3KROB

Mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium, ipp, and dmaspp (ii)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
259
structure length
259
Chain Sequence
MQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLTDGSRPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALEELGGFHGKNAELMSSLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyl diphosphate synthase large subunit
publication title Structure of a heterotetrameric geranyl pyrophosphate synthase from mint (Mentha piperita) reveals intersubunit regulation
pubmed doi rcsb
source organism Mentha x piperita
total genus 94
structure length 259
sequence length 259
chains with identical sequence C
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2009-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3kroB00
5HN9A 4OMHA 3ACYA 3WC9A 4DXJA 3PYBA 3VJBA 2EWGA 3LDWA 1YQ7A 3IPIA 3RBMA 1V4IA 4RXEA 5ERMA 5IN8A 4N9UA 1WL1A 3SAEA 3Q2ZA 1FPSA 5ERNA 3RYWA 3DYGA 4GP2A 5A0IA 4GAXA 4QXSF 3WCMA 3WCDA 3ZOUA 1WL2A 5DGNF 4L2XF 3WCLA 3ICMA 4P0WA 3KB9A 3WEHA 1WL3A 3KROA 3OABB 3WCIA 2AZKA 2F89F 4NFKF 2E8TA 3SDQA 2Z7HA 3LJIA 2AELA 5ILKA 3WSAA 5IK0A 2ZEVA 3WEKA 4XQSF 2AZLA 5AYPA 3KRAA 5IKHA 3VJEA 3PKOA 3N5JF 4UMJA 4XQTF 1HXCA 1HX9A 2ZEUA 2DH4A 2O1OA 4LA5A 3S9VA 3VJ9A 4F6VA 5A0KA 4KVDA 4NFIF 3ID0A 4LFEA 4H5DF 4PVYF 5CG6A 3P8RA 3ZL6A 5IK6A 1YYUA 3NRIA 2Z4ZA 3VJCA 5IKAA 5ILHA 1YJ4A 3ZCDA 3BNYA 3ACWA 1N24A 3TS7A 1N23A 3AQ0A 1VG4A 3CKEA 5E8LA 3ICNA 1HXAA 5AHUB 3DYFA 1HM4A 2H8OA 4LFGA 2OPNA 5DJPF 3PDEA 3WCEA 3N6KF 4NG6A 3EGTA 4DZWA 3S4JA 5A0JA 2J5CA 5AFXA 3QQVA 2P1CA 2F8ZF 4RXAA 4E9UA 4F6XA 2F94F 4OKMA 4DHDA 5B00A 4GP1A 4XQRF 1V4JA 5EROA 5DHIA 2F7MF 1VG6A 3WCCA 4ZQ8A 4NFJF 1RTRA 3ZMBA 3N3DA 4PVXF 5B0JA 1JFGA 3WEJA 4P0XA 2PS6A 3EFQA 4LZCA 3KROB 4DWBA 5CG5A 4EA2A 3KRFA 2Q9ZA 4LZ0A 3LK5A 3KRPA 1DGPA 2E91A 5DJVF 2Z50A 2AEKA 3WEGA 3LOMA 4QPFA 4LTZA 3KRAB 5HN8A 4FJQA 3Q2QA 3OACA 3WCJA 1VG3A 5IK9A 2ZCRA 4JZXA 3LLWA 4GA3A 2Z78A 3LMDA 3NPKA 5HNAA 3SDRA 3B7LA 4KVIA 3N0GA 2Z7IA 4LFVF 4LIXA 4OMGA 3M00A 3WJNA 5ILDA 4KQ5A 1UBYA 5B0LA 5ILIA 5B0KA 3ICKA 3CC9A 1N21A 2Z4YA 3LVSA 5IMNA 2Z4XA 1YHKA 1WKZA 3LEEA 1ZW5A 5IL3A 2E8UA 1YHMA 2PS8A 4WK5A 1PS1A 4JVJF 4RXDA 4N1ZF 2E8XA 1WL0A 3N3LF 4LOBA 4FP4A 2E8WA 3VJAA 5ILJA 3G4DA 4KVYA 1RQJA 5DIQF 1DI1A 5DJRF 2J1PA 2PS4A 2AZJA 3P41A 3SDUA 2F8CF 3LGZB 3N0FA 4KKMA 3CP6A 2VF6A 3NF2A 2PS7A 4LPHF 4KVWA 5IL8A 2Q58A 3SDTA 2E93A 3DYHA 3LZ9A 3ICZA 5HN7A 2QISA 5B0MA 3WCGA 3N1VF 2AETA 4LA6A 5I1UA 4JXYA 4LTVA 3M01A 5AELA 1YHLA 1UBVA 2PS5A 4EA0A 5EASA 1YYTA 4Q23A 2E92A 3PH7A 1N22A 5EATA 5C05A 4KPDA 3IBAA 3UCAA 2OGDA 2ONGA 3NPRA 2E95A 4KUXA 4DI5A 4MC3A 3KRCB 4F62A 3M9UA 1N1BA 3P8LA 2OPMA 3MZVA 3AE0A 4OGUA 5DGSF 3AQBB 2OA6A 3KRFB 4RXCA 3TFPA 4LPGF 3WCHA 3KRCA 5EAUA 3KRPB 5JV2F 1N1ZA 3N49F 5E8KA 3RYEA 1V4KA 5IMIA 1RQIA 4KWDA 5KSXF 3WE9A 3QKCA 3OACB 5DHKA 5B01A 2FTZA 3PYAA 1HM7A 3SDVA 2E94A 3W7FA 3G4FA 3VJ8A 3WCAA 3LG5A 5IM1A 4NKFA 3EZ3A 3Q30A 5ER8A 3WCBA 1N20A 1WY0A 4KQUA 2Z4VA 4LUUA 4E9ZA 3TFNA 4MC0A 2RAHA 3LSNA 4E1EA 4LLSA 2E8VA 1YYSA 3BNXA 3MAVA 3OABA 5B03A 3N1WF 1WMWA 2J1OA 3TC1A 3OYRA 4K10A 3V1VA 2E4OA 4JZBA 4P0VA 5ILYA 5B02A 4KK2A 4RNQA 1UBXA 4NUAA 3ADZA 2I19A 4LZ3A 4HD1A 2Z52A 1V4HA 2ZCQA 3P5RA 4EA1A 1YYRA 5JA0F 5ILZA 4KQSA 3WCFA 4JXNA 5DW7A 3V1XA 4H5CF 4KPJA 2ONHA 3WJKA 2ZY1A 2E90A 3VJDA 3WEFA 4MC8A 1V4EA 2Q9YA 3Q1OA 3RMGA 2Z4WA 5DGMF 3APZA 1UBWA 4LXWA 1VG2A 5IMPA 3WEIA 1KIYA 1HXGA 5H9DA 3WSBA 5DZ2A 5B0IA 3TFVA 4DWGA 5JUZF 2F92F 4RYPA 5IVGA 2F9KF 3ASXA 2Q80A 1JFAA 3M0GA 3N46F 4OKZA 3LGKA 3N5HF 4LLTA 3WJOA 3M02A 4DEMF 2ZCSA 1EZFA 1VG7A 1YV5A 2FORA 3ACXA 4NKEA 5JV1F 1YYQA 4JYXA 3KBKA 5JV0F 1KIZA 3N45F 3V66A 4H5EF 3ZMCA 3P5PA 3AQCB 5E8HA 2ZCOA 4KFAA
chains in the Genus database with same CATH superfamily
5HN9A 4OMHA 3ACYA 3WC9A 4DXJA 3PYBA 3VJBA 2EWGA 3LDWA 1YQ7A 3IPIA 3RBMA 1V4IA 4RXEA 5ERMA 5IN8A 4N9UA 1WL1A 3SAEA 3Q2ZA 1FPSA 5ERNA 3RYWA 3DYGA 4GP2A 5A0IA 4GAXA 4QXSF 3WCMA 3WCDA 3ZOUA 1WL2A 5DGNF 4L2XF 3WCLA 3ICMA 4P0WA 3KB9A 3WEHA 1WL3A 3KROA 3OABB 3WCIA 2AZKA 2F89F 4NFKF 2E8TA 3SDQA 2Z7HA 3LJIA 2AELA 5ILKA 3WSAA 5IK0A 2ZEVA 3WEKA 4XQSF 2AZLA 5AYPA 3KRAA 5IKHA 3VJEA 3PKOA 3N5JF 4UMJA 4XQTF 1HXCA 1HX9A 2ZEUA 2DH4A 2O1OA 4LA5A 3S9VA 3VJ9A 4F6VA 5A0KA 4KVDA 4NFIF 3ID0A 4LFEA 4H5DF 4PVYF 5CG6A 3P8RA 3ZL6A 5IK6A 1YYUA 3NRIA 2Z4ZA 3VJCA 5IKAA 5ILHA 1YJ4A 3ZCDA 3BNYA 3ACWA 1N24A 3TS7A 1N23A 3AQ0A 1VG4A 3CKEA 5E8LA 3ICNA 1HXAA 5AHUB 3DYFA 1HM4A 2H8OA 4LFGA 2OPNA 5DJPF 3PDEA 3WCEA 3N6KF 4NG6A 3EGTA 4DZWA 3S4JA 5A0JA 2J5CA 5AFXA 3QQVA 2P1CA 2F8ZF 4RXAA 4E9UA 4F6XA 2F94F 4OKMA 4DHDA 5B00A 4GP1A 4XQRF 1V4JA 5EROA 5DHIA 2F7MF 1VG6A 3WCCA 4ZQ8A 4NFJF 1RTRA 3ZMBA 3N3DA 4PVXF 5B0JA 1JFGA 3WEJA 4P0XA 2PS6A 3EFQA 4LZCA 3KROB 4DWBA 5CG5A 4EA2A 3KRFA 2Q9ZA 4LZ0A 3LK5A 3KRPA 1DGPA 2E91A 5DJVF 2Z50A 2AEKA 3WEGA 3LOMA 4QPFA 4LTZA 3KRAB 5HN8A 4FJQA 3Q2QA 3OACA 3WCJA 1VG3A 5IK9A 2ZCRA 4JZXA 3LLWA 4GA3A 2Z78A 3LMDA 3NPKA 5HNAA 3SDRA 3B7LA 4KVIA 3N0GA 2Z7IA 4LFVF 4LIXA 4OMGA 3M00A 3WJNA 5ILDA 4KQ5A 1UBYA 5B0LA 5ILIA 5B0KA 3ICKA 3CC9A 1N21A 2Z4YA 3LVSA 5IMNA 2Z4XA 1YHKA 1WKZA 3LEEA 1ZW5A 5IL3A 2E8UA 1YHMA 2PS8A 4WK5A 1PS1A 4JVJF 4RXDA 4N1ZF 2E8XA 1WL0A 3N3LF 4LOBA 4FP4A 2E8WA 3VJAA 5ILJA 3G4DA 4KVYA 1RQJA 5DIQF 1DI1A 5DJRF 2J1PA 2PS4A 2AZJA 3P41A 3SDUA 2F8CF 3LGZB 3N0FA 4KKMA 3CP6A 2VF6A 3NF2A 2PS7A 4LPHF 4KVWA 5IL8A 2Q58A 3SDTA 2E93A 3DYHA 3LZ9A 3ICZA 5HN7A 2QISA 5B0MA 3WCGA 3N1VF 2AETA 4LA6A 5I1UA 4JXYA 4LTVA 3M01A 5AELA 1YHLA 1UBVA 2PS5A 4EA0A 5EASA 1YYTA 4Q23A 2E92A 3PH7A 1N22A 5EATA 5C05A 4KPDA 3IBAA 3UCAA 2OGDA 2ONGA 3NPRA 2E95A 4KUXA 4DI5A 4MC3A 3KRCB 4F62A 3M9UA 1N1BA 3P8LA 2OPMA 3MZVA 3AE0A 4OGUA 5DGSF 3AQBB 2OA6A 3KRFB 4RXCA 3TFPA 4LPGF 3WCHA 3KRCA 5EAUA 3KRPB 5JV2F 1N1ZA 3N49F 5E8KA 3RYEA 1V4KA 5IMIA 1RQIA 4KWDA 5KSXF 3WE9A 3QKCA 3OACB 5DHKA 5B01A 2FTZA 3PYAA 1HM7A 3SDVA 2E94A 3W7FA 3G4FA 3VJ8A 3WCAA 3LG5A 5IM1A 4NKFA 3EZ3A 3Q30A 5ER8A 3WCBA 1N20A 1WY0A 4KQUA 2Z4VA 4LUUA 4E9ZA 3TFNA 4MC0A 2RAHA 3LSNA 4E1EA 4LLSA 2E8VA 1YYSA 3BNXA 3MAVA 3OABA 5B03A 3N1WF 1WMWA 2J1OA 3TC1A 3OYRA 4K10A 3V1VA 2E4OA 4JZBA 4P0VA 5ILYA 5B02A 4KK2A 4RNQA 1UBXA 4NUAA 3ADZA 2I19A 4LZ3A 4HD1A 2Z52A 1V4HA 2ZCQA 3P5RA 4EA1A 1YYRA 5JA0F 5ILZA 4KQSA 3WCFA 4JXNA 5DW7A 3V1XA 4H5CF 4KPJA 2ONHA 3WJKA 2ZY1A 2E90A 3VJDA 3WEFA 4MC8A 1V4EA 2Q9YA 3Q1OA 3RMGA 2Z4WA 5DGMF 3APZA 1UBWA 4LXWA 1VG2A 5IMPA 3WEIA 1KIYA 1HXGA 5H9DA 3WSBA 5DZ2A 5B0IA 3TFVA 4DWGA 5JUZF 2F92F 4RYPA 5IVGA 2F9KF 3ASXA 2Q80A 1JFAA 3M0GA 3N46F 4OKZA 3LGKA 3N5HF 4LLTA 3WJOA 3M02A 4DEMF 2ZCSA 1EZFA 1VG7A 1YV5A 2FORA 3ACXA 4NKEA 5JV1F 1YYQA 4JYXA 3KBKA 5JV0F 1KIZA 3N45F 3V66A 4H5EF 3ZMCA 3P5PA 3AQCB 5E8HA 2ZCOA 4KFAA
chains in the Genus database with same CATH topology
5HN9A 4OMHA 3ACYA 3WC9A 4DXJA 3PYBA 3VJBA 2EWGA 3LDWA 1YQ7A 3IPIA 3RBMA 1V4IA 4RXEA 5ERMA 5IN8A 4N9UA 1WL1A 3SAEA 3Q2ZA 1FPSA 5ERNA 3RYWA 3DYGA 4GP2A 5A0IA 4GAXA 4QXSF 3WCMA 3WCDA 3ZOUA 1WL2A 5DGNF 4L2XF 3WCLA 3ICMA 4P0WA 3KB9A 3WEHA 1WL3A 3KROA 3OABB 3WCIA 2AZKA 2F89F 4NFKF 2E8TA 3SDQA 2Z7HA 3LJIA 2AELA 5ILKA 3WSAA 5IK0A 2ZEVA 3WEKA 4XQSF 2AZLA 5AYPA 3KRAA 5IKHA 3VJEA 3PKOA 3N5JF 4UMJA 4XQTF 1HXCA 1HX9A 2ZEUA 2DH4A 2O1OA 4LA5A 3S9VA 3VJ9A 4F6VA 5A0KA 4KVDA 4NFIF 3ID0A 4LFEA 4H5DF 4PVYF 5CG6A 3P8RA 3ZL6A 5IK6A 1YYUA 3NRIA 2Z4ZA 3VJCA 5IKAA 5ILHA 1YJ4A 3ZCDA 3BNYA 3ACWA 1N24A 3TS7A 1N23A 3AQ0A 1VG4A 3CKEA 5E8LA 3ICNA 1HXAA 5AHUB 3DYFA 1HM4A 2H8OA 4LFGA 2OPNA 5DJPF 3PDEA 3WCEA 3N6KF 4NG6A 3EGTA 4DZWA 3S4JA 5A0JA 2J5CA 5AFXA 3QQVA 2P1CA 2F8ZF 4RXAA 4E9UA 4F6XA 2F94F 4OKMA 4DHDA 5B00A 4GP1A 4XQRF 1V4JA 5EROA 5DHIA 2F7MF 1VG6A 3WCCA 4ZQ8A 4NFJF 1RTRA 3ZMBA 3N3DA 4PVXF 5B0JA 1JFGA 3WEJA 4P0XA 2PS6A 3EFQA 4LZCA 3KROB 4DWBA 5CG5A 4EA2A 3KRFA 2Q9ZA 4LZ0A 3LK5A 3KRPA 1DGPA 2E91A 5DJVF 2Z50A 2AEKA 3WEGA 3LOMA 4QPFA 4LTZA 3KRAB 5HN8A 4FJQA 3Q2QA 3OACA 3WCJA 1VG3A 5IK9A 2ZCRA 4JZXA 3LLWA 4GA3A 2Z78A 3LMDA 3NPKA 5HNAA 3SDRA 3B7LA 4KVIA 3N0GA 2Z7IA 4LFVF 4LIXA 4OMGA 3M00A 3WJNA 5ILDA 4KQ5A 1UBYA 5B0LA 5ILIA 5B0KA 3ICKA 3CC9A 1N21A 2Z4YA 3LVSA 5IMNA 2Z4XA 1YHKA 1WKZA 3LEEA 1ZW5A 5IL3A 2E8UA 1YHMA 2PS8A 4WK5A 1PS1A 4JVJF 4RXDA 4N1ZF 2E8XA 1WL0A 3N3LF 4LOBA 4FP4A 2E8WA 3VJAA 5ILJA 3G4DA 4KVYA 1RQJA 5DIQF 1DI1A 5DJRF 2J1PA 2PS4A 2AZJA 3P41A 3SDUA 2F8CF 3LGZB 3N0FA 4KKMA 3CP6A 2VF6A 3NF2A 2PS7A 4LPHF 4KVWA 5IL8A 2Q58A 3SDTA 2E93A 3DYHA 3LZ9A 3ICZA 5HN7A 2QISA 5B0MA 3WCGA 3N1VF 2AETA 4LA6A 5I1UA 4JXYA 4LTVA 3M01A 5AELA 1YHLA 1UBVA 2PS5A 4EA0A 5EASA 1YYTA 4Q23A 2E92A 3PH7A 1N22A 5EATA 5C05A 4KPDA 3IBAA 3UCAA 2OGDA 2ONGA 3NPRA 2E95A 4KUXA 4DI5A 4MC3A 3KRCB 4F62A 3M9UA 1N1BA 3P8LA 2OPMA 3MZVA 3AE0A 4OGUA 5DGSF 3AQBB 2OA6A 3KRFB 4RXCA 3TFPA 4LPGF 3WCHA 3KRCA 5EAUA 3KRPB 5JV2F 1N1ZA 3N49F 5E8KA 3RYEA 1V4KA 5IMIA 1RQIA 4KWDA 5KSXF 3WE9A 3QKCA 3OACB 5DHKA 5B01A 2FTZA 3PYAA 1HM7A 3SDVA 2E94A 3W7FA 3G4FA 3VJ8A 3WCAA 3LG5A 5IM1A 4NKFA 3EZ3A 3Q30A 5ER8A 3WCBA 1N20A 1WY0A 4KQUA 2Z4VA 4LUUA 4E9ZA 3TFNA 4MC0A 2RAHA 3LSNA 4E1EA 4LLSA 2E8VA 1YYSA 3BNXA 3MAVA 3OABA 5B03A 3N1WF 1WMWA 2J1OA 3TC1A 3OYRA 4K10A 3V1VA 2E4OA 4JZBA 4P0VA 5ILYA 5B02A 4KK2A 4RNQA 1UBXA 4NUAA 3ADZA 2I19A 4LZ3A 4HD1A 2Z52A 1V4HA 2ZCQA 3P5RA 4EA1A 1YYRA 5JA0F 5ILZA 4KQSA 3WCFA 4JXNA 5DW7A 3V1XA 4H5CF 4KPJA 2ONHA 3WJKA 2ZY1A 2E90A 3VJDA 3WEFA 4MC8A 1V4EA 2Q9YA 3Q1OA 3RMGA 2Z4WA 5DGMF 3APZA 1UBWA 4LXWA 1VG2A 5IMPA 3WEIA 1KIYA 1HXGA 5H9DA 3WSBA 5DZ2A 5B0IA 3TFVA 4DWGA 5JUZF 2F92F 4RYPA 5IVGA 2F9KF 3ASXA 2Q80A 1JFAA 3M0GA 3N46F 4OKZA 3LGKA 3N5HF 4LLTA 3WJOA 3M02A 4DEMF 2ZCSA 1EZFA 1VG7A 1YV5A 2FORA 3ACXA 4NKEA 5JV1F 1YYQA 4JYXA 3KBKA 5JV0F 1KIZA 3N45F 3V66A 4H5EF 3ZMCA 3P5PA 3AQCB 5E8HA 2ZCOA 4KFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HN9 A;  4OMH A;  3ACY A;  3WC9 A;  4DXJ A;  3PYB A;  3VJB A;  2EWG A;  3LDW A;  1YQ7 A;  3IPI A;  3RBM A;  1V4I A;  4RXE A;  5ERM A;  5IN8 A;  4N9U A;  1WL1 A;  3SAE A;  3Q2Z A;  1FPS A;  5ERN A;  3RYW A;  3DYG A;  4GP2 A;  5A0I A;  4GAX A;  4QXS F;  3WCM A;  3WCD A;  3ZOU A;  1WL2 A;  5DGN F;  4L2X F;  3WCL A;  3ICM A;  4P0W A;  3KB9 A;  3WEH A;  1WL3 A;  3KRO A;  3OAB B;  3WCI A;  2AZK A;  2F89 F;  4NFK F;  2E8T A;  3SDQ A;  2Z7H A;  3LJI A;  2AEL A;  5ILK A;  3WSA A;  5IK0 A;  2ZEV A;  3WEK A;  4XQS F;  2AZL A;  5AYP A;  3KRA A;  5IKH A;  3VJE A;  3PKO A;  3N5J F;  4UMJ A;  4XQT F;  1HXC A;  1HX9 A;  2ZEU A;  2DH4 A;  2O1O A;  4LA5 A;  3S9V A;  3VJ9 A;  4F6V A;  5A0K A;  4KVD A;  4NFI F;  3ID0 A;  4LFE A;  4H5D F;  4PVY F;  5CG6 A;  3P8R A;  3ZL6 A;  5IK6 A;  1YYU A;  3NRI A;  2Z4Z A;  3VJC A;  5IKA A;  5ILH A;  1YJ4 A;  3ZCD A;  3BNY A;  3ACW A;  1N24 A;  3TS7 A;  1N23 A;  3AQ0 A;  1VG4 A;  3CKE A;  5E8L A;  3ICN A;  1HXA A;  5AHU B;  3DYF A;  1HM4 A;  2H8O A;  4LFG A;  2OPN A;  5DJP F;  3PDE A;  3WCE A;  3N6K F;  4NG6 A;  3EGT A;  4DZW A;  3S4J A;  5A0J A;  2J5C A;  5AFX A;  3QQV A;  2P1C A;  2F8Z F;  4RXA A;  4E9U A;  4F6X A;  2F94 F;  4OKM A;  4DHD A;  5B00 A;  4GP1 A;  4XQR F;  1V4J A;  5ERO A;  5DHI A;  2F7M F;  1VG6 A;  3WCC A;  4ZQ8 A;  4NFJ F;  1RTR A;  3ZMB A;  3N3D A;  4PVX F;  5B0J A;  1JFG A;  3WEJ A;  4P0X A;  2PS6 A;  3EFQ A;  4LZC A;  3KRO B;  4DWB A;  5CG5 A;  4EA2 A;  3KRF A;  2Q9Z A;  4LZ0 A;  3LK5 A;  3KRP A;  1DGP A;  2E91 A;  5DJV F;  2Z50 A;  2AEK A;  3WEG A;  3LOM A;  4QPF A;  4LTZ A;  3KRA B;  5HN8 A;  4FJQ A;  3Q2Q A;  3OAC A;  3WCJ A;  1VG3 A;  5IK9 A;  2ZCR A;  4JZX A;  3LLW A;  4GA3 A;  2Z78 A;  3LMD A;  3NPK A;  5HNA A;  3SDR A;  3B7L A;  4KVI A;  3N0G A;  2Z7I A;  4LFV F;  4LIX A;  4OMG A;  3M00 A;  3WJN A;  5ILD A;  4KQ5 A;  1UBY A;  5B0L A;  5ILI A;  5B0K A;  3ICK A;  3CC9 A;  1N21 A;  2Z4Y A;  3LVS A;  5IMN A;  2Z4X A;  1YHK A;  1WKZ A;  3LEE A;  1ZW5 A;  5IL3 A;  2E8U A;  1YHM A;  2PS8 A;  4WK5 A;  1PS1 A;  4JVJ F;  4RXD A;  4N1Z F;  2E8X A;  1WL0 A;  3N3L F;  4LOB A;  4FP4 A;  2E8W A;  3VJA A;  5ILJ A;  3G4D A;  4KVY A;  1RQJ A;  5DIQ F;  1DI1 A;  5DJR F;  2J1P A;  2PS4 A;  2AZJ A;  3P41 A;  3SDU A;  2F8C F;  3LGZ B;  3N0F A;  4KKM A;  3CP6 A;  2VF6 A;  3NF2 A;  2PS7 A;  4LPH F;  4KVW A;  5IL8 A;  2Q58 A;  3SDT A;  2E93 A;  3DYH A;  3LZ9 A;  3ICZ A;  5HN7 A;  2QIS A;  5B0M A;  3WCG A;  3N1V F;  2AET A;  4LA6 A;  5I1U A;  4JXY A;  4LTV A;  3M01 A;  5AEL A;  1YHL A;  1UBV A;  2PS5 A;  4EA0 A;  5EAS A;  1YYT A;  4Q23 A;  2E92 A;  3PH7 A;  1N22 A;  5EAT A;  5C05 A;  4KPD A;  3IBA A;  3UCA A;  2OGD A;  2ONG A;  3NPR A;  2E95 A;  4KUX A;  4DI5 A;  4MC3 A;  3KRC B;  4F62 A;  3M9U A;  1N1B A;  3P8L A;  2OPM A;  3MZV A;  3AE0 A;  4OGU A;  5DGS F;  3AQB B;  2OA6 A;  3KRF B;  4RXC A;  3TFP A;  4LPG F;  3WCH A;  3KRC A;  5EAU A;  3KRP B;  5JV2 F;  1N1Z A;  3N49 F;  5E8K A;  3RYE A;  1V4K A;  5IMI A;  1RQI A;  4KWD A;  5KSX F;  3WE9 A;  3QKC A;  3OAC B;  5DHK A;  5B01 A;  2FTZ A;  3PYA A;  1HM7 A;  3SDV A;  2E94 A;  3W7F A;  3G4F A;  3VJ8 A;  3WCA A;  3LG5 A;  5IM1 A;  4NKF A;  3EZ3 A;  3Q30 A;  5ER8 A;  3WCB A;  1N20 A;  1WY0 A;  4KQU A;  2Z4V A;  4LUU A;  4E9Z A;  3TFN A;  4MC0 A;  2RAH A;  3LSN A;  4E1E A;  4LLS A;  2E8V A;  1YYS A;  3BNX A;  3MAV A;  3OAB A;  5B03 A;  3N1W F;  1WMW A;  2J1O A;  3TC1 A;  3OYR A;  4K10 A;  3V1V A;  2E4O A;  4JZB A;  4P0V A;  5ILY A;  5B02 A;  4KK2 A;  4RNQ A;  1UBX A;  4NUA A;  3ADZ A;  2I19 A;  4LZ3 A;  4HD1 A;  2Z52 A;  1V4H A;  2ZCQ A;  3P5R A;  4EA1 A;  1YYR A;  5JA0 F;  5ILZ A;  4KQS A;  3WCF A;  4JXN A;  5DW7 A;  3V1X A;  4H5C F;  4KPJ A;  2ONH A;  3WJK A;  2ZY1 A;  2E90 A;  3VJD A;  3WEF A;  4MC8 A;  1V4E A;  2Q9Y A;  3Q1O A;  3RMG A;  2Z4W A;  5DGM F;  3APZ A;  1UBW A;  4LXW A;  1VG2 A;  5IMP A;  3WEI A;  1KIY A;  1HXG A;  5H9D A;  3WSB A;  5DZ2 A;  5B0I A;  3TFV A;  4DWG A;  5JUZ F;  2F92 F;  4RYP A;  5IVG A;  2F9K F;  3ASX A;  2Q80 A;  1JFA A;  3M0G A;  3N46 F;  4OKZ A;  3LGK A;  3N5H F;  4LLT A;  3WJO A;  3M02 A;  4DEM F;  2ZCS A;  1EZF A;  1VG7 A;  1YV5 A;  2FOR A;  3ACX A;  4NKE A;  5JV1 F;  1YYQ A;  4JYX A;  3KBK A;  5JV0 F;  1KIZ A;  3N45 F;  3V66 A;  4H5E F;  3ZMC A;  3P5P A;  3AQC B;  5E8H A;  2ZCO A;  4KFA A; 
#chains in the Genus database with same CATH topology
 5HN9 A;  4OMH A;  3ACY A;  3WC9 A;  4DXJ A;  3PYB A;  3VJB A;  2EWG A;  3LDW A;  1YQ7 A;  3IPI A;  3RBM A;  1V4I A;  4RXE A;  5ERM A;  5IN8 A;  4N9U A;  1WL1 A;  3SAE A;  3Q2Z A;  1FPS A;  5ERN A;  3RYW A;  3DYG A;  4GP2 A;  5A0I A;  4GAX A;  4QXS F;  3WCM A;  3WCD A;  3ZOU A;  1WL2 A;  5DGN F;  4L2X F;  3WCL A;  3ICM A;  4P0W A;  3KB9 A;  3WEH A;  1WL3 A;  3KRO A;  3OAB B;  3WCI A;  2AZK A;  2F89 F;  4NFK F;  2E8T A;  3SDQ A;  2Z7H A;  3LJI A;  2AEL A;  5ILK A;  3WSA A;  5IK0 A;  2ZEV A;  3WEK A;  4XQS F;  2AZL A;  5AYP A;  3KRA A;  5IKH A;  3VJE A;  3PKO A;  3N5J F;  4UMJ A;  4XQT F;  1HXC A;  1HX9 A;  2ZEU A;  2DH4 A;  2O1O A;  4LA5 A;  3S9V A;  3VJ9 A;  4F6V A;  5A0K A;  4KVD A;  4NFI F;  3ID0 A;  4LFE A;  4H5D F;  4PVY F;  5CG6 A;  3P8R A;  3ZL6 A;  5IK6 A;  1YYU A;  3NRI A;  2Z4Z A;  3VJC A;  5IKA A;  5ILH A;  1YJ4 A;  3ZCD A;  3BNY A;  3ACW A;  1N24 A;  3TS7 A;  1N23 A;  3AQ0 A;  1VG4 A;  3CKE A;  5E8L A;  3ICN A;  1HXA A;  5AHU B;  3DYF A;  1HM4 A;  2H8O A;  4LFG A;  2OPN A;  5DJP F;  3PDE A;  3WCE A;  3N6K F;  4NG6 A;  3EGT A;  4DZW A;  3S4J A;  5A0J A;  2J5C A;  5AFX A;  3QQV A;  2P1C A;  2F8Z F;  4RXA A;  4E9U A;  4F6X A;  2F94 F;  4OKM A;  4DHD A;  5B00 A;  4GP1 A;  4XQR F;  1V4J A;  5ERO A;  5DHI A;  2F7M F;  1VG6 A;  3WCC A;  4ZQ8 A;  4NFJ F;  1RTR A;  3ZMB A;  3N3D A;  4PVX F;  5B0J A;  1JFG A;  3WEJ A;  4P0X A;  2PS6 A;  3EFQ A;  4LZC A;  3KRO B;  4DWB A;  5CG5 A;  4EA2 A;  3KRF A;  2Q9Z A;  4LZ0 A;  3LK5 A;  3KRP A;  1DGP A;  2E91 A;  5DJV F;  2Z50 A;  2AEK A;  3WEG A;  3LOM A;  4QPF A;  4LTZ A;  3KRA B;  5HN8 A;  4FJQ A;  3Q2Q A;  3OAC A;  3WCJ A;  1VG3 A;  5IK9 A;  2ZCR A;  4JZX A;  3LLW A;  4GA3 A;  2Z78 A;  3LMD A;  3NPK A;  5HNA A;  3SDR A;  3B7L A;  4KVI A;  3N0G A;  2Z7I A;  4LFV F;  4LIX A;  4OMG A;  3M00 A;  3WJN A;  5ILD A;  4KQ5 A;  1UBY A;  5B0L A;  5ILI A;  5B0K A;  3ICK A;  3CC9 A;  1N21 A;  2Z4Y A;  3LVS A;  5IMN A;  2Z4X A;  1YHK A;  1WKZ A;  3LEE A;  1ZW5 A;  5IL3 A;  2E8U A;  1YHM A;  2PS8 A;  4WK5 A;  1PS1 A;  4JVJ F;  4RXD A;  4N1Z F;  2E8X A;  1WL0 A;  3N3L F;  4LOB A;  4FP4 A;  2E8W A;  3VJA A;  5ILJ A;  3G4D A;  4KVY A;  1RQJ A;  5DIQ F;  1DI1 A;  5DJR F;  2J1P A;  2PS4 A;  2AZJ A;  3P41 A;  3SDU A;  2F8C F;  3LGZ B;  3N0F A;  4KKM A;  3CP6 A;  2VF6 A;  3NF2 A;  2PS7 A;  4LPH F;  4KVW A;  5IL8 A;  2Q58 A;  3SDT A;  2E93 A;  3DYH A;  3LZ9 A;  3ICZ A;  5HN7 A;  2QIS A;  5B0M A;  3WCG A;  3N1V F;  2AET A;  4LA6 A;  5I1U A;  4JXY A;  4LTV A;  3M01 A;  5AEL A;  1YHL A;  1UBV A;  2PS5 A;  4EA0 A;  5EAS A;  1YYT A;  4Q23 A;  2E92 A;  3PH7 A;  1N22 A;  5EAT A;  5C05 A;  4KPD A;  3IBA A;  3UCA A;  2OGD A;  2ONG A;  3NPR A;  2E95 A;  4KUX A;  4DI5 A;  4MC3 A;  3KRC B;  4F62 A;  3M9U A;  1N1B A;  3P8L A;  2OPM A;  3MZV A;  3AE0 A;  4OGU A;  5DGS F;  3AQB B;  2OA6 A;  3KRF B;  4RXC A;  3TFP A;  4LPG F;  3WCH A;  3KRC A;  5EAU A;  3KRP B;  5JV2 F;  1N1Z A;  3N49 F;  5E8K A;  3RYE A;  1V4K A;  5IMI A;  1RQI A;  4KWD A;  5KSX F;  3WE9 A;  3QKC A;  3OAC B;  5DHK A;  5B01 A;  2FTZ A;  3PYA A;  1HM7 A;  3SDV A;  2E94 A;  3W7F A;  3G4F A;  3VJ8 A;  3WCA A;  3LG5 A;  5IM1 A;  4NKF A;  3EZ3 A;  3Q30 A;  5ER8 A;  3WCB A;  1N20 A;  1WY0 A;  4KQU A;  2Z4V A;  4LUU A;  4E9Z A;  3TFN A;  4MC0 A;  2RAH A;  3LSN A;  4E1E A;  4LLS A;  2E8V A;  1YYS A;  3BNX A;  3MAV A;  3OAB A;  5B03 A;  3N1W F;  1WMW A;  2J1O A;  3TC1 A;  3OYR A;  4K10 A;  3V1V A;  2E4O A;  4JZB A;  4P0V A;  5ILY A;  5B02 A;  4KK2 A;  4RNQ A;  1UBX A;  4NUA A;  3ADZ A;  2I19 A;  4LZ3 A;  4HD1 A;  2Z52 A;  1V4H A;  2ZCQ A;  3P5R A;  4EA1 A;  1YYR A;  5JA0 F;  5ILZ A;  4KQS A;  3WCF A;  4JXN A;  5DW7 A;  3V1X A;  4H5C F;  4KPJ A;  2ONH A;  3WJK A;  2ZY1 A;  2E90 A;  3VJD A;  3WEF A;  4MC8 A;  1V4E A;  2Q9Y A;  3Q1O A;  3RMG A;  2Z4W A;  5DGM F;  3APZ A;  1UBW A;  4LXW A;  1VG2 A;  5IMP A;  3WEI A;  1KIY A;  1HXG A;  5H9D A;  3WSB A;  5DZ2 A;  5B0I A;  3TFV A;  4DWG A;  5JUZ F;  2F92 F;  4RYP A;  5IVG A;  2F9K F;  3ASX A;  2Q80 A;  1JFA A;  3M0G A;  3N46 F;  4OKZ A;  3LGK A;  3N5H F;  4LLT A;  3WJO A;  3M02 A;  4DEM F;  2ZCS A;  1EZF A;  1VG7 A;  1YV5 A;  2FOR A;  3ACX A;  4NKE A;  5JV1 F;  1YYQ A;  4JYX A;  3KBK A;  5JV0 F;  1KIZ A;  3N45 F;  3V66 A;  4H5E F;  3ZMC A;  3P5P A;  3AQC B;  5E8H A;  2ZCO A;  4KFA A; 
#chains in the Genus database with same CATH homology
 5HN9 A;  4OMH A;  3ACY A;  3WC9 A;  4DXJ A;  3PYB A;  3VJB A;  2EWG A;  3LDW A;  1YQ7 A;  3IPI A;  3RBM A;  1V4I A;  4RXE A;  5ERM A;  5IN8 A;  4N9U A;  1WL1 A;  3SAE A;  3Q2Z A;  1FPS A;  5ERN A;  3RYW A;  3DYG A;  4GP2 A;  5A0I A;  4GAX A;  4QXS F;  3WCM A;  3WCD A;  3ZOU A;  1WL2 A;  5DGN F;  4L2X F;  3WCL A;  3ICM A;  4P0W A;  3KB9 A;  3WEH A;  1WL3 A;  3KRO A;  3OAB B;  3WCI A;  2AZK A;  2F89 F;  4NFK F;  2E8T A;  3SDQ A;  2Z7H A;  3LJI A;  2AEL A;  5ILK A;  3WSA A;  5IK0 A;  2ZEV A;  3WEK A;  4XQS F;  2AZL A;  5AYP A;  3KRA A;  5IKH A;  3VJE A;  3PKO A;  3N5J F;  4UMJ A;  4XQT F;  1HXC A;  1HX9 A;  2ZEU A;  2DH4 A;  2O1O A;  4LA5 A;  3S9V A;  3VJ9 A;  4F6V A;  5A0K A;  4KVD A;  4NFI F;  3ID0 A;  4LFE A;  4H5D F;  4PVY F;  5CG6 A;  3P8R A;  3ZL6 A;  5IK6 A;  1YYU A;  3NRI A;  2Z4Z A;  3VJC A;  5IKA A;  5ILH A;  1YJ4 A;  3ZCD A;  3BNY A;  3ACW A;  1N24 A;  3TS7 A;  1N23 A;  3AQ0 A;  1VG4 A;  3CKE A;  5E8L A;  3ICN A;  1HXA A;  5AHU B;  3DYF A;  1HM4 A;  2H8O A;  4LFG A;  2OPN A;  5DJP F;  3PDE A;  3WCE A;  3N6K F;  4NG6 A;  3EGT A;  4DZW A;  3S4J A;  5A0J A;  2J5C A;  5AFX A;  3QQV A;  2P1C A;  2F8Z F;  4RXA A;  4E9U A;  4F6X A;  2F94 F;  4OKM A;  4DHD A;  5B00 A;  4GP1 A;  4XQR F;  1V4J A;  5ERO A;  5DHI A;  2F7M F;  1VG6 A;  3WCC A;  4ZQ8 A;  4NFJ F;  1RTR A;  3ZMB A;  3N3D A;  4PVX F;  5B0J A;  1JFG A;  3WEJ A;  4P0X A;  2PS6 A;  3EFQ A;  4LZC A;  3KRO B;  4DWB A;  5CG5 A;  4EA2 A;  3KRF A;  2Q9Z A;  4LZ0 A;  3LK5 A;  3KRP A;  1DGP A;  2E91 A;  5DJV F;  2Z50 A;  2AEK A;  3WEG A;  3LOM A;  4QPF A;  4LTZ A;  3KRA B;  5HN8 A;  4FJQ A;  3Q2Q A;  3OAC A;  3WCJ A;  1VG3 A;  5IK9 A;  2ZCR A;  4JZX A;  3LLW A;  4GA3 A;  2Z78 A;  3LMD A;  3NPK A;  5HNA A;  3SDR A;  3B7L A;  4KVI A;  3N0G A;  2Z7I A;  4LFV F;  4LIX A;  4OMG A;  3M00 A;  3WJN A;  5ILD A;  4KQ5 A;  1UBY A;  5B0L A;  5ILI A;  5B0K A;  3ICK A;  3CC9 A;  1N21 A;  2Z4Y A;  3LVS A;  5IMN A;  2Z4X A;  1YHK A;  1WKZ A;  3LEE A;  1ZW5 A;  5IL3 A;  2E8U A;  1YHM A;  2PS8 A;  4WK5 A;  1PS1 A;  4JVJ F;  4RXD A;  4N1Z F;  2E8X A;  1WL0 A;  3N3L F;  4LOB A;  4FP4 A;  2E8W A;  3VJA A;  5ILJ A;  3G4D A;  4KVY A;  1RQJ A;  5DIQ F;  1DI1 A;  5DJR F;  2J1P A;  2PS4 A;  2AZJ A;  3P41 A;  3SDU A;  2F8C F;  3LGZ B;  3N0F A;  4KKM A;  3CP6 A;  2VF6 A;  3NF2 A;  2PS7 A;  4LPH F;  4KVW A;  5IL8 A;  2Q58 A;  3SDT A;  2E93 A;  3DYH A;  3LZ9 A;  3ICZ A;  5HN7 A;  2QIS A;  5B0M A;  3WCG A;  3N1V F;  2AET A;  4LA6 A;  5I1U A;  4JXY A;  4LTV A;  3M01 A;  5AEL A;  1YHL A;  1UBV A;  2PS5 A;  4EA0 A;  5EAS A;  1YYT A;  4Q23 A;  2E92 A;  3PH7 A;  1N22 A;  5EAT A;  5C05 A;  4KPD A;  3IBA A;  3UCA A;  2OGD A;  2ONG A;  3NPR A;  2E95 A;  4KUX A;  4DI5 A;  4MC3 A;  3KRC B;  4F62 A;  3M9U A;  1N1B A;  3P8L A;  2OPM A;  3MZV A;  3AE0 A;  4OGU A;  5DGS F;  3AQB B;  2OA6 A;  3KRF B;  4RXC A;  3TFP A;  4LPG F;  3WCH A;  3KRC A;  5EAU A;  3KRP B;  5JV2 F;  1N1Z A;  3N49 F;  5E8K A;  3RYE A;  1V4K A;  5IMI A;  1RQI A;  4KWD A;  5KSX F;  3WE9 A;  3QKC A;  3OAC B;  5DHK A;  5B01 A;  2FTZ A;  3PYA A;  1HM7 A;  3SDV A;  2E94 A;  3W7F A;  3G4F A;  3VJ8 A;  3WCA A;  3LG5 A;  5IM1 A;  4NKF A;  3EZ3 A;  3Q30 A;  5ER8 A;  3WCB A;  1N20 A;  1WY0 A;  4KQU A;  2Z4V A;  4LUU A;  4E9Z A;  3TFN A;  4MC0 A;  2RAH A;  3LSN A;  4E1E A;  4LLS A;  2E8V A;  1YYS A;  3BNX A;  3MAV A;  3OAB A;  5B03 A;  3N1W F;  1WMW A;  2J1O A;  3TC1 A;  3OYR A;  4K10 A;  3V1V A;  2E4O A;  4JZB A;  4P0V A;  5ILY A;  5B02 A;  4KK2 A;  4RNQ A;  1UBX A;  4NUA A;  3ADZ A;  2I19 A;  4LZ3 A;  4HD1 A;  2Z52 A;  1V4H A;  2ZCQ A;  3P5R A;  4EA1 A;  1YYR A;  5JA0 F;  5ILZ A;  4KQS A;  3WCF A;  4JXN A;  5DW7 A;  3V1X A;  4H5C F;  4KPJ A;  2ONH A;  3WJK A;  2ZY1 A;  2E90 A;  3VJD A;  3WEF A;  4MC8 A;  1V4E A;  2Q9Y A;  3Q1O A;  3RMG A;  2Z4W A;  5DGM F;  3APZ A;  1UBW A;  4LXW A;  1VG2 A;  5IMP A;  3WEI A;  1KIY A;  1HXG A;  5H9D A;  3WSB A;  5DZ2 A;  5B0I A;  3TFV A;  4DWG A;  5JUZ F;  2F92 F;  4RYP A;  5IVG A;  2F9K F;  3ASX A;  2Q80 A;  1JFA A;  3M0G A;  3N46 F;  4OKZ A;  3LGK A;  3N5H F;  4LLT A;  3WJO A;  3M02 A;  4DEM F;  2ZCS A;  1EZF A;  1VG7 A;  1YV5 A;  2FOR A;  3ACX A;  4NKE A;  5JV1 F;  1YYQ A;  4JYX A;  3KBK A;  5JV0 F;  1KIZ A;  3N45 F;  3V66 A;  4H5E F;  3ZMC A;  3P5P A;  3AQC B;  5E8H A;  2ZCO A;  4KFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...