3KROB

Mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, ipp, and dmaspp (ii)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
259
structure length
259
Chain Sequence
MQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLTDGSRPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALEELGGFHGKNAELMSSLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranyl diphosphate synthase large subunit
publication title Structure of a heterotetrameric geranyl pyrophosphate synthase from mint (Mentha piperita) reveals intersubunit regulation
pubmed doi rcsb
source organism Mentha x piperita
molecule tags Transferase
total genus 94
structure length 259
sequence length 259
chains with identical sequence C
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2009-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3kroB00
2AELA 4LXWA 3WEIA 4F6VA 5ILKA 3WCFA 3ACXA 2ZCQA 4JZBA 5EAUA 3WCLA 4DHDA 3Q2QA 3G4DA 3KBKA 4LZ0A 5B0KA 2Q9YA 4NFKF 3WJOA 1ZW5A 2ZEUA 4XQRF 3TFNA 3SDUA 2E4OA 3MAVA 1VG3A 5B01A 3CC9A 3KRFA 2E90A 1UBXA 3KROB 2Z4WA 5DZ2A 4RXDA 2E92A 1UBVA 1WMWA 3VJ8A 3ASXA 3PYAA 2F9KF 3ACWA 4P0XA 5I1UA 3WJNA 1HM4A 1JFAA 5B00A 4LOBA 1KIYA 3W7FA 5E8HA 4LFVF 5JV1F 3P5RA 4GA3A 2F94F 2Z4ZA 3Q30A 3UCAA 5DW7A 3SDQA 2DH4A 3OYRA 2OPMA 3BNYA 4EA2A 4GP1A 5B0IA 1FPSA 4H5DF 4LPHF 2Z4VA 3WCMA 2ZEVA 3CP6A 5ERMA 1YHMA 3ACYA 4RXCA 3ADZA 4NKFA 3WCEA 5DGMF 1HX9A 3TFVA 5ILJA 3ZL6A 3VJ9A 3N5JF 3AE0A 3RMGA 3N0FA 5DHIA 5HN7A 5JA0F 3IPIA 5IVGA 1V4HA 2E8VA 1HXGA 4PVYF 4RXEA 5B03A 3VJEA 3M00A 5DGNF 5EROA 4QXSF 4EA1A 3WEJA 3KRAA 3WCGA 3PDEA 3OABB 4DZWA 1KIZA 2PS5A 1PS1A 2H8OA 4NKEA 1N20A 3WCIA 4LA5A 3M9UA 3DYHA 3ICKA 3P8LA 1WL0A 3N1WF 2EWGA 3NF2A 3WCAA 4XQTF 5AFXA 2E93A 4F62A 1N22A 3SDVA 3WSBA 3B7LA 4OGUA 5DJPF 5HNAA 5IMIA 4MC3A 1WL1A 2J1PA 5ILIA 4GAXA 4KUXA 1UBWA 3N49F 4FJQA 5IK6A 2PS8A 4LIXA 3KRPB 3KB9A 4LUUA 3KRFB 4FP4A 4DXJA 3IBAA 1N21A 1VG4A 3Q1OA 3DYFA 3MZVA 3ICMA 1VG2A 5CG5A 3SAEA 1RTRA 5AELA 4KVWA 1V4KA 4LTZA 3KRPA 2ZCSA 2Z4XA 1EZFA 5ILDA 1N24A 1N23A 4KPJA 3WEFA 3QQVA 2QISA 3WE9A 2J1OA 3ZMCA 3LDWA 4LFEA 4P0WA 4RXAA 3LSNA 4LPGF 2P1CA 3N1VF 4LLSA 4OKZA 5A0IA 5JV0F 4N9UA 5DJVF 3M0GA 2ZY1A 4DWGA 1V4JA 3TS7A 5ERNA 3WJKA 3N3LF 2ZCOA 3G4FA 4H5EF 1YQ7A 3APZA 4E1EA 2I19A 1VG7A 3WSAA 5ILHA 1WKZA 4KWDA 4NFJF 5E8KA 4MC0A 3LJIA 3LGZB 2AETA 4LZCA 5JUZF 3LOMA 3P5PA 3LLWA 3OACB 3KRAB 1V4IA 3M01A 3SDRA 4DWBA 4KKMA 1RQJA 1YYSA 2Z7IA 4KVYA 4P0VA 5IMNA 2PS4A 3OACA 4JXNA 2ONHA 4LTVA 3N45F 3ID0A 5KSXF 3RBMA 2FTZA 1HXAA 3ZOUA 2E94A 3EFQA 3VJBA 1YYQA 3RYWA 3EZ3A 5B0JA 2Z78A 3N46F 3RYEA 3WEGA 4LZ3A 3N0GA 3WEHA 5DIQF 4DI5A 3WCJA 3DYGA 5AYPA 4ZQ8A 5IN8A 3CKEA 2F8CF 5A0KA 5IKAA 3WCHA 2E95A 3AQ0A 1WL3A 3AQBB 3LG5A 3N6KF 3ICZA 2O1OA 1UBYA 4JVJF 4OMGA 1YHKA 3V1XA 3ZMBA 2E8UA 4JZXA 2ONGA 5IL8A 3LMDA 1DGPA 3PKOA 2OGDA 5JV2F 4OMHA 3BNXA 1N1BA 1WY0A 1YYRA 1YYTA 4UMJA 4DEMF 3QKCA 1YV5A 1N1ZA 2E8WA 5DHKA 3PH7A 3ICNA 1YYUA 5ILZA 3S9VA 2OA6A 3WC9A 2F8ZF 3VJDA 5B0LA 3AQCB 2PS7A 2E91A 3P8RA 3NPKA 2AZJA 4L2XF 3Q2ZA 5B0MA 5IKHA 4GP2A 5HN9A 3LZ9A 3NPRA 1RQIA 4KQSA 4LLTA 3LEEA 4F6XA 5IK0A 2ZCRA 3SDTA 3KRCB 4KFAA 5AHUB 5ILYA 4EA0A 4KK2A 4KVIA 5C05A 3S4JA 3NRIA 1YJ4A 5EASA 1HXCA 3N3DA 3ZCDA 3TFPA 4KQ5A 4KVDA 3KROA 3KRCA 4LA6A 2Q80A 2VF6A 5IK9A 3VJCA 5CG6A 3PYBA 3WCDA 4RYPA 2Z52A 4E9ZA 2J5CA 2F92F 3LK5A 5IL3A 4NG6A 2AEKA 2E8XA 2Q58A 4PVXF 4Q23A 3V66A 1VG6A 1YHLA 4WK5A 4XQSF 4N1ZF 4LFGA 2F89F 4NUAA 1JFGA 5B02A 4MC8A 4RNQA 5ER8A 4KQUA 3WCCA 2FORA 5HN8A 2Z7HA 5EATA 2Q9ZA 3M02A 2Z50A 4JYXA 4OKMA 3V1VA 4H5CF 5H9DA 3P41A 3TC1A 4QPFA 2Z4YA 1V4EA 5DGSF 1DI1A 3WEKA 3EGTA 2RAHA 2OPNA 3N5HF 4K10A 1WL2A 1HM7A 2AZLA 5A0JA 4HD1A 5DJRF 3LVSA 3OABA 4NFIF 4JXYA 4E9UA 3VJAA 2PS6A 5IMPA 2AZKA 4KPDA 5E8LA 3WCBA 2E8TA 2F7MF 5IM1A 3LGKA
chains in the Genus database with same CATH superfamily
2AELA 4LXWA 3WEIA 4F6VA 5ILKA 3WCFA 3ACXA 2ZCQA 4JZBA 5EAUA 3WCLA 4DHDA 3Q2QA 3G4DA 3KBKA 4LZ0A 5B0KA 2Q9YA 4NFKF 3WJOA 1ZW5A 2ZEUA 4XQRF 3TFNA 3SDUA 2E4OA 3MAVA 1VG3A 5B01A 3CC9A 3KRFA 2E90A 1UBXA 3KROB 2Z4WA 5DZ2A 4RXDA 2E92A 1UBVA 1WMWA 3VJ8A 3ASXA 3PYAA 2F9KF 3ACWA 4P0XA 5I1UA 3WJNA 1HM4A 1JFAA 5B00A 4LOBA 1KIYA 3W7FA 5E8HA 4LFVF 5JV1F 3P5RA 4GA3A 2F94F 2Z4ZA 3Q30A 3UCAA 5DW7A 3SDQA 2DH4A 3OYRA 2OPMA 3BNYA 4EA2A 4GP1A 5B0IA 1FPSA 4H5DF 4LPHF 2Z4VA 3WCMA 2ZEVA 3CP6A 5ERMA 1YHMA 3ACYA 4RXCA 3ADZA 4NKFA 3WCEA 5DGMF 1HX9A 3TFVA 5ILJA 3ZL6A 3VJ9A 3N5JF 3AE0A 3RMGA 3N0FA 5DHIA 5HN7A 5JA0F 3IPIA 5IVGA 1V4HA 2E8VA 1HXGA 4PVYF 4RXEA 5B03A 3VJEA 3M00A 5DGNF 5EROA 4QXSF 4EA1A 3WEJA 3KRAA 3WCGA 3PDEA 3OABB 4DZWA 1KIZA 2PS5A 1PS1A 2H8OA 4NKEA 1N20A 3WCIA 4LA5A 3M9UA 3DYHA 3ICKA 3P8LA 1WL0A 3N1WF 2EWGA 3NF2A 3WCAA 4XQTF 5AFXA 2E93A 4F62A 1N22A 3SDVA 3WSBA 3B7LA 4OGUA 5DJPF 5HNAA 5IMIA 4MC3A 1WL1A 2J1PA 5ILIA 4GAXA 4KUXA 1UBWA 3N49F 4FJQA 5IK6A 2PS8A 4LIXA 3KRPB 3KB9A 4LUUA 3KRFB 4FP4A 4DXJA 3IBAA 1N21A 1VG4A 3Q1OA 3DYFA 3MZVA 3ICMA 1VG2A 5CG5A 3SAEA 1RTRA 5AELA 4KVWA 1V4KA 4LTZA 3KRPA 2ZCSA 2Z4XA 1EZFA 5ILDA 1N24A 1N23A 4KPJA 3WEFA 3QQVA 2QISA 3WE9A 2J1OA 3ZMCA 3LDWA 4LFEA 4P0WA 4RXAA 3LSNA 4LPGF 2P1CA 3N1VF 4LLSA 4OKZA 5A0IA 5JV0F 4N9UA 5DJVF 3M0GA 2ZY1A 4DWGA 1V4JA 3TS7A 5ERNA 3WJKA 3N3LF 2ZCOA 3G4FA 4H5EF 1YQ7A 3APZA 4E1EA 2I19A 1VG7A 3WSAA 5ILHA 1WKZA 4KWDA 4NFJF 5E8KA 4MC0A 3LJIA 3LGZB 2AETA 4LZCA 5JUZF 3LOMA 3P5PA 3LLWA 3OACB 3KRAB 1V4IA 3M01A 3SDRA 4DWBA 4KKMA 1RQJA 1YYSA 2Z7IA 4KVYA 4P0VA 5IMNA 2PS4A 3OACA 4JXNA 2ONHA 4LTVA 3N45F 3ID0A 5KSXF 3RBMA 2FTZA 1HXAA 3ZOUA 2E94A 3EFQA 3VJBA 1YYQA 3RYWA 3EZ3A 5B0JA 2Z78A 3N46F 3RYEA 3WEGA 4LZ3A 3N0GA 3WEHA 5DIQF 4DI5A 3WCJA 3DYGA 5AYPA 4ZQ8A 5IN8A 3CKEA 2F8CF 5A0KA 5IKAA 3WCHA 2E95A 3AQ0A 1WL3A 3AQBB 3LG5A 3N6KF 3ICZA 2O1OA 1UBYA 4JVJF 4OMGA 1YHKA 3V1XA 3ZMBA 2E8UA 4JZXA 2ONGA 5IL8A 3LMDA 1DGPA 3PKOA 2OGDA 5JV2F 4OMHA 3BNXA 1N1BA 1WY0A 1YYRA 1YYTA 4UMJA 4DEMF 3QKCA 1YV5A 1N1ZA 2E8WA 5DHKA 3PH7A 3ICNA 1YYUA 5ILZA 3S9VA 2OA6A 3WC9A 2F8ZF 3VJDA 5B0LA 3AQCB 2PS7A 2E91A 3P8RA 3NPKA 2AZJA 4L2XF 3Q2ZA 5B0MA 5IKHA 4GP2A 5HN9A 3LZ9A 3NPRA 1RQIA 4KQSA 4LLTA 3LEEA 4F6XA 5IK0A 2ZCRA 3SDTA 3KRCB 4KFAA 5AHUB 5ILYA 4EA0A 4KK2A 4KVIA 5C05A 3S4JA 3NRIA 1YJ4A 5EASA 1HXCA 3N3DA 3ZCDA 3TFPA 4KQ5A 4KVDA 3KROA 3KRCA 4LA6A 2Q80A 2VF6A 5IK9A 3VJCA 5CG6A 3PYBA 3WCDA 4RYPA 2Z52A 4E9ZA 2J5CA 2F92F 3LK5A 5IL3A 4NG6A 2AEKA 2E8XA 2Q58A 4PVXF 4Q23A 3V66A 1VG6A 1YHLA 4WK5A 4XQSF 4N1ZF 4LFGA 2F89F 4NUAA 1JFGA 5B02A 4MC8A 4RNQA 5ER8A 4KQUA 3WCCA 2FORA 5HN8A 2Z7HA 5EATA 2Q9ZA 3M02A 2Z50A 4JYXA 4OKMA 3V1VA 4H5CF 5H9DA 3P41A 3TC1A 4QPFA 2Z4YA 1V4EA 5DGSF 1DI1A 3WEKA 3EGTA 2RAHA 2OPNA 3N5HF 4K10A 1WL2A 1HM7A 2AZLA 5A0JA 4HD1A 5DJRF 3LVSA 3OABA 4NFIF 4JXYA 4E9UA 3VJAA 2PS6A 5IMPA 2AZKA 4KPDA 5E8LA 3WCBA 2E8TA 2F7MF 5IM1A 3LGKA
chains in the Genus database with same CATH topology
2AELA 4LXWA 3WEIA 4F6VA 5ILKA 3WCFA 3ACXA 2ZCQA 4JZBA 5EAUA 3WCLA 4DHDA 3Q2QA 3G4DA 3KBKA 4LZ0A 5B0KA 2Q9YA 4NFKF 3WJOA 1ZW5A 2ZEUA 4XQRF 3TFNA 3SDUA 2E4OA 3MAVA 1VG3A 5B01A 3CC9A 3KRFA 2E90A 1UBXA 3KROB 2Z4WA 5DZ2A 4RXDA 2E92A 1UBVA 1WMWA 3VJ8A 3ASXA 3PYAA 2F9KF 3ACWA 4P0XA 5I1UA 3WJNA 1HM4A 1JFAA 5B00A 4LOBA 1KIYA 3W7FA 5E8HA 4LFVF 5JV1F 3P5RA 4GA3A 2F94F 2Z4ZA 3Q30A 3UCAA 5DW7A 3SDQA 2DH4A 3OYRA 2OPMA 3BNYA 4EA2A 4GP1A 5B0IA 1FPSA 4H5DF 4LPHF 2Z4VA 3WCMA 2ZEVA 3CP6A 5ERMA 1YHMA 3ACYA 4RXCA 3ADZA 4NKFA 3WCEA 5DGMF 1HX9A 3TFVA 5ILJA 3ZL6A 3VJ9A 3N5JF 3AE0A 3RMGA 3N0FA 5DHIA 5HN7A 5JA0F 3IPIA 5IVGA 1V4HA 2E8VA 1HXGA 4PVYF 4RXEA 5B03A 3VJEA 3M00A 5DGNF 5EROA 4QXSF 4EA1A 3WEJA 3KRAA 3WCGA 3PDEA 3OABB 4DZWA 1KIZA 2PS5A 1PS1A 2H8OA 4NKEA 1N20A 3WCIA 4LA5A 3M9UA 3DYHA 3ICKA 3P8LA 1WL0A 3N1WF 2EWGA 3NF2A 3WCAA 4XQTF 5AFXA 2E93A 4F62A 1N22A 3SDVA 3WSBA 3B7LA 4OGUA 5DJPF 5HNAA 5IMIA 4MC3A 1WL1A 2J1PA 5ILIA 4GAXA 4KUXA 1UBWA 3N49F 4FJQA 5IK6A 2PS8A 4LIXA 3KRPB 3KB9A 4LUUA 3KRFB 4FP4A 4DXJA 3IBAA 1N21A 1VG4A 3Q1OA 3DYFA 3MZVA 3ICMA 1VG2A 5CG5A 3SAEA 1RTRA 5AELA 4KVWA 1V4KA 4LTZA 3KRPA 2ZCSA 2Z4XA 1EZFA 5ILDA 1N24A 1N23A 4KPJA 3WEFA 3QQVA 2QISA 3WE9A 2J1OA 3ZMCA 3LDWA 4LFEA 4P0WA 4RXAA 3LSNA 4LPGF 2P1CA 3N1VF 4LLSA 4OKZA 5A0IA 5JV0F 4N9UA 5DJVF 3M0GA 2ZY1A 4DWGA 1V4JA 3TS7A 5ERNA 3WJKA 3N3LF 2ZCOA 3G4FA 4H5EF 1YQ7A 3APZA 4E1EA 2I19A 1VG7A 3WSAA 5ILHA 1WKZA 4KWDA 4NFJF 5E8KA 4MC0A 3LJIA 3LGZB 2AETA 4LZCA 5JUZF 3LOMA 3P5PA 3LLWA 3OACB 3KRAB 1V4IA 3M01A 3SDRA 4DWBA 4KKMA 1RQJA 1YYSA 2Z7IA 4KVYA 4P0VA 5IMNA 2PS4A 3OACA 4JXNA 2ONHA 4LTVA 3N45F 3ID0A 5KSXF 3RBMA 2FTZA 1HXAA 3ZOUA 2E94A 3EFQA 3VJBA 1YYQA 3RYWA 3EZ3A 5B0JA 2Z78A 3N46F 3RYEA 3WEGA 4LZ3A 3N0GA 3WEHA 5DIQF 4DI5A 3WCJA 3DYGA 5AYPA 4ZQ8A 5IN8A 3CKEA 2F8CF 5A0KA 5IKAA 3WCHA 2E95A 3AQ0A 1WL3A 3AQBB 3LG5A 3N6KF 3ICZA 2O1OA 1UBYA 4JVJF 4OMGA 1YHKA 3V1XA 3ZMBA 2E8UA 4JZXA 2ONGA 5IL8A 3LMDA 1DGPA 3PKOA 2OGDA 5JV2F 4OMHA 3BNXA 1N1BA 1WY0A 1YYRA 1YYTA 4UMJA 4DEMF 3QKCA 1YV5A 1N1ZA 2E8WA 5DHKA 3PH7A 3ICNA 1YYUA 5ILZA 3S9VA 2OA6A 3WC9A 2F8ZF 3VJDA 5B0LA 3AQCB 2PS7A 2E91A 3P8RA 3NPKA 2AZJA 4L2XF 3Q2ZA 5B0MA 5IKHA 4GP2A 5HN9A 3LZ9A 3NPRA 1RQIA 4KQSA 4LLTA 3LEEA 4F6XA 5IK0A 2ZCRA 3SDTA 3KRCB 4KFAA 5AHUB 5ILYA 4EA0A 4KK2A 4KVIA 5C05A 3S4JA 3NRIA 1YJ4A 5EASA 1HXCA 3N3DA 3ZCDA 3TFPA 4KQ5A 4KVDA 3KROA 3KRCA 4LA6A 2Q80A 2VF6A 5IK9A 3VJCA 5CG6A 3PYBA 3WCDA 4RYPA 2Z52A 4E9ZA 2J5CA 2F92F 3LK5A 5IL3A 4NG6A 2AEKA 2E8XA 2Q58A 4PVXF 4Q23A 3V66A 1VG6A 1YHLA 4WK5A 4XQSF 4N1ZF 4LFGA 2F89F 4NUAA 1JFGA 5B02A 4MC8A 4RNQA 5ER8A 4KQUA 3WCCA 2FORA 5HN8A 2Z7HA 5EATA 2Q9ZA 3M02A 2Z50A 4JYXA 4OKMA 3V1VA 4H5CF 5H9DA 3P41A 3TC1A 4QPFA 2Z4YA 1V4EA 5DGSF 1DI1A 3WEKA 3EGTA 2RAHA 2OPNA 3N5HF 4K10A 1WL2A 1HM7A 2AZLA 5A0JA 4HD1A 5DJRF 3LVSA 3OABA 4NFIF 4JXYA 4E9UA 3VJAA 2PS6A 5IMPA 2AZKA 4KPDA 5E8LA 3WCBA 2E8TA 2F7MF 5IM1A 3LGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEL A;  4LXW A;  3WEI A;  4F6V A;  5ILK A;  3WCF A;  3ACX A;  2ZCQ A;  4JZB A;  5EAU A;  3WCL A;  4DHD A;  3Q2Q A;  3G4D A;  3KBK A;  4LZ0 A;  5B0K A;  2Q9Y A;  4NFK F;  3WJO A;  1ZW5 A;  2ZEU A;  4XQR F;  3TFN A;  3SDU A;  2E4O A;  3MAV A;  1VG3 A;  5B01 A;  3CC9 A;  3KRF A;  2E90 A;  1UBX A;  3KRO B;  2Z4W A;  5DZ2 A;  4RXD A;  2E92 A;  1UBV A;  1WMW A;  3VJ8 A;  3ASX A;  3PYA A;  2F9K F;  3ACW A;  4P0X A;  5I1U A;  3WJN A;  1HM4 A;  1JFA A;  5B00 A;  4LOB A;  1KIY A;  3W7F A;  5E8H A;  4LFV F;  5JV1 F;  3P5R A;  4GA3 A;  2F94 F;  2Z4Z A;  3Q30 A;  3UCA A;  5DW7 A;  3SDQ A;  2DH4 A;  3OYR A;  2OPM A;  3BNY A;  4EA2 A;  4GP1 A;  5B0I A;  1FPS A;  4H5D F;  4LPH F;  2Z4V A;  3WCM A;  2ZEV A;  3CP6 A;  5ERM A;  1YHM A;  3ACY A;  4RXC A;  3ADZ A;  4NKF A;  3WCE A;  5DGM F;  1HX9 A;  3TFV A;  5ILJ A;  3ZL6 A;  3VJ9 A;  3N5J F;  3AE0 A;  3RMG A;  3N0F A;  5DHI A;  5HN7 A;  5JA0 F;  3IPI A;  5IVG A;  1V4H A;  2E8V A;  1HXG A;  4PVY F;  4RXE A;  5B03 A;  3VJE A;  3M00 A;  5DGN F;  5ERO A;  4QXS F;  4EA1 A;  3WEJ A;  3KRA A;  3WCG A;  3PDE A;  3OAB B;  4DZW A;  1KIZ A;  2PS5 A;  1PS1 A;  2H8O A;  4NKE A;  1N20 A;  3WCI A;  4LA5 A;  3M9U A;  3DYH A;  3ICK A;  3P8L A;  1WL0 A;  3N1W F;  2EWG A;  3NF2 A;  3WCA A;  4XQT F;  5AFX A;  2E93 A;  4F62 A;  1N22 A;  3SDV A;  3WSB A;  3B7L A;  4OGU A;  5DJP F;  5HNA A;  5IMI A;  4MC3 A;  1WL1 A;  2J1P A;  5ILI A;  4GAX A;  4KUX A;  1UBW A;  3N49 F;  4FJQ A;  5IK6 A;  2PS8 A;  4LIX A;  3KRP B;  3KB9 A;  4LUU A;  3KRF B;  4FP4 A;  4DXJ A;  3IBA A;  1N21 A;  1VG4 A;  3Q1O A;  3DYF A;  3MZV A;  3ICM A;  1VG2 A;  5CG5 A;  3SAE A;  1RTR A;  5AEL A;  4KVW A;  1V4K A;  4LTZ A;  3KRP A;  2ZCS A;  2Z4X A;  1EZF A;  5ILD A;  1N24 A;  1N23 A;  4KPJ A;  3WEF A;  3QQV A;  2QIS A;  3WE9 A;  2J1O A;  3ZMC A;  3LDW A;  4LFE A;  4P0W A;  4RXA A;  3LSN A;  4LPG F;  2P1C A;  3N1V F;  4LLS A;  4OKZ A;  5A0I A;  5JV0 F;  4N9U A;  5DJV F;  3M0G A;  2ZY1 A;  4DWG A;  1V4J A;  3TS7 A;  5ERN A;  3WJK A;  3N3L F;  2ZCO A;  3G4F A;  4H5E F;  1YQ7 A;  3APZ A;  4E1E A;  2I19 A;  1VG7 A;  3WSA A;  5ILH A;  1WKZ A;  4KWD A;  4NFJ F;  5E8K A;  4MC0 A;  3LJI A;  3LGZ B;  2AET A;  4LZC A;  5JUZ F;  3LOM A;  3P5P A;  3LLW A;  3OAC B;  3KRA B;  1V4I A;  3M01 A;  3SDR A;  4DWB A;  4KKM A;  1RQJ A;  1YYS A;  2Z7I A;  4KVY A;  4P0V A;  5IMN A;  2PS4 A;  3OAC A;  4JXN A;  2ONH A;  4LTV A;  3N45 F;  3ID0 A;  5KSX F;  3RBM A;  2FTZ A;  1HXA A;  3ZOU A;  2E94 A;  3EFQ A;  3VJB A;  1YYQ A;  3RYW A;  3EZ3 A;  5B0J A;  2Z78 A;  3N46 F;  3RYE A;  3WEG A;  4LZ3 A;  3N0G A;  3WEH A;  5DIQ F;  4DI5 A;  3WCJ A;  3DYG A;  5AYP A;  4ZQ8 A;  5IN8 A;  3CKE A;  2F8C F;  5A0K A;  5IKA A;  3WCH A;  2E95 A;  3AQ0 A;  1WL3 A;  3AQB B;  3LG5 A;  3N6K F;  3ICZ A;  2O1O A;  1UBY A;  4JVJ F;  4OMG A;  1YHK A;  3V1X A;  3ZMB A;  2E8U A;  4JZX A;  2ONG A;  5IL8 A;  3LMD A;  1DGP A;  3PKO A;  2OGD A;  5JV2 F;  4OMH A;  3BNX A;  1N1B A;  1WY0 A;  1YYR A;  1YYT A;  4UMJ A;  4DEM F;  3QKC A;  1YV5 A;  1N1Z A;  2E8W A;  5DHK A;  3PH7 A;  3ICN A;  1YYU A;  5ILZ A;  3S9V A;  2OA6 A;  3WC9 A;  2F8Z F;  3VJD A;  5B0L A;  3AQC B;  2PS7 A;  2E91 A;  3P8R A;  3NPK A;  2AZJ A;  4L2X F;  3Q2Z A;  5B0M A;  5IKH A;  4GP2 A;  5HN9 A;  3LZ9 A;  3NPR A;  1RQI A;  4KQS A;  4LLT A;  3LEE A;  4F6X A;  5IK0 A;  2ZCR A;  3SDT A;  3KRC B;  4KFA A;  5AHU B;  5ILY A;  4EA0 A;  4KK2 A;  4KVI A;  5C05 A;  3S4J A;  3NRI A;  1YJ4 A;  5EAS A;  1HXC A;  3N3D A;  3ZCD A;  3TFP A;  4KQ5 A;  4KVD A;  3KRO A;  3KRC A;  4LA6 A;  2Q80 A;  2VF6 A;  5IK9 A;  3VJC A;  5CG6 A;  3PYB A;  3WCD A;  4RYP A;  2Z52 A;  4E9Z A;  2J5C A;  2F92 F;  3LK5 A;  5IL3 A;  4NG6 A;  2AEK A;  2E8X A;  2Q58 A;  4PVX F;  4Q23 A;  3V66 A;  1VG6 A;  1YHL A;  4WK5 A;  4XQS F;  4N1Z F;  4LFG A;  2F89 F;  4NUA A;  1JFG A;  5B02 A;  4MC8 A;  4RNQ A;  5ER8 A;  4KQU A;  3WCC A;  2FOR A;  5HN8 A;  2Z7H A;  5EAT A;  2Q9Z A;  3M02 A;  2Z50 A;  4JYX A;  4OKM A;  3V1V A;  4H5C F;  5H9D A;  3P41 A;  3TC1 A;  4QPF A;  2Z4Y A;  1V4E A;  5DGS F;  1DI1 A;  3WEK A;  3EGT A;  2RAH A;  2OPN A;  3N5H F;  4K10 A;  1WL2 A;  1HM7 A;  2AZL A;  5A0J A;  4HD1 A;  5DJR F;  3LVS A;  3OAB A;  4NFI F;  4JXY A;  4E9U A;  3VJA A;  2PS6 A;  5IMP A;  2AZK A;  4KPD A;  5E8L A;  3WCB A;  2E8T A;  2F7M F;  5IM1 A;  3LGK A; 
#chains in the Genus database with same CATH topology
 2AEL A;  4LXW A;  3WEI A;  4F6V A;  5ILK A;  3WCF A;  3ACX A;  2ZCQ A;  4JZB A;  5EAU A;  3WCL A;  4DHD A;  3Q2Q A;  3G4D A;  3KBK A;  4LZ0 A;  5B0K A;  2Q9Y A;  4NFK F;  3WJO A;  1ZW5 A;  2ZEU A;  4XQR F;  3TFN A;  3SDU A;  2E4O A;  3MAV A;  1VG3 A;  5B01 A;  3CC9 A;  3KRF A;  2E90 A;  1UBX A;  3KRO B;  2Z4W A;  5DZ2 A;  4RXD A;  2E92 A;  1UBV A;  1WMW A;  3VJ8 A;  3ASX A;  3PYA A;  2F9K F;  3ACW A;  4P0X A;  5I1U A;  3WJN A;  1HM4 A;  1JFA A;  5B00 A;  4LOB A;  1KIY A;  3W7F A;  5E8H A;  4LFV F;  5JV1 F;  3P5R A;  4GA3 A;  2F94 F;  2Z4Z A;  3Q30 A;  3UCA A;  5DW7 A;  3SDQ A;  2DH4 A;  3OYR A;  2OPM A;  3BNY A;  4EA2 A;  4GP1 A;  5B0I A;  1FPS A;  4H5D F;  4LPH F;  2Z4V A;  3WCM A;  2ZEV A;  3CP6 A;  5ERM A;  1YHM A;  3ACY A;  4RXC A;  3ADZ A;  4NKF A;  3WCE A;  5DGM F;  1HX9 A;  3TFV A;  5ILJ A;  3ZL6 A;  3VJ9 A;  3N5J F;  3AE0 A;  3RMG A;  3N0F A;  5DHI A;  5HN7 A;  5JA0 F;  3IPI A;  5IVG A;  1V4H A;  2E8V A;  1HXG A;  4PVY F;  4RXE A;  5B03 A;  3VJE A;  3M00 A;  5DGN F;  5ERO A;  4QXS F;  4EA1 A;  3WEJ A;  3KRA A;  3WCG A;  3PDE A;  3OAB B;  4DZW A;  1KIZ A;  2PS5 A;  1PS1 A;  2H8O A;  4NKE A;  1N20 A;  3WCI A;  4LA5 A;  3M9U A;  3DYH A;  3ICK A;  3P8L A;  1WL0 A;  3N1W F;  2EWG A;  3NF2 A;  3WCA A;  4XQT F;  5AFX A;  2E93 A;  4F62 A;  1N22 A;  3SDV A;  3WSB A;  3B7L A;  4OGU A;  5DJP F;  5HNA A;  5IMI A;  4MC3 A;  1WL1 A;  2J1P A;  5ILI A;  4GAX A;  4KUX A;  1UBW A;  3N49 F;  4FJQ A;  5IK6 A;  2PS8 A;  4LIX A;  3KRP B;  3KB9 A;  4LUU A;  3KRF B;  4FP4 A;  4DXJ A;  3IBA A;  1N21 A;  1VG4 A;  3Q1O A;  3DYF A;  3MZV A;  3ICM A;  1VG2 A;  5CG5 A;  3SAE A;  1RTR A;  5AEL A;  4KVW A;  1V4K A;  4LTZ A;  3KRP A;  2ZCS A;  2Z4X A;  1EZF A;  5ILD A;  1N24 A;  1N23 A;  4KPJ A;  3WEF A;  3QQV A;  2QIS A;  3WE9 A;  2J1O A;  3ZMC A;  3LDW A;  4LFE A;  4P0W A;  4RXA A;  3LSN A;  4LPG F;  2P1C A;  3N1V F;  4LLS A;  4OKZ A;  5A0I A;  5JV0 F;  4N9U A;  5DJV F;  3M0G A;  2ZY1 A;  4DWG A;  1V4J A;  3TS7 A;  5ERN A;  3WJK A;  3N3L F;  2ZCO A;  3G4F A;  4H5E F;  1YQ7 A;  3APZ A;  4E1E A;  2I19 A;  1VG7 A;  3WSA A;  5ILH A;  1WKZ A;  4KWD A;  4NFJ F;  5E8K A;  4MC0 A;  3LJI A;  3LGZ B;  2AET A;  4LZC A;  5JUZ F;  3LOM A;  3P5P A;  3LLW A;  3OAC B;  3KRA B;  1V4I A;  3M01 A;  3SDR A;  4DWB A;  4KKM A;  1RQJ A;  1YYS A;  2Z7I A;  4KVY A;  4P0V A;  5IMN A;  2PS4 A;  3OAC A;  4JXN A;  2ONH A;  4LTV A;  3N45 F;  3ID0 A;  5KSX F;  3RBM A;  2FTZ A;  1HXA A;  3ZOU A;  2E94 A;  3EFQ A;  3VJB A;  1YYQ A;  3RYW A;  3EZ3 A;  5B0J A;  2Z78 A;  3N46 F;  3RYE A;  3WEG A;  4LZ3 A;  3N0G A;  3WEH A;  5DIQ F;  4DI5 A;  3WCJ A;  3DYG A;  5AYP A;  4ZQ8 A;  5IN8 A;  3CKE A;  2F8C F;  5A0K A;  5IKA A;  3WCH A;  2E95 A;  3AQ0 A;  1WL3 A;  3AQB B;  3LG5 A;  3N6K F;  3ICZ A;  2O1O A;  1UBY A;  4JVJ F;  4OMG A;  1YHK A;  3V1X A;  3ZMB A;  2E8U A;  4JZX A;  2ONG A;  5IL8 A;  3LMD A;  1DGP A;  3PKO A;  2OGD A;  5JV2 F;  4OMH A;  3BNX A;  1N1B A;  1WY0 A;  1YYR A;  1YYT A;  4UMJ A;  4DEM F;  3QKC A;  1YV5 A;  1N1Z A;  2E8W A;  5DHK A;  3PH7 A;  3ICN A;  1YYU A;  5ILZ A;  3S9V A;  2OA6 A;  3WC9 A;  2F8Z F;  3VJD A;  5B0L A;  3AQC B;  2PS7 A;  2E91 A;  3P8R A;  3NPK A;  2AZJ A;  4L2X F;  3Q2Z A;  5B0M A;  5IKH A;  4GP2 A;  5HN9 A;  3LZ9 A;  3NPR A;  1RQI A;  4KQS A;  4LLT A;  3LEE A;  4F6X A;  5IK0 A;  2ZCR A;  3SDT A;  3KRC B;  4KFA A;  5AHU B;  5ILY A;  4EA0 A;  4KK2 A;  4KVI A;  5C05 A;  3S4J A;  3NRI A;  1YJ4 A;  5EAS A;  1HXC A;  3N3D A;  3ZCD A;  3TFP A;  4KQ5 A;  4KVD A;  3KRO A;  3KRC A;  4LA6 A;  2Q80 A;  2VF6 A;  5IK9 A;  3VJC A;  5CG6 A;  3PYB A;  3WCD A;  4RYP A;  2Z52 A;  4E9Z A;  2J5C A;  2F92 F;  3LK5 A;  5IL3 A;  4NG6 A;  2AEK A;  2E8X A;  2Q58 A;  4PVX F;  4Q23 A;  3V66 A;  1VG6 A;  1YHL A;  4WK5 A;  4XQS F;  4N1Z F;  4LFG A;  2F89 F;  4NUA A;  1JFG A;  5B02 A;  4MC8 A;  4RNQ A;  5ER8 A;  4KQU A;  3WCC A;  2FOR A;  5HN8 A;  2Z7H A;  5EAT A;  2Q9Z A;  3M02 A;  2Z50 A;  4JYX A;  4OKM A;  3V1V A;  4H5C F;  5H9D A;  3P41 A;  3TC1 A;  4QPF A;  2Z4Y A;  1V4E A;  5DGS F;  1DI1 A;  3WEK A;  3EGT A;  2RAH A;  2OPN A;  3N5H F;  4K10 A;  1WL2 A;  1HM7 A;  2AZL A;  5A0J A;  4HD1 A;  5DJR F;  3LVS A;  3OAB A;  4NFI F;  4JXY A;  4E9U A;  3VJA A;  2PS6 A;  5IMP A;  2AZK A;  4KPD A;  5E8L A;  3WCB A;  2E8T A;  2F7M F;  5IM1 A;  3LGK A; 
#chains in the Genus database with same CATH homology
 2AEL A;  4LXW A;  3WEI A;  4F6V A;  5ILK A;  3WCF A;  3ACX A;  2ZCQ A;  4JZB A;  5EAU A;  3WCL A;  4DHD A;  3Q2Q A;  3G4D A;  3KBK A;  4LZ0 A;  5B0K A;  2Q9Y A;  4NFK F;  3WJO A;  1ZW5 A;  2ZEU A;  4XQR F;  3TFN A;  3SDU A;  2E4O A;  3MAV A;  1VG3 A;  5B01 A;  3CC9 A;  3KRF A;  2E90 A;  1UBX A;  3KRO B;  2Z4W A;  5DZ2 A;  4RXD A;  2E92 A;  1UBV A;  1WMW A;  3VJ8 A;  3ASX A;  3PYA A;  2F9K F;  3ACW A;  4P0X A;  5I1U A;  3WJN A;  1HM4 A;  1JFA A;  5B00 A;  4LOB A;  1KIY A;  3W7F A;  5E8H A;  4LFV F;  5JV1 F;  3P5R A;  4GA3 A;  2F94 F;  2Z4Z A;  3Q30 A;  3UCA A;  5DW7 A;  3SDQ A;  2DH4 A;  3OYR A;  2OPM A;  3BNY A;  4EA2 A;  4GP1 A;  5B0I A;  1FPS A;  4H5D F;  4LPH F;  2Z4V A;  3WCM A;  2ZEV A;  3CP6 A;  5ERM A;  1YHM A;  3ACY A;  4RXC A;  3ADZ A;  4NKF A;  3WCE A;  5DGM F;  1HX9 A;  3TFV A;  5ILJ A;  3ZL6 A;  3VJ9 A;  3N5J F;  3AE0 A;  3RMG A;  3N0F A;  5DHI A;  5HN7 A;  5JA0 F;  3IPI A;  5IVG A;  1V4H A;  2E8V A;  1HXG A;  4PVY F;  4RXE A;  5B03 A;  3VJE A;  3M00 A;  5DGN F;  5ERO A;  4QXS F;  4EA1 A;  3WEJ A;  3KRA A;  3WCG A;  3PDE A;  3OAB B;  4DZW A;  1KIZ A;  2PS5 A;  1PS1 A;  2H8O A;  4NKE A;  1N20 A;  3WCI A;  4LA5 A;  3M9U A;  3DYH A;  3ICK A;  3P8L A;  1WL0 A;  3N1W F;  2EWG A;  3NF2 A;  3WCA A;  4XQT F;  5AFX A;  2E93 A;  4F62 A;  1N22 A;  3SDV A;  3WSB A;  3B7L A;  4OGU A;  5DJP F;  5HNA A;  5IMI A;  4MC3 A;  1WL1 A;  2J1P A;  5ILI A;  4GAX A;  4KUX A;  1UBW A;  3N49 F;  4FJQ A;  5IK6 A;  2PS8 A;  4LIX A;  3KRP B;  3KB9 A;  4LUU A;  3KRF B;  4FP4 A;  4DXJ A;  3IBA A;  1N21 A;  1VG4 A;  3Q1O A;  3DYF A;  3MZV A;  3ICM A;  1VG2 A;  5CG5 A;  3SAE A;  1RTR A;  5AEL A;  4KVW A;  1V4K A;  4LTZ A;  3KRP A;  2ZCS A;  2Z4X A;  1EZF A;  5ILD A;  1N24 A;  1N23 A;  4KPJ A;  3WEF A;  3QQV A;  2QIS A;  3WE9 A;  2J1O A;  3ZMC A;  3LDW A;  4LFE A;  4P0W A;  4RXA A;  3LSN A;  4LPG F;  2P1C A;  3N1V F;  4LLS A;  4OKZ A;  5A0I A;  5JV0 F;  4N9U A;  5DJV F;  3M0G A;  2ZY1 A;  4DWG A;  1V4J A;  3TS7 A;  5ERN A;  3WJK A;  3N3L F;  2ZCO A;  3G4F A;  4H5E F;  1YQ7 A;  3APZ A;  4E1E A;  2I19 A;  1VG7 A;  3WSA A;  5ILH A;  1WKZ A;  4KWD A;  4NFJ F;  5E8K A;  4MC0 A;  3LJI A;  3LGZ B;  2AET A;  4LZC A;  5JUZ F;  3LOM A;  3P5P A;  3LLW A;  3OAC B;  3KRA B;  1V4I A;  3M01 A;  3SDR A;  4DWB A;  4KKM A;  1RQJ A;  1YYS A;  2Z7I A;  4KVY A;  4P0V A;  5IMN A;  2PS4 A;  3OAC A;  4JXN A;  2ONH A;  4LTV A;  3N45 F;  3ID0 A;  5KSX F;  3RBM A;  2FTZ A;  1HXA A;  3ZOU A;  2E94 A;  3EFQ A;  3VJB A;  1YYQ A;  3RYW A;  3EZ3 A;  5B0J A;  2Z78 A;  3N46 F;  3RYE A;  3WEG A;  4LZ3 A;  3N0G A;  3WEH A;  5DIQ F;  4DI5 A;  3WCJ A;  3DYG A;  5AYP A;  4ZQ8 A;  5IN8 A;  3CKE A;  2F8C F;  5A0K A;  5IKA A;  3WCH A;  2E95 A;  3AQ0 A;  1WL3 A;  3AQB B;  3LG5 A;  3N6K F;  3ICZ A;  2O1O A;  1UBY A;  4JVJ F;  4OMG A;  1YHK A;  3V1X A;  3ZMB A;  2E8U A;  4JZX A;  2ONG A;  5IL8 A;  3LMD A;  1DGP A;  3PKO A;  2OGD A;  5JV2 F;  4OMH A;  3BNX A;  1N1B A;  1WY0 A;  1YYR A;  1YYT A;  4UMJ A;  4DEM F;  3QKC A;  1YV5 A;  1N1Z A;  2E8W A;  5DHK A;  3PH7 A;  3ICN A;  1YYU A;  5ILZ A;  3S9V A;  2OA6 A;  3WC9 A;  2F8Z F;  3VJD A;  5B0L A;  3AQC B;  2PS7 A;  2E91 A;  3P8R A;  3NPK A;  2AZJ A;  4L2X F;  3Q2Z A;  5B0M A;  5IKH A;  4GP2 A;  5HN9 A;  3LZ9 A;  3NPR A;  1RQI A;  4KQS A;  4LLT A;  3LEE A;  4F6X A;  5IK0 A;  2ZCR A;  3SDT A;  3KRC B;  4KFA A;  5AHU B;  5ILY A;  4EA0 A;  4KK2 A;  4KVI A;  5C05 A;  3S4J A;  3NRI A;  1YJ4 A;  5EAS A;  1HXC A;  3N3D A;  3ZCD A;  3TFP A;  4KQ5 A;  4KVD A;  3KRO A;  3KRC A;  4LA6 A;  2Q80 A;  2VF6 A;  5IK9 A;  3VJC A;  5CG6 A;  3PYB A;  3WCD A;  4RYP A;  2Z52 A;  4E9Z A;  2J5C A;  2F92 F;  3LK5 A;  5IL3 A;  4NG6 A;  2AEK A;  2E8X A;  2Q58 A;  4PVX F;  4Q23 A;  3V66 A;  1VG6 A;  1YHL A;  4WK5 A;  4XQS F;  4N1Z F;  4LFG A;  2F89 F;  4NUA A;  1JFG A;  5B02 A;  4MC8 A;  4RNQ A;  5ER8 A;  4KQU A;  3WCC A;  2FOR A;  5HN8 A;  2Z7H A;  5EAT A;  2Q9Z A;  3M02 A;  2Z50 A;  4JYX A;  4OKM A;  3V1V A;  4H5C F;  5H9D A;  3P41 A;  3TC1 A;  4QPF A;  2Z4Y A;  1V4E A;  5DGS F;  1DI1 A;  3WEK A;  3EGT A;  2RAH A;  2OPN A;  3N5H F;  4K10 A;  1WL2 A;  1HM7 A;  2AZL A;  5A0J A;  4HD1 A;  5DJR F;  3LVS A;  3OAB A;  4NFI F;  4JXY A;  4E9U A;  3VJA A;  2PS6 A;  5IMP A;  2AZK A;  4KPD A;  5E8L A;  3WCB A;  2E8T A;  2F7M F;  5IM1 A;  3LGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...