4DWBA 4PVXF 4RNQA 2AZKA 2P1CA 1KIYA 1WMWA 2Z4VA 5EASA 5B0LA 2ZCOA 3ICMA 3WCJA 3WCAA 5DW7A 1UBWA 3LGKA 3WCCA 3LJIA 2OGDA 3M00A 1V4JA 1V4HA 1WL3A 3AQ0A 4F6XA 4HD1A 5DJVF 4OKZA 4P0WA 2Z4YA 3N3DA 4DWGA 2F8ZF 3WCFA
chains in the Genus database with same CATH topology
3LOMA 1YHKA 3MAVA 3WCBA 2Z4ZA 5IK6A 4GA3A 3WE9A 4XQRF 1UBXA 4N1ZF 1YHLA 3WC9A 2FORA 4WK5A 2ZEUA 3ZOUA 3SDVA 1VG2A 4KVYA 3PDEA 4KVIA 5E8HA 3M0GA 5ILIA 5B01A 1YHMA 5B0JA 5I1UA 3CKEA 3WCHA 5AHUB 5ILYA 4H5EF 4DXJA 4LIXA 3SDQA 5ILKA 4LA6A 1N23A 4KPJA 3N3LF 1HX9A 5ILZA 5HN9A 3WCIA 3KRCA 3TFPA 3VJ8A 3Q2ZA 2Z78A 3M02A 3WCEA 4KVWA 1HM7A 2J1OA 4RXDA 3APZA 2Q80A 3KROB 3N1VF 5ERMA 3P5RA 3N0FA 4E1EA 3N45F 3KBKA 1N21A 4KUXA 1RTRA 3M01A 3PYAA 2E90A 5ILHA 4NKFA 4E9ZA 3LZ9A 1V4IA 3WJOA 4OGUA 3N0GA 3OABA 5AYPA 5B00A 2PS8A 4P0XA 2AZLA 2PS6A 4LA5A 3ICNA 2ONGA 4KK2A 5DHIA 2I19A 1V4EA 3WEIA 3EZ3A 3N5JF 3WEFA 3KB9A 3OYRA 4LUUA 3RMGA 2Q58A 4JZXA 4RXCA 1VG7A 3KRAA 4OMHA 3V66A 5CG6A 1HXCA 3TFVA 3ICZA 5A0IA 1WL0A 3BNYA 1RQJA 3LSNA 3W7FA 5IN8A 3G4DA 3NPKA 4JXYA 4UMJA 4LLSA 4JZBA 3KRCB 1UBVA 3ZMBA 3PYBA 1HXAA 3KRFA 5A0KA 4EA1A 1V4KA 3SDTA 5IMNA 5EAUA 3BNXA 5HN8A 1JFAA 3AE0A 1YYSA 3ID0A 3VJEA 4MC3A 4JVJF 3ZMCA 3WEGA 3LDWA 3LVSA 3PH7A 5E8LA 4LOBA 4Q23A 2AEKA 1ZW5A 4E9UA 3WCGA 2F9KF 4NFIF 1VG3A 4JXNA 5IKAA 4DZWA 3RYWA 2Z4XA 4KQ5A 4LZ0A 3N6KF 3LMDA 3PKOA 5IVGA 1UBYA 1YQ7A 4JYXA 3P8RA 2H8OA 2EWGA 5DHKA 3DYGA 5IKHA 5DJRF 3WEJA 4LLTA 4NKEA 5EROA 5DGSF 2ZEVA 3QQVA 3ADZA 3OACA 3VJCA 2RAHA 5IMPA 3LLWA 2E93A 1VG6A 2E8UA 1WL2A 1WY0A 3WSAA 5JV0F 3S4JA 4LFGA 1FPSA 4DHDA 2PS5A 3S9VA 3DYFA 2ONHA 4OKMA 5IL3A 4NFKF 3VJDA 3Q30A 2E94A 5ERNA 3WJKA 5KSXF 3ZCDA 3V1VA 3N46F 2Q9ZA 5A0JA 1KIZA 3P8LA 5H9DA 4N9UA 4KQUA 4KVDA 2Z4WA 4K10A 4LXWA 4RXAA 2OPMA 2ZCSA 4P0VA 3NF2A 1VG4A 2DH4A 4EA2A 3EGTA 5AELA 5B03A 5ER8A 3VJ9A 4NFJF 2E8WA 5B0IA 5HNAA 2OPNA 4MC8A 1RQIA 3EFQA 4GP1A 3MZVA 3CP6A 3WEHA 2E4OA 5ILJA 4KQSA 3Q1OA 4DEMF 3IBAA 5DZ2A 1N1BA 4LPHF 2E92A 5JUZF 3NRIA 1HM4A 1N24A 5IK0A 3SDRA 4QXSF 4LTZA 2F92F 4KFAA 5JV1F 2FTZA 3UCAA 4L2XF 2OA6A 4RYPA 2AETA 3LG5A 4MC0A 1YYUA 3VJBA 1YYTA 5B02A 3VJAA 2Q9YA 3G4FA 3SAEA 3OABB 5DGMF 5B0KA 4F6VA 2Z7IA 4LPGF 3KROA 5JV2F 3DYHA 3WEKA 2E95A 2AELA 5EATA 2ZCQA 3ACWA 4NG6A 4PVYF 4KWDA 5IM1A 1N20A 1YYQA 4EA0A 2E8VA 3SDUA 1DGPA 3KRAB 3AQCB 1N22A 1YJ4A 3WSBA 2PS4A 2E8TA 3Q2QA 3KRPA 4LFEA 2QISA 2F7MF 5IK9A 3P41A 3N5HF 3TC1A 1YYRA 4XQSF 4H5DF 1WKZA 5HN7A 3KRFB 2F8CF 4FJQA 4H5CF 4ZQ8A 2VF6A 3ASXA 3IPIA 2O1OA 4LZ3A 2F89F 3CC9A 4KKMA 2ZY1A 3NPRA 4GP2A 3V1XA 1N1ZA 3ACYA 5IL8A 1EZFA 5IMIA 3AQBB 3LGZB 5ILDA 3N1WF 2E8XA 3WJNA 5AFXA 2Z52A 3RYEA 3N49F 4GAXA 4XQTF 4LTVA 4F62A 2Z50A 5DIQF 5JA0F 3TFNA 1WL1A 2AZJA 2J5CA 1DI1A 5DJPF 3RBMA 4FP4A 3ICKA 5B0MA 3B7LA 3P5PA 4DI5A 2J1PA 4NUAA 2PS7A 4RXEA 3OACB 3TS7A 5E8KA 3KRPB 5CG5A 4KPDA 5C05A 3QKCA 4OMGA 1JFGA 2F94F 3WCDA 3WCMA 3LEEA 2E91A 3ACXA 4QPFA 3LK5A 3WCLA 1PS1A 1HXGA 3M9UA 1YV5A 2ZCRA 5DGNF 3ZL6A 4LZCA 2Z7HA 4LFVF 4DWBA 4PVXF 4RNQA 2AZKA 2P1CA 1KIYA 1WMWA 2Z4VA 5EASA 5B0LA 2ZCOA 3ICMA 3WCJA 3WCAA 5DW7A 1UBWA 3LGKA 3WCCA 3LJIA 2OGDA 3M00A 1V4JA 1V4HA 1WL3A 3AQ0A 4F6XA 4HD1A 5DJVF 4OKZA 4P0WA 2Z4YA 3N3DA 4DWGA 2F8ZF 3WCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LOM A;  1YHK A;  3MAV A;  3WCB A;  2Z4Z A;  5IK6 A;  4GA3 A;  3WE9 A;  4XQR F;  1UBX A;  4N1Z F;  1YHL A;  3WC9 A;  2FOR A;  4WK5 A;  2ZEU A;  3ZOU A;  3SDV A;  1VG2 A;  4KVY A;  3PDE A;  4KVI A;  5E8H A;  3M0G A;  5ILI A;  5B01 A;  1YHM A;  5B0J A;  5I1U A;  3CKE A;  3WCH A;  5AHU B;  5ILY A;  4H5E F;  4DXJ A;  4LIX A;  3SDQ A;  5ILK A;  4LA6 A;  1N23 A;  4KPJ A;  3N3L F;  1HX9 A;  5ILZ A;  5HN9 A;  3WCI A;  3KRC A;  3TFP A;  3VJ8 A;  3Q2Z A;  2Z78 A;  3M02 A;  3WCE A;  4KVW A;  1HM7 A;  2J1O A;  4RXD A;  3APZ A;  2Q80 A;  3KRO B;  3N1V F;  5ERM A;  3P5R A;  3N0F A;  4E1E A;  3N45 F;  3KBK A;  1N21 A;  4KUX A;  1RTR A;  3M01 A;  3PYA A;  2E90 A;  5ILH A;  4NKF A;  4E9Z A;  3LZ9 A;  1V4I A;  3WJO A;  4OGU A;  3N0G A;  3OAB A;  5AYP A;  5B00 A;  2PS8 A;  4P0X A;  2AZL A;  2PS6 A;  4LA5 A;  3ICN A;  2ONG A;  4KK2 A;  5DHI A;  2I19 A;  1V4E A;  3WEI A;  3EZ3 A;  3N5J F;  3WEF A;  3KB9 A;  3OYR A;  4LUU A;  3RMG A;  2Q58 A;  4JZX A;  4RXC A;  1VG7 A;  3KRA A;  4OMH A;  3V66 A;  5CG6 A;  1HXC A;  3TFV A;  3ICZ A;  5A0I A;  1WL0 A;  3BNY A;  1RQJ A;  3LSN A;  3W7F A;  5IN8 A;  3G4D A;  3NPK A;  4JXY A;  4UMJ A;  4LLS A;  4JZB A;  3KRC B;  1UBV A;  3ZMB A;  3PYB A;  1HXA A;  3KRF A;  5A0K A;  4EA1 A;  1V4K A;  3SDT A;  5IMN A;  5EAU A;  3BNX A;  5HN8 A;  1JFA A;  3AE0 A;  1YYS A;  3ID0 A;  3VJE A;  4MC3 A;  4JVJ F;  3ZMC A;  3WEG A;  3LDW A;  3LVS A;  3PH7 A;  5E8L A;  4LOB A;  4Q23 A;  2AEK A;  1ZW5 A;  4E9U A;  3WCG A;  2F9K F;  4NFI F;  1VG3 A;  4JXN A;  5IKA A;  4DZW A;  3RYW A;  2Z4X A;  4KQ5 A;  4LZ0 A;  3N6K F;  3LMD A;  3PKO A;  5IVG A;  1UBY A;  1YQ7 A;  4JYX A;  3P8R A;  2H8O A;  2EWG A;  5DHK A;  3DYG A;  5IKH A;  5DJR F;  3WEJ A;  4LLT A;  4NKE A;  5ERO A;  5DGS F;  2ZEV A;  3QQV A;  3ADZ A;  3OAC A;  3VJC A;  2RAH A;  5IMP A;  3LLW A;  2E93 A;  1VG6 A;  2E8U A;  1WL2 A;  1WY0 A;  3WSA A;  5JV0 F;  3S4J A;  4LFG A;  1FPS A;  4DHD A;  2PS5 A;  3S9V A;  3DYF A;  2ONH A;  4OKM A;  5IL3 A;  4NFK F;  3VJD A;  3Q30 A;  2E94 A;  5ERN A;  3WJK A;  5KSX F;  3ZCD A;  3V1V A;  3N46 F;  2Q9Z A;  5A0J A;  1KIZ A;  3P8L A;  5H9D A;  4N9U A;  4KQU A;  4KVD A;  2Z4W A;  4K10 A;  4LXW A;  4RXA A;  2OPM A;  2ZCS A;  4P0V A;  3NF2 A;  1VG4 A;  2DH4 A;  4EA2 A;  3EGT A;  5AEL A;  5B03 A;  5ER8 A;  3VJ9 A;  4NFJ F;  2E8W A;  5B0I A;  5HNA A;  2OPN A;  4MC8 A;  1RQI A;  3EFQ A;  4GP1 A;  3MZV A;  3CP6 A;  3WEH A;  2E4O A;  5ILJ A;  4KQS A;  3Q1O A;  4DEM F;  3IBA A;  5DZ2 A;  1N1B A;  4LPH F;  2E92 A;  5JUZ F;  3NRI A;  1HM4 A;  1N24 A;  5IK0 A;  3SDR A;  4QXS F;  4LTZ A;  2F92 F;  4KFA A;  5JV1 F;  2FTZ A;  3UCA A;  4L2X F;  2OA6 A;  4RYP A;  2AET A;  3LG5 A;  4MC0 A;  1YYU A;  3VJB A;  1YYT A;  5B02 A;  3VJA A;  2Q9Y A;  3G4F A;  3SAE A;  3OAB B;  5DGM F;  5B0K A;  4F6V A;  2Z7I A;  4LPG F;  3KRO A;  5JV2 F;  3DYH A;  3WEK A;  2E95 A;  2AEL A;  5EAT A;  2ZCQ A;  3ACW A;  4NG6 A;  4PVY F;  4KWD A;  5IM1 A;  1N20 A;  1YYQ A;  4EA0 A;  2E8V A;  3SDU A;  1DGP A;  3KRA B;  3AQC B;  1N22 A;  1YJ4 A;  3WSB A;  2PS4 A;  2E8T A;  3Q2Q A;  3KRP A;  4LFE A;  2QIS A;  2F7M F;  5IK9 A;  3P41 A;  3N5H F;  3TC1 A;  1YYR A;  4XQS F;  4H5D F;  1WKZ A;  5HN7 A;  3KRF B;  2F8C F;  4FJQ A;  4H5C F;  4ZQ8 A;  2VF6 A;  3ASX A;  3IPI A;  2O1O A;  4LZ3 A;  2F89 F;  3CC9 A;  4KKM A;  2ZY1 A;  3NPR A;  4GP2 A;  3V1X A;  1N1Z A;  3ACY A;  5IL8 A;  1EZF A;  5IMI A;  3AQB B;  3LGZ B;  5ILD A;  3N1W F;  2E8X A;  3WJN A;  5AFX A;  2Z52 A;  3RYE A;  3N49 F;  4GAX A;  4XQT F;  4LTV A;  4F62 A;  2Z50 A;  5DIQ F;  5JA0 F;  3TFN A;  1WL1 A;  2AZJ A;  2J5C A;  1DI1 A;  5DJP F;  3RBM A;  4FP4 A;  3ICK A;  5B0M A;  3B7L A;  3P5P A;  4DI5 A;  2J1P A;  4NUA A;  2PS7 A;  4RXE A;  3OAC B;  3TS7 A;  5E8K A;  3KRP B;  5CG5 A;  4KPD A;  5C05 A;  3QKC A;  4OMG A;  1JFG A;  2F94 F;  3WCD A;  3WCM A;  3LEE A;  2E91 A;  3ACX A;  4QPF A;  3LK5 A;  3WCL A;  1PS1 A;  1HXG A;  3M9U A;  1YV5 A;  2ZCR A;  5DGN F;  3ZL6 A;  4LZC A;  2Z7H A;  4LFV F;  4DWB A;  4PVX F;  4RNQ A;  2AZK A;  2P1C A;  1KIY A;  1WMW A;  2Z4V A;  5EAS A;  5B0L A;  2ZCO A;  3ICM A;  3WCJ A;  3WCA A;  5DW7 A;  1UBW A;  3LGK A;  3WCC A;  3LJI A;  2OGD A;  3M00 A;  1V4J A;  1V4H A;  1WL3 A;  3AQ0 A;  4F6X A;  4HD1 A;  5DJV F;  4OKZ A;  4P0W A;  2Z4Y A;  3N3D A;  4DWG A;  2F8Z F;  3WCF A; 
#chains in the Genus database with same CATH topology
 3LOM A;  1YHK A;  3MAV A;  3WCB A;  2Z4Z A;  5IK6 A;  4GA3 A;  3WE9 A;  4XQR F;  1UBX A;  4N1Z F;  1YHL A;  3WC9 A;  2FOR A;  4WK5 A;  2ZEU A;  3ZOU A;  3SDV A;  1VG2 A;  4KVY A;  3PDE A;  4KVI A;  5E8H A;  3M0G A;  5ILI A;  5B01 A;  1YHM A;  5B0J A;  5I1U A;  3CKE A;  3WCH A;  5AHU B;  5ILY A;  4H5E F;  4DXJ A;  4LIX A;  3SDQ A;  5ILK A;  4LA6 A;  1N23 A;  4KPJ A;  3N3L F;  1HX9 A;  5ILZ A;  5HN9 A;  3WCI A;  3KRC A;  3TFP A;  3VJ8 A;  3Q2Z A;  2Z78 A;  3M02 A;  3WCE A;  4KVW A;  1HM7 A;  2J1O A;  4RXD A;  3APZ A;  2Q80 A;  3KRO B;  3N1V F;  5ERM A;  3P5R A;  3N0F A;  4E1E A;  3N45 F;  3KBK A;  1N21 A;  4KUX A;  1RTR A;  3M01 A;  3PYA A;  2E90 A;  5ILH A;  4NKF A;  4E9Z A;  3LZ9 A;  1V4I A;  3WJO A;  4OGU A;  3N0G A;  3OAB A;  5AYP A;  5B00 A;  2PS8 A;  4P0X A;  2AZL A;  2PS6 A;  4LA5 A;  3ICN A;  2ONG A;  4KK2 A;  5DHI A;  2I19 A;  1V4E A;  3WEI A;  3EZ3 A;  3N5J F;  3WEF A;  3KB9 A;  3OYR A;  4LUU A;  3RMG A;  2Q58 A;  4JZX A;  4RXC A;  1VG7 A;  3KRA A;  4OMH A;  3V66 A;  5CG6 A;  1HXC A;  3TFV A;  3ICZ A;  5A0I A;  1WL0 A;  3BNY A;  1RQJ A;  3LSN A;  3W7F A;  5IN8 A;  3G4D A;  3NPK A;  4JXY A;  4UMJ A;  4LLS A;  4JZB A;  3KRC B;  1UBV A;  3ZMB A;  3PYB A;  1HXA A;  3KRF A;  5A0K A;  4EA1 A;  1V4K A;  3SDT A;  5IMN A;  5EAU A;  3BNX A;  5HN8 A;  1JFA A;  3AE0 A;  1YYS A;  3ID0 A;  3VJE A;  4MC3 A;  4JVJ F;  3ZMC A;  3WEG A;  3LDW A;  3LVS A;  3PH7 A;  5E8L A;  4LOB A;  4Q23 A;  2AEK A;  1ZW5 A;  4E9U A;  3WCG A;  2F9K F;  4NFI F;  1VG3 A;  4JXN A;  5IKA A;  4DZW A;  3RYW A;  2Z4X A;  4KQ5 A;  4LZ0 A;  3N6K F;  3LMD A;  3PKO A;  5IVG A;  1UBY A;  1YQ7 A;  4JYX A;  3P8R A;  2H8O A;  2EWG A;  5DHK A;  3DYG A;  5IKH A;  5DJR F;  3WEJ A;  4LLT A;  4NKE A;  5ERO A;  5DGS F;  2ZEV A;  3QQV A;  3ADZ A;  3OAC A;  3VJC A;  2RAH A;  5IMP A;  3LLW A;  2E93 A;  1VG6 A;  2E8U A;  1WL2 A;  1WY0 A;  3WSA A;  5JV0 F;  3S4J A;  4LFG A;  1FPS A;  4DHD A;  2PS5 A;  3S9V A;  3DYF A;  2ONH A;  4OKM A;  5IL3 A;  4NFK F;  3VJD A;  3Q30 A;  2E94 A;  5ERN A;  3WJK A;  5KSX F;  3ZCD A;  3V1V A;  3N46 F;  2Q9Z A;  5A0J A;  1KIZ A;  3P8L A;  5H9D A;  4N9U A;  4KQU A;  4KVD A;  2Z4W A;  4K10 A;  4LXW A;  4RXA A;  2OPM A;  2ZCS A;  4P0V A;  3NF2 A;  1VG4 A;  2DH4 A;  4EA2 A;  3EGT A;  5AEL A;  5B03 A;  5ER8 A;  3VJ9 A;  4NFJ F;  2E8W A;  5B0I A;  5HNA A;  2OPN A;  4MC8 A;  1RQI A;  3EFQ A;  4GP1 A;  3MZV A;  3CP6 A;  3WEH A;  2E4O A;  5ILJ A;  4KQS A;  3Q1O A;  4DEM F;  3IBA A;  5DZ2 A;  1N1B A;  4LPH F;  2E92 A;  5JUZ F;  3NRI A;  1HM4 A;  1N24 A;  5IK0 A;  3SDR A;  4QXS F;  4LTZ A;  2F92 F;  4KFA A;  5JV1 F;  2FTZ A;  3UCA A;  4L2X F;  2OA6 A;  4RYP A;  2AET A;  3LG5 A;  4MC0 A;  1YYU A;  3VJB A;  1YYT A;  5B02 A;  3VJA A;  2Q9Y A;  3G4F A;  3SAE A;  3OAB B;  5DGM F;  5B0K A;  4F6V A;  2Z7I A;  4LPG F;  3KRO A;  5JV2 F;  3DYH A;  3WEK A;  2E95 A;  2AEL A;  5EAT A;  2ZCQ A;  3ACW A;  4NG6 A;  4PVY F;  4KWD A;  5IM1 A;  1N20 A;  1YYQ A;  4EA0 A;  2E8V A;  3SDU A;  1DGP A;  3KRA B;  3AQC B;  1N22 A;  1YJ4 A;  3WSB A;  2PS4 A;  2E8T A;  3Q2Q A;  3KRP A;  4LFE A;  2QIS A;  2F7M F;  5IK9 A;  3P41 A;  3N5H F;  3TC1 A;  1YYR A;  4XQS F;  4H5D F;  1WKZ A;  5HN7 A;  3KRF B;  2F8C F;  4FJQ A;  4H5C F;  4ZQ8 A;  2VF6 A;  3ASX A;  3IPI A;  2O1O A;  4LZ3 A;  2F89 F;  3CC9 A;  4KKM A;  2ZY1 A;  3NPR A;  4GP2 A;  3V1X A;  1N1Z A;  3ACY A;  5IL8 A;  1EZF A;  5IMI A;  3AQB B;  3LGZ B;  5ILD A;  3N1W F;  2E8X A;  3WJN A;  5AFX A;  2Z52 A;  3RYE A;  3N49 F;  4GAX A;  4XQT F;  4LTV A;  4F62 A;  2Z50 A;  5DIQ F;  5JA0 F;  3TFN A;  1WL1 A;  2AZJ A;  2J5C A;  1DI1 A;  5DJP F;  3RBM A;  4FP4 A;  3ICK A;  5B0M A;  3B7L A;  3P5P A;  4DI5 A;  2J1P A;  4NUA A;  2PS7 A;  4RXE A;  3OAC B;  3TS7 A;  5E8K A;  3KRP B;  5CG5 A;  4KPD A;  5C05 A;  3QKC A;  4OMG A;  1JFG A;  2F94 F;  3WCD A;  3WCM A;  3LEE A;  2E91 A;  3ACX A;  4QPF A;  3LK5 A;  3WCL A;  1PS1 A;  1HXG A;  3M9U A;  1YV5 A;  2ZCR A;  5DGN F;  3ZL6 A;  4LZC A;  2Z7H A;  4LFV F;  4DWB A;  4PVX F;  4RNQ A;  2AZK A;  2P1C A;  1KIY A;  1WMW A;  2Z4V A;  5EAS A;  5B0L A;  2ZCO A;  3ICM A;  3WCJ A;  3WCA A;  5DW7 A;  1UBW A;  3LGK A;  3WCC A;  3LJI A;  2OGD A;  3M00 A;  1V4J A;  1V4H A;  1WL3 A;  3AQ0 A;  4F6X A;  4HD1 A;  5DJV F;  4OKZ A;  4P0W A;  2Z4Y A;  3N3D A;  4DWG A;  2F8Z F;  3WCF A; 
#chains in the Genus database with same CATH homology
 3LOM A;  1YHK A;  3MAV A;  3WCB A;  2Z4Z A;  5IK6 A;  4GA3 A;  3WE9 A;  4XQR F;  1UBX A;  4N1Z F;  1YHL A;  3WC9 A;  2FOR A;  4WK5 A;  2ZEU A;  3ZOU A;  3SDV A;  1VG2 A;  4KVY A;  3PDE A;  4KVI A;  5E8H A;  3M0G A;  5ILI A;  5B01 A;  1YHM A;  5B0J A;  5I1U A;  3CKE A;  3WCH A;  5AHU B;  5ILY A;  4H5E F;  4DXJ A;  4LIX A;  3SDQ A;  5ILK A;  4LA6 A;  1N23 A;  4KPJ A;  3N3L F;  1HX9 A;  5ILZ A;  5HN9 A;  3WCI A;  3KRC A;  3TFP A;  3VJ8 A;  3Q2Z A;  2Z78 A;  3M02 A;  3WCE A;  4KVW A;  1HM7 A;  2J1O A;  4RXD A;  3APZ A;  2Q80 A;  3KRO B;  3N1V F;  5ERM A;  3P5R A;  3N0F A;  4E1E A;  3N45 F;  3KBK A;  1N21 A;  4KUX A;  1RTR A;  3M01 A;  3PYA A;  2E90 A;  5ILH A;  4NKF A;  4E9Z A;  3LZ9 A;  1V4I A;  3WJO A;  4OGU A;  3N0G A;  3OAB A;  5AYP A;  5B00 A;  2PS8 A;  4P0X A;  2AZL A;  2PS6 A;  4LA5 A;  3ICN A;  2ONG A;  4KK2 A;  5DHI A;  2I19 A;  1V4E A;  3WEI A;  3EZ3 A;  3N5J F;  3WEF A;  3KB9 A;  3OYR A;  4LUU A;  3RMG A;  2Q58 A;  4JZX A;  4RXC A;  1VG7 A;  3KRA A;  4OMH A;  3V66 A;  5CG6 A;  1HXC A;  3TFV A;  3ICZ A;  5A0I A;  1WL0 A;  3BNY A;  1RQJ A;  3LSN A;  3W7F A;  5IN8 A;  3G4D A;  3NPK A;  4JXY A;  4UMJ A;  4LLS A;  4JZB A;  3KRC B;  1UBV A;  3ZMB A;  3PYB A;  1HXA A;  3KRF A;  5A0K A;  4EA1 A;  1V4K A;  3SDT A;  5IMN A;  5EAU A;  3BNX A;  5HN8 A;  1JFA A;  3AE0 A;  1YYS A;  3ID0 A;  3VJE A;  4MC3 A;  4JVJ F;  3ZMC A;  3WEG A;  3LDW A;  3LVS A;  3PH7 A;  5E8L A;  4LOB A;  4Q23 A;  2AEK A;  1ZW5 A;  4E9U A;  3WCG A;  2F9K F;  4NFI F;  1VG3 A;  4JXN A;  5IKA A;  4DZW A;  3RYW A;  2Z4X A;  4KQ5 A;  4LZ0 A;  3N6K F;  3LMD A;  3PKO A;  5IVG A;  1UBY A;  1YQ7 A;  4JYX A;  3P8R A;  2H8O A;  2EWG A;  5DHK A;  3DYG A;  5IKH A;  5DJR F;  3WEJ A;  4LLT A;  4NKE A;  5ERO A;  5DGS F;  2ZEV A;  3QQV A;  3ADZ A;  3OAC A;  3VJC A;  2RAH A;  5IMP A;  3LLW A;  2E93 A;  1VG6 A;  2E8U A;  1WL2 A;  1WY0 A;  3WSA A;  5JV0 F;  3S4J A;  4LFG A;  1FPS A;  4DHD A;  2PS5 A;  3S9V A;  3DYF A;  2ONH A;  4OKM A;  5IL3 A;  4NFK F;  3VJD A;  3Q30 A;  2E94 A;  5ERN A;  3WJK A;  5KSX F;  3ZCD A;  3V1V A;  3N46 F;  2Q9Z A;  5A0J A;  1KIZ A;  3P8L A;  5H9D A;  4N9U A;  4KQU A;  4KVD A;  2Z4W A;  4K10 A;  4LXW A;  4RXA A;  2OPM A;  2ZCS A;  4P0V A;  3NF2 A;  1VG4 A;  2DH4 A;  4EA2 A;  3EGT A;  5AEL A;  5B03 A;  5ER8 A;  3VJ9 A;  4NFJ F;  2E8W A;  5B0I A;  5HNA A;  2OPN A;  4MC8 A;  1RQI A;  3EFQ A;  4GP1 A;  3MZV A;  3CP6 A;  3WEH A;  2E4O A;  5ILJ A;  4KQS A;  3Q1O A;  4DEM F;  3IBA A;  5DZ2 A;  1N1B A;  4LPH F;  2E92 A;  5JUZ F;  3NRI A;  1HM4 A;  1N24 A;  5IK0 A;  3SDR A;  4QXS F;  4LTZ A;  2F92 F;  4KFA A;  5JV1 F;  2FTZ A;  3UCA A;  4L2X F;  2OA6 A;  4RYP A;  2AET A;  3LG5 A;  4MC0 A;  1YYU A;  3VJB A;  1YYT A;  5B02 A;  3VJA A;  2Q9Y A;  3G4F A;  3SAE A;  3OAB B;  5DGM F;  5B0K A;  4F6V A;  2Z7I A;  4LPG F;  3KRO A;  5JV2 F;  3DYH A;  3WEK A;  2E95 A;  2AEL A;  5EAT A;  2ZCQ A;  3ACW A;  4NG6 A;  4PVY F;  4KWD A;  5IM1 A;  1N20 A;  1YYQ A;  4EA0 A;  2E8V A;  3SDU A;  1DGP A;  3KRA B;  3AQC B;  1N22 A;  1YJ4 A;  3WSB A;  2PS4 A;  2E8T A;  3Q2Q A;  3KRP A;  4LFE A;  2QIS A;  2F7M F;  5IK9 A;  3P41 A;  3N5H F;  3TC1 A;  1YYR A;  4XQS F;  4H5D F;  1WKZ A;  5HN7 A;  3KRF B;  2F8C F;  4FJQ A;  4H5C F;  4ZQ8 A;  2VF6 A;  3ASX A;  3IPI A;  2O1O A;  4LZ3 A;  2F89 F;  3CC9 A;  4KKM A;  2ZY1 A;  3NPR A;  4GP2 A;  3V1X A;  1N1Z A;  3ACY A;  5IL8 A;  1EZF A;  5IMI A;  3AQB B;  3LGZ B;  5ILD A;  3N1W F;  2E8X A;  3WJN A;  5AFX A;  2Z52 A;  3RYE A;  3N49 F;  4GAX A;  4XQT F;  4LTV A;  4F62 A;  2Z50 A;  5DIQ F;  5JA0 F;  3TFN A;  1WL1 A;  2AZJ A;  2J5C A;  1DI1 A;  5DJP F;  3RBM A;  4FP4 A;  3ICK A;  5B0M A;  3B7L A;  3P5P A;  4DI5 A;  2J1P A;  4NUA A;  2PS7 A;  4RXE A;  3OAC B;  3TS7 A;  5E8K A;  3KRP B;  5CG5 A;  4KPD A;  5C05 A;  3QKC A;  4OMG A;  1JFG A;  2F94 F;  3WCD A;  3WCM A;  3LEE A;  2E91 A;  3ACX A;  4QPF A;  3LK5 A;  3WCL A;  1PS1 A;  1HXG A;  3M9U A;  1YV5 A;  2ZCR A;  5DGN F;  3ZL6 A;  4LZC A;  2Z7H A;  4LFV F;  4DWB A;  4PVX F;  4RNQ A;  2AZK A;  2P1C A;  1KIY A;  1WMW A;  2Z4V A;  5EAS A;  5B0L A;  2ZCO A;  3ICM A;  3WCJ A;  3WCA A;  5DW7 A;  1UBW A;  3LGK A;  3WCC A;  3LJI A;  2OGD A;  3M00 A;  1V4J A;  1V4H A;  1WL3 A;  3AQ0 A;  4F6X A;  4HD1 A;  5DJV F;  4OKZ A;  4P0W A;  2Z4Y A;  3N3D A;  4DWG A;  2F8Z F;  3WCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...