4EA2A

Crystal structure of dehydrosqualene synthase (crtm) aureus complexed with sq-109
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
284
structure length
281
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
total genus 115
structure length 281
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4ea2A00
3M02A 3Q1OA 5DIQF 5I1UA 2ZCRA 3KBKA 2PS5A 3CC9A 3TC1A 2EWGA 1V4EA 5ILIA 5IL3A 1YYRA 2Q58A 3LOMA 4KQ5A 3VJDA 5ILKA 4P0VA 3NPRA 4RXEA 2PS4A 3M01A 4KVDA 4F62A 3AE0A 3NF2A 3LLWA 2Z78A 3NRIA 3WEHA 3WEKA 3SAEA 2E4OA 1UBYA 2ZEUA 4KVWA 2E8UA 2Z7IA 4N9UA 4XQRF 3ACYA 4LFVF 3WEFA 1N20A 4KKMA 1WY0A 4H5DF 1UBWA 3CKEA 3WEJA 2ZEVA 2ZY1A 5JV1F 1KIYA 3M0GA 3VJ8A 2E95A 3V1XA 3N49F 3S4JA 4WK5A 3N6KF 4DZWA 5DHKA 1VG6A 2VF6A 1N21A 3WJNA 5DGNF 1N24A 4DXJA 4KQUA 2F7MF 1RQJA 3N5HF 4LUUA 5CG5A 2F8CF 3KROB 4LA5A 3LG5A 3N1WF 2PS7A 3WEGA 2Z52A 2FTZA 2F9KF 4LFGA 3AQCB 2ONGA 2QISA 4H5EF 3ZCDA 4JZXA 3WCAA 4ZQ8A 3ZMBA 4NUAA 3WCCA 4GA3A 4NFJF 4MC3A 3V66A 4KK2A 1PS1A 3KROA 4DI5A 2O1OA 3V1VA 1YYSA 4NKFA 5HN7A 3VJ9A 5IK0A 3LEEA 4EA2A 4GAXA 3LGKA 3N46F 2J1OA 5JV2F 4L2XF 3N5JF 4LLTA 5E8KA 5ILHA 4QXSF 2RAHA 1YYTA 3WJOA 3BNYA 1V4JA 5IN8A 2FORA 4LZCA 4DHDA 3MZVA 2PS8A 3QKCA 5JUZF 4F6VA 4LFEA 3WCGA 2E90A 3LJIA 4KQSA 1VG3A 4RXDA 5IKAA 5B0LA 4LA6A 5A0KA 5B01A 1HXCA 5JA0F 3WCIA 3P5PA 4OMGA 4LTZA 3ICKA 2E91A 4FJQA 3WEIA 1YJ4A 5CG6A 3WSAA 3ASXA 3Q2QA 1JFGA 3WCJA 1YYUA 3WJKA 4F6XA 4E1EA 3WC9A 1HM4A 3RBMA 1WMWA 5HN8A 3S9VA 4H5CF 3M9UA 2P1CA 3KB9A 3VJBA 5AELA 5HNAA 5ILDA 4UMJA 3EFQA 1FPSA 2E92A 5H9DA 5IMNA 2AEKA 3LZ9A 2F8ZF 4KFAA 1HXGA 3IPIA 3PKOA 3OACB 3ZMCA 5IK9A 3P5RA 3P41A 3SDQA 4LXWA 3ZL6A 3P8RA 1V4KA 2I19A 5DW7A 3TFNA 5ILYA 5JV0F 3RMGA 3AQ0A 4JYXA 3OYRA 2ZCSA 4OGUA 3OACA 4KWDA 1N22A 3ICZA 3DYFA 5IK6A 5KSXF 3UCAA 4RXCA 3N45F 2H8OA 4HD1A 3PYAA 4GP2A 3EZ3A 4XQSF 3KRAB 2Z4WA 3APZA 2ONHA 1ZW5A 3LK5A 5DJVF 1N1ZA 5E8HA 4NFKF 4LPGF 3ADZA 1RQIA 4E9UA 4PVYF 2E8TA 3TFPA 4KVYA 3LVSA 4KPJA 3SDVA 3WCHA 4P0XA 4P0WA 3KRAA 3SDTA 4GP1A 5A0IA 2Z4YA 4EA1A 4JVJF 4JXNA 2Q9YA 4JZBA 4MC0A 1YV5A 5AHUB 1VG4A 2Z50A 3WCMA 5IVGA 1YYQA 3W7FA 3ICMA 2AETA 3KRFB 3P8LA 3N3DA 5AFXA 1N1BA 5A0JA 4DEMF 1VG2A 4OMHA 3LMDA 3PDEA 5AYPA 4JXYA 3M00A 3VJEA 3WE9A 4NG6A 5ILZA 4K10A 5ER8A 2OGDA 3KRFA 1HX9A 1YHMA 3LDWA 3EGTA 3RYEA 5ERNA 5IMPA 3WSBA 5HN9A 3IBAA 2Q80A 2PS6A 2Z4VA 3QQVA 1KIZA 2E8WA 2E8VA 5B02A 3PH7A 1EZFA 3PYBA 3TFVA 3N0FA 1RTRA 1UBVA 5IL8A 2DH4A 3B7LA 3TS7A 4DWBA 5B0IA 4Q23A 3MAVA 5DZ2A 3WCFA 2Q9ZA 4LZ0A 1YHKA 3KRPB 4RYPA 5ERMA 2OPNA 3ACXA 4NKEA 5DJPF 4KVIA 5DJRF 4LPHF 1V4HA 4DWGA 4LOBA 4NFIF 4PVXF 5IMIA 5DGSF 2ZCOA 3VJCA 5B03A 1JFAA 2J1PA 5B00A 5C05A 2ZCQA 4OKZA 5EASA 1DGPA 3N1VF 3LSNA 4OKMA 3KRPA 5ILJA 3DYHA 3Q30A 3ACWA 4LZ3A 3ZOUA 2AZLA 5DGMF 1WKZA 3BNXA 5B0MA 2E8XA 4RNQA 4E9ZA 1WL0A 4MC8A 3WCDA 1DI1A 1WL3A 1WL1A 3SDUA 5IKHA 3SDRA 4XQTF 2Z4ZA 3ID0A 1VG7A 5EROA 1YHLA 3WCEA 5E8LA 2E93A 3Q2ZA 3NPKA 5IM1A 4RXAA 3ICNA 3OABB 2Z4XA 2OPMA 3KRCB 2AELA 4N1ZF 1V4IA 5EATA 1N23A 4EA0A 1HXAA 4KUXA 3N0GA 5EAUA 1UBXA 1HM7A 2F89F 3G4FA 4FP4A 4LLSA 3WCBA 2F92F 4QPFA 3OABA 2AZJA 3KRCA 3WCLA 5B0JA 4LTVA 2F94F 2AZKA 5B0KA 2OA6A 3G4DA 1WL2A 4LIXA 2E94A 2J5CA 1YQ7A 3CP6A 3DYGA 3VJAA 3RYWA 3AQBB 3LGZB 2Z7HA 5DHIA 4KPDA 3N3LF
chains in the Genus database with same CATH superfamily
3M02A 3Q1OA 5DIQF 5I1UA 2ZCRA 3KBKA 2PS5A 3CC9A 3TC1A 2EWGA 1V4EA 5ILIA 5IL3A 1YYRA 2Q58A 3LOMA 4KQ5A 3VJDA 5ILKA 4P0VA 3NPRA 4RXEA 2PS4A 3M01A 4KVDA 4F62A 3AE0A 3NF2A 3LLWA 2Z78A 3NRIA 3WEHA 3WEKA 3SAEA 2E4OA 1UBYA 2ZEUA 4KVWA 2E8UA 2Z7IA 4N9UA 4XQRF 3ACYA 4LFVF 3WEFA 1N20A 4KKMA 1WY0A 4H5DF 1UBWA 3CKEA 3WEJA 2ZEVA 2ZY1A 5JV1F 1KIYA 3M0GA 3VJ8A 2E95A 3V1XA 3N49F 3S4JA 4WK5A 3N6KF 4DZWA 5DHKA 1VG6A 2VF6A 1N21A 3WJNA 5DGNF 1N24A 4DXJA 4KQUA 2F7MF 1RQJA 3N5HF 4LUUA 5CG5A 2F8CF 3KROB 4LA5A 3LG5A 3N1WF 2PS7A 3WEGA 2Z52A 2FTZA 2F9KF 4LFGA 3AQCB 2ONGA 2QISA 4H5EF 3ZCDA 4JZXA 3WCAA 4ZQ8A 3ZMBA 4NUAA 3WCCA 4GA3A 4NFJF 4MC3A 3V66A 4KK2A 1PS1A 3KROA 4DI5A 2O1OA 3V1VA 1YYSA 4NKFA 5HN7A 3VJ9A 5IK0A 3LEEA 4EA2A 4GAXA 3LGKA 3N46F 2J1OA 5JV2F 4L2XF 3N5JF 4LLTA 5E8KA 5ILHA 4QXSF 2RAHA 1YYTA 3WJOA 3BNYA 1V4JA 5IN8A 2FORA 4LZCA 4DHDA 3MZVA 2PS8A 3QKCA 5JUZF 4F6VA 4LFEA 3WCGA 2E90A 3LJIA 4KQSA 1VG3A 4RXDA 5IKAA 5B0LA 4LA6A 5A0KA 5B01A 1HXCA 5JA0F 3WCIA 3P5PA 4OMGA 4LTZA 3ICKA 2E91A 4FJQA 3WEIA 1YJ4A 5CG6A 3WSAA 3ASXA 3Q2QA 1JFGA 3WCJA 1YYUA 3WJKA 4F6XA 4E1EA 3WC9A 1HM4A 3RBMA 1WMWA 5HN8A 3S9VA 4H5CF 3M9UA 2P1CA 3KB9A 3VJBA 5AELA 5HNAA 5ILDA 4UMJA 3EFQA 1FPSA 2E92A 5H9DA 5IMNA 2AEKA 3LZ9A 2F8ZF 4KFAA 1HXGA 3IPIA 3PKOA 3OACB 3ZMCA 5IK9A 3P5RA 3P41A 3SDQA 4LXWA 3ZL6A 3P8RA 1V4KA 2I19A 5DW7A 3TFNA 5ILYA 5JV0F 3RMGA 3AQ0A 4JYXA 3OYRA 2ZCSA 4OGUA 3OACA 4KWDA 1N22A 3ICZA 3DYFA 5IK6A 5KSXF 3UCAA 4RXCA 3N45F 2H8OA 4HD1A 3PYAA 4GP2A 3EZ3A 4XQSF 3KRAB 2Z4WA 3APZA 2ONHA 1ZW5A 3LK5A 5DJVF 1N1ZA 5E8HA 4NFKF 4LPGF 3ADZA 1RQIA 4E9UA 4PVYF 2E8TA 3TFPA 4KVYA 3LVSA 4KPJA 3SDVA 3WCHA 4P0XA 4P0WA 3KRAA 3SDTA 4GP1A 5A0IA 2Z4YA 4EA1A 4JVJF 4JXNA 2Q9YA 4JZBA 4MC0A 1YV5A 5AHUB 1VG4A 2Z50A 3WCMA 5IVGA 1YYQA 3W7FA 3ICMA 2AETA 3KRFB 3P8LA 3N3DA 5AFXA 1N1BA 5A0JA 4DEMF 1VG2A 4OMHA 3LMDA 3PDEA 5AYPA 4JXYA 3M00A 3VJEA 3WE9A 4NG6A 5ILZA 4K10A 5ER8A 2OGDA 3KRFA 1HX9A 1YHMA 3LDWA 3EGTA 3RYEA 5ERNA 5IMPA 3WSBA 5HN9A 3IBAA 2Q80A 2PS6A 2Z4VA 3QQVA 1KIZA 2E8WA 2E8VA 5B02A 3PH7A 1EZFA 3PYBA 3TFVA 3N0FA 1RTRA 1UBVA 5IL8A 2DH4A 3B7LA 3TS7A 4DWBA 5B0IA 4Q23A 3MAVA 5DZ2A 3WCFA 2Q9ZA 4LZ0A 1YHKA 3KRPB 4RYPA 5ERMA 2OPNA 3ACXA 4NKEA 5DJPF 4KVIA 5DJRF 4LPHF 1V4HA 4DWGA 4LOBA 4NFIF 4PVXF 5IMIA 5DGSF 2ZCOA 3VJCA 5B03A 1JFAA 2J1PA 5B00A 5C05A 2ZCQA 4OKZA 5EASA 1DGPA 3N1VF 3LSNA 4OKMA 3KRPA 5ILJA 3DYHA 3Q30A 3ACWA 4LZ3A 3ZOUA 2AZLA 5DGMF 1WKZA 3BNXA 5B0MA 2E8XA 4RNQA 4E9ZA 1WL0A 4MC8A 3WCDA 1DI1A 1WL3A 1WL1A 3SDUA 5IKHA 3SDRA 4XQTF 2Z4ZA 3ID0A 1VG7A 5EROA 1YHLA 3WCEA 5E8LA 2E93A 3Q2ZA 3NPKA 5IM1A 4RXAA 3ICNA 3OABB 2Z4XA 2OPMA 3KRCB 2AELA 4N1ZF 1V4IA 5EATA 1N23A 4EA0A 1HXAA 4KUXA 3N0GA 5EAUA 1UBXA 1HM7A 2F89F 3G4FA 4FP4A 4LLSA 3WCBA 2F92F 4QPFA 3OABA 2AZJA 3KRCA 3WCLA 5B0JA 4LTVA 2F94F 2AZKA 5B0KA 2OA6A 3G4DA 1WL2A 4LIXA 2E94A 2J5CA 1YQ7A 3CP6A 3DYGA 3VJAA 3RYWA 3AQBB 3LGZB 2Z7HA 5DHIA 4KPDA 3N3LF
chains in the Genus database with same CATH topology
3M02A 3Q1OA 5DIQF 5I1UA 2ZCRA 3KBKA 2PS5A 3CC9A 3TC1A 2EWGA 1V4EA 5ILIA 5IL3A 1YYRA 2Q58A 3LOMA 4KQ5A 3VJDA 5ILKA 4P0VA 3NPRA 4RXEA 2PS4A 3M01A 4KVDA 4F62A 3AE0A 3NF2A 3LLWA 2Z78A 3NRIA 3WEHA 3WEKA 3SAEA 2E4OA 1UBYA 2ZEUA 4KVWA 2E8UA 2Z7IA 4N9UA 4XQRF 3ACYA 4LFVF 3WEFA 1N20A 4KKMA 1WY0A 4H5DF 1UBWA 3CKEA 3WEJA 2ZEVA 2ZY1A 5JV1F 1KIYA 3M0GA 3VJ8A 2E95A 3V1XA 3N49F 3S4JA 4WK5A 3N6KF 4DZWA 5DHKA 1VG6A 2VF6A 1N21A 3WJNA 5DGNF 1N24A 4DXJA 4KQUA 2F7MF 1RQJA 3N5HF 4LUUA 5CG5A 2F8CF 3KROB 4LA5A 3LG5A 3N1WF 2PS7A 3WEGA 2Z52A 2FTZA 2F9KF 4LFGA 3AQCB 2ONGA 2QISA 4H5EF 3ZCDA 4JZXA 3WCAA 4ZQ8A 3ZMBA 4NUAA 3WCCA 4GA3A 4NFJF 4MC3A 3V66A 4KK2A 1PS1A 3KROA 4DI5A 2O1OA 3V1VA 1YYSA 4NKFA 5HN7A 3VJ9A 5IK0A 3LEEA 4EA2A 4GAXA 3LGKA 3N46F 2J1OA 5JV2F 4L2XF 3N5JF 4LLTA 5E8KA 5ILHA 4QXSF 2RAHA 1YYTA 3WJOA 3BNYA 1V4JA 5IN8A 2FORA 4LZCA 4DHDA 3MZVA 2PS8A 3QKCA 5JUZF 4F6VA 4LFEA 3WCGA 2E90A 3LJIA 4KQSA 1VG3A 4RXDA 5IKAA 5B0LA 4LA6A 5A0KA 5B01A 1HXCA 5JA0F 3WCIA 3P5PA 4OMGA 4LTZA 3ICKA 2E91A 4FJQA 3WEIA 1YJ4A 5CG6A 3WSAA 3ASXA 3Q2QA 1JFGA 3WCJA 1YYUA 3WJKA 4F6XA 4E1EA 3WC9A 1HM4A 3RBMA 1WMWA 5HN8A 3S9VA 4H5CF 3M9UA 2P1CA 3KB9A 3VJBA 5AELA 5HNAA 5ILDA 4UMJA 3EFQA 1FPSA 2E92A 5H9DA 5IMNA 2AEKA 3LZ9A 2F8ZF 4KFAA 1HXGA 3IPIA 3PKOA 3OACB 3ZMCA 5IK9A 3P5RA 3P41A 3SDQA 4LXWA 3ZL6A 3P8RA 1V4KA 2I19A 5DW7A 3TFNA 5ILYA 5JV0F 3RMGA 3AQ0A 4JYXA 3OYRA 2ZCSA 4OGUA 3OACA 4KWDA 1N22A 3ICZA 3DYFA 5IK6A 5KSXF 3UCAA 4RXCA 3N45F 2H8OA 4HD1A 3PYAA 4GP2A 3EZ3A 4XQSF 3KRAB 2Z4WA 3APZA 2ONHA 1ZW5A 3LK5A 5DJVF 1N1ZA 5E8HA 4NFKF 4LPGF 3ADZA 1RQIA 4E9UA 4PVYF 2E8TA 3TFPA 4KVYA 3LVSA 4KPJA 3SDVA 3WCHA 4P0XA 4P0WA 3KRAA 3SDTA 4GP1A 5A0IA 2Z4YA 4EA1A 4JVJF 4JXNA 2Q9YA 4JZBA 4MC0A 1YV5A 5AHUB 1VG4A 2Z50A 3WCMA 5IVGA 1YYQA 3W7FA 3ICMA 2AETA 3KRFB 3P8LA 3N3DA 5AFXA 1N1BA 5A0JA 4DEMF 1VG2A 4OMHA 3LMDA 3PDEA 5AYPA 4JXYA 3M00A 3VJEA 3WE9A 4NG6A 5ILZA 4K10A 5ER8A 2OGDA 3KRFA 1HX9A 1YHMA 3LDWA 3EGTA 3RYEA 5ERNA 5IMPA 3WSBA 5HN9A 3IBAA 2Q80A 2PS6A 2Z4VA 3QQVA 1KIZA 2E8WA 2E8VA 5B02A 3PH7A 1EZFA 3PYBA 3TFVA 3N0FA 1RTRA 1UBVA 5IL8A 2DH4A 3B7LA 3TS7A 4DWBA 5B0IA 4Q23A 3MAVA 5DZ2A 3WCFA 2Q9ZA 4LZ0A 1YHKA 3KRPB 4RYPA 5ERMA 2OPNA 3ACXA 4NKEA 5DJPF 4KVIA 5DJRF 4LPHF 1V4HA 4DWGA 4LOBA 4NFIF 4PVXF 5IMIA 5DGSF 2ZCOA 3VJCA 5B03A 1JFAA 2J1PA 5B00A 5C05A 2ZCQA 4OKZA 5EASA 1DGPA 3N1VF 3LSNA 4OKMA 3KRPA 5ILJA 3DYHA 3Q30A 3ACWA 4LZ3A 3ZOUA 2AZLA 5DGMF 1WKZA 3BNXA 5B0MA 2E8XA 4RNQA 4E9ZA 1WL0A 4MC8A 3WCDA 1DI1A 1WL3A 1WL1A 3SDUA 5IKHA 3SDRA 4XQTF 2Z4ZA 3ID0A 1VG7A 5EROA 1YHLA 3WCEA 5E8LA 2E93A 3Q2ZA 3NPKA 5IM1A 4RXAA 3ICNA 3OABB 2Z4XA 2OPMA 3KRCB 2AELA 4N1ZF 1V4IA 5EATA 1N23A 4EA0A 1HXAA 4KUXA 3N0GA 5EAUA 1UBXA 1HM7A 2F89F 3G4FA 4FP4A 4LLSA 3WCBA 2F92F 4QPFA 3OABA 2AZJA 3KRCA 3WCLA 5B0JA 4LTVA 2F94F 2AZKA 5B0KA 2OA6A 3G4DA 1WL2A 4LIXA 2E94A 2J5CA 1YQ7A 3CP6A 3DYGA 3VJAA 3RYWA 3AQBB 3LGZB 2Z7HA 5DHIA 4KPDA 3N3LF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M02 A;  3Q1O A;  5DIQ F;  5I1U A;  2ZCR A;  3KBK A;  2PS5 A;  3CC9 A;  3TC1 A;  2EWG A;  1V4E A;  5ILI A;  5IL3 A;  1YYR A;  2Q58 A;  3LOM A;  4KQ5 A;  3VJD A;  5ILK A;  4P0V A;  3NPR A;  4RXE A;  2PS4 A;  3M01 A;  4KVD A;  4F62 A;  3AE0 A;  3NF2 A;  3LLW A;  2Z78 A;  3NRI A;  3WEH A;  3WEK A;  3SAE A;  2E4O A;  1UBY A;  2ZEU A;  4KVW A;  2E8U A;  2Z7I A;  4N9U A;  4XQR F;  3ACY A;  4LFV F;  3WEF A;  1N20 A;  4KKM A;  1WY0 A;  4H5D F;  1UBW A;  3CKE A;  3WEJ A;  2ZEV A;  2ZY1 A;  5JV1 F;  1KIY A;  3M0G A;  3VJ8 A;  2E95 A;  3V1X A;  3N49 F;  3S4J A;  4WK5 A;  3N6K F;  4DZW A;  5DHK A;  1VG6 A;  2VF6 A;  1N21 A;  3WJN A;  5DGN F;  1N24 A;  4DXJ A;  4KQU A;  2F7M F;  1RQJ A;  3N5H F;  4LUU A;  5CG5 A;  2F8C F;  3KRO B;  4LA5 A;  3LG5 A;  3N1W F;  2PS7 A;  3WEG A;  2Z52 A;  2FTZ A;  2F9K F;  4LFG A;  3AQC B;  2ONG A;  2QIS A;  4H5E F;  3ZCD A;  4JZX A;  3WCA A;  4ZQ8 A;  3ZMB A;  4NUA A;  3WCC A;  4GA3 A;  4NFJ F;  4MC3 A;  3V66 A;  4KK2 A;  1PS1 A;  3KRO A;  4DI5 A;  2O1O A;  3V1V A;  1YYS A;  4NKF A;  5HN7 A;  3VJ9 A;  5IK0 A;  3LEE A;  4EA2 A;  4GAX A;  3LGK A;  3N46 F;  2J1O A;  5JV2 F;  4L2X F;  3N5J F;  4LLT A;  5E8K A;  5ILH A;  4QXS F;  2RAH A;  1YYT A;  3WJO A;  3BNY A;  1V4J A;  5IN8 A;  2FOR A;  4LZC A;  4DHD A;  3MZV A;  2PS8 A;  3QKC A;  5JUZ F;  4F6V A;  4LFE A;  3WCG A;  2E90 A;  3LJI A;  4KQS A;  1VG3 A;  4RXD A;  5IKA A;  5B0L A;  4LA6 A;  5A0K A;  5B01 A;  1HXC A;  5JA0 F;  3WCI A;  3P5P A;  4OMG A;  4LTZ A;  3ICK A;  2E91 A;  4FJQ A;  3WEI A;  1YJ4 A;  5CG6 A;  3WSA A;  3ASX A;  3Q2Q A;  1JFG A;  3WCJ A;  1YYU A;  3WJK A;  4F6X A;  4E1E A;  3WC9 A;  1HM4 A;  3RBM A;  1WMW A;  5HN8 A;  3S9V A;  4H5C F;  3M9U A;  2P1C A;  3KB9 A;  3VJB A;  5AEL A;  5HNA A;  5ILD A;  4UMJ A;  3EFQ A;  1FPS A;  2E92 A;  5H9D A;  5IMN A;  2AEK A;  3LZ9 A;  2F8Z F;  4KFA A;  1HXG A;  3IPI A;  3PKO A;  3OAC B;  3ZMC A;  5IK9 A;  3P5R A;  3P41 A;  3SDQ A;  4LXW A;  3ZL6 A;  3P8R A;  1V4K A;  2I19 A;  5DW7 A;  3TFN A;  5ILY A;  5JV0 F;  3RMG A;  3AQ0 A;  4JYX A;  3OYR A;  2ZCS A;  4OGU A;  3OAC A;  4KWD A;  1N22 A;  3ICZ A;  3DYF A;  5IK6 A;  5KSX F;  3UCA A;  4RXC A;  3N45 F;  2H8O A;  4HD1 A;  3PYA A;  4GP2 A;  3EZ3 A;  4XQS F;  3KRA B;  2Z4W A;  3APZ A;  2ONH A;  1ZW5 A;  3LK5 A;  5DJV F;  1N1Z A;  5E8H A;  4NFK F;  4LPG F;  3ADZ A;  1RQI A;  4E9U A;  4PVY F;  2E8T A;  3TFP A;  4KVY A;  3LVS A;  4KPJ A;  3SDV A;  3WCH A;  4P0X A;  4P0W A;  3KRA A;  3SDT A;  4GP1 A;  5A0I A;  2Z4Y A;  4EA1 A;  4JVJ F;  4JXN A;  2Q9Y A;  4JZB A;  4MC0 A;  1YV5 A;  5AHU B;  1VG4 A;  2Z50 A;  3WCM A;  5IVG A;  1YYQ A;  3W7F A;  3ICM A;  2AET A;  3KRF B;  3P8L A;  3N3D A;  5AFX A;  1N1B A;  5A0J A;  4DEM F;  1VG2 A;  4OMH A;  3LMD A;  3PDE A;  5AYP A;  4JXY A;  3M00 A;  3VJE A;  3WE9 A;  4NG6 A;  5ILZ A;  4K10 A;  5ER8 A;  2OGD A;  3KRF A;  1HX9 A;  1YHM A;  3LDW A;  3EGT A;  3RYE A;  5ERN A;  5IMP A;  3WSB A;  5HN9 A;  3IBA A;  2Q80 A;  2PS6 A;  2Z4V A;  3QQV A;  1KIZ A;  2E8W A;  2E8V A;  5B02 A;  3PH7 A;  1EZF A;  3PYB A;  3TFV A;  3N0F A;  1RTR A;  1UBV A;  5IL8 A;  2DH4 A;  3B7L A;  3TS7 A;  4DWB A;  5B0I A;  4Q23 A;  3MAV A;  5DZ2 A;  3WCF A;  2Q9Z A;  4LZ0 A;  1YHK A;  3KRP B;  4RYP A;  5ERM A;  2OPN A;  3ACX A;  4NKE A;  5DJP F;  4KVI A;  5DJR F;  4LPH F;  1V4H A;  4DWG A;  4LOB A;  4NFI F;  4PVX F;  5IMI A;  5DGS F;  2ZCO A;  3VJC A;  5B03 A;  1JFA A;  2J1P A;  5B00 A;  5C05 A;  2ZCQ A;  4OKZ A;  5EAS A;  1DGP A;  3N1V F;  3LSN A;  4OKM A;  3KRP A;  5ILJ A;  3DYH A;  3Q30 A;  3ACW A;  4LZ3 A;  3ZOU A;  2AZL A;  5DGM F;  1WKZ A;  3BNX A;  5B0M A;  2E8X A;  4RNQ A;  4E9Z A;  1WL0 A;  4MC8 A;  3WCD A;  1DI1 A;  1WL3 A;  1WL1 A;  3SDU A;  5IKH A;  3SDR A;  4XQT F;  2Z4Z A;  3ID0 A;  1VG7 A;  5ERO A;  1YHL A;  3WCE A;  5E8L A;  2E93 A;  3Q2Z A;  3NPK A;  5IM1 A;  4RXA A;  3ICN A;  3OAB B;  2Z4X A;  2OPM A;  3KRC B;  2AEL A;  4N1Z F;  1V4I A;  5EAT A;  1N23 A;  4EA0 A;  1HXA A;  4KUX A;  3N0G A;  5EAU A;  1UBX A;  1HM7 A;  2F89 F;  3G4F A;  4FP4 A;  4LLS A;  3WCB A;  2F92 F;  4QPF A;  3OAB A;  2AZJ A;  3KRC A;  3WCL A;  5B0J A;  4LTV A;  2F94 F;  2AZK A;  5B0K A;  2OA6 A;  3G4D A;  1WL2 A;  4LIX A;  2E94 A;  2J5C A;  1YQ7 A;  3CP6 A;  3DYG A;  3VJA A;  3RYW A;  3AQB B;  3LGZ B;  2Z7H A;  5DHI A;  4KPD A;  3N3L F; 
#chains in the Genus database with same CATH topology
 3M02 A;  3Q1O A;  5DIQ F;  5I1U A;  2ZCR A;  3KBK A;  2PS5 A;  3CC9 A;  3TC1 A;  2EWG A;  1V4E A;  5ILI A;  5IL3 A;  1YYR A;  2Q58 A;  3LOM A;  4KQ5 A;  3VJD A;  5ILK A;  4P0V A;  3NPR A;  4RXE A;  2PS4 A;  3M01 A;  4KVD A;  4F62 A;  3AE0 A;  3NF2 A;  3LLW A;  2Z78 A;  3NRI A;  3WEH A;  3WEK A;  3SAE A;  2E4O A;  1UBY A;  2ZEU A;  4KVW A;  2E8U A;  2Z7I A;  4N9U A;  4XQR F;  3ACY A;  4LFV F;  3WEF A;  1N20 A;  4KKM A;  1WY0 A;  4H5D F;  1UBW A;  3CKE A;  3WEJ A;  2ZEV A;  2ZY1 A;  5JV1 F;  1KIY A;  3M0G A;  3VJ8 A;  2E95 A;  3V1X A;  3N49 F;  3S4J A;  4WK5 A;  3N6K F;  4DZW A;  5DHK A;  1VG6 A;  2VF6 A;  1N21 A;  3WJN A;  5DGN F;  1N24 A;  4DXJ A;  4KQU A;  2F7M F;  1RQJ A;  3N5H F;  4LUU A;  5CG5 A;  2F8C F;  3KRO B;  4LA5 A;  3LG5 A;  3N1W F;  2PS7 A;  3WEG A;  2Z52 A;  2FTZ A;  2F9K F;  4LFG A;  3AQC B;  2ONG A;  2QIS A;  4H5E F;  3ZCD A;  4JZX A;  3WCA A;  4ZQ8 A;  3ZMB A;  4NUA A;  3WCC A;  4GA3 A;  4NFJ F;  4MC3 A;  3V66 A;  4KK2 A;  1PS1 A;  3KRO A;  4DI5 A;  2O1O A;  3V1V A;  1YYS A;  4NKF A;  5HN7 A;  3VJ9 A;  5IK0 A;  3LEE A;  4EA2 A;  4GAX A;  3LGK A;  3N46 F;  2J1O A;  5JV2 F;  4L2X F;  3N5J F;  4LLT A;  5E8K A;  5ILH A;  4QXS F;  2RAH A;  1YYT A;  3WJO A;  3BNY A;  1V4J A;  5IN8 A;  2FOR A;  4LZC A;  4DHD A;  3MZV A;  2PS8 A;  3QKC A;  5JUZ F;  4F6V A;  4LFE A;  3WCG A;  2E90 A;  3LJI A;  4KQS A;  1VG3 A;  4RXD A;  5IKA A;  5B0L A;  4LA6 A;  5A0K A;  5B01 A;  1HXC A;  5JA0 F;  3WCI A;  3P5P A;  4OMG A;  4LTZ A;  3ICK A;  2E91 A;  4FJQ A;  3WEI A;  1YJ4 A;  5CG6 A;  3WSA A;  3ASX A;  3Q2Q A;  1JFG A;  3WCJ A;  1YYU A;  3WJK A;  4F6X A;  4E1E A;  3WC9 A;  1HM4 A;  3RBM A;  1WMW A;  5HN8 A;  3S9V A;  4H5C F;  3M9U A;  2P1C A;  3KB9 A;  3VJB A;  5AEL A;  5HNA A;  5ILD A;  4UMJ A;  3EFQ A;  1FPS A;  2E92 A;  5H9D A;  5IMN A;  2AEK A;  3LZ9 A;  2F8Z F;  4KFA A;  1HXG A;  3IPI A;  3PKO A;  3OAC B;  3ZMC A;  5IK9 A;  3P5R A;  3P41 A;  3SDQ A;  4LXW A;  3ZL6 A;  3P8R A;  1V4K A;  2I19 A;  5DW7 A;  3TFN A;  5ILY A;  5JV0 F;  3RMG A;  3AQ0 A;  4JYX A;  3OYR A;  2ZCS A;  4OGU A;  3OAC A;  4KWD A;  1N22 A;  3ICZ A;  3DYF A;  5IK6 A;  5KSX F;  3UCA A;  4RXC A;  3N45 F;  2H8O A;  4HD1 A;  3PYA A;  4GP2 A;  3EZ3 A;  4XQS F;  3KRA B;  2Z4W A;  3APZ A;  2ONH A;  1ZW5 A;  3LK5 A;  5DJV F;  1N1Z A;  5E8H A;  4NFK F;  4LPG F;  3ADZ A;  1RQI A;  4E9U A;  4PVY F;  2E8T A;  3TFP A;  4KVY A;  3LVS A;  4KPJ A;  3SDV A;  3WCH A;  4P0X A;  4P0W A;  3KRA A;  3SDT A;  4GP1 A;  5A0I A;  2Z4Y A;  4EA1 A;  4JVJ F;  4JXN A;  2Q9Y A;  4JZB A;  4MC0 A;  1YV5 A;  5AHU B;  1VG4 A;  2Z50 A;  3WCM A;  5IVG A;  1YYQ A;  3W7F A;  3ICM A;  2AET A;  3KRF B;  3P8L A;  3N3D A;  5AFX A;  1N1B A;  5A0J A;  4DEM F;  1VG2 A;  4OMH A;  3LMD A;  3PDE A;  5AYP A;  4JXY A;  3M00 A;  3VJE A;  3WE9 A;  4NG6 A;  5ILZ A;  4K10 A;  5ER8 A;  2OGD A;  3KRF A;  1HX9 A;  1YHM A;  3LDW A;  3EGT A;  3RYE A;  5ERN A;  5IMP A;  3WSB A;  5HN9 A;  3IBA A;  2Q80 A;  2PS6 A;  2Z4V A;  3QQV A;  1KIZ A;  2E8W A;  2E8V A;  5B02 A;  3PH7 A;  1EZF A;  3PYB A;  3TFV A;  3N0F A;  1RTR A;  1UBV A;  5IL8 A;  2DH4 A;  3B7L A;  3TS7 A;  4DWB A;  5B0I A;  4Q23 A;  3MAV A;  5DZ2 A;  3WCF A;  2Q9Z A;  4LZ0 A;  1YHK A;  3KRP B;  4RYP A;  5ERM A;  2OPN A;  3ACX A;  4NKE A;  5DJP F;  4KVI A;  5DJR F;  4LPH F;  1V4H A;  4DWG A;  4LOB A;  4NFI F;  4PVX F;  5IMI A;  5DGS F;  2ZCO A;  3VJC A;  5B03 A;  1JFA A;  2J1P A;  5B00 A;  5C05 A;  2ZCQ A;  4OKZ A;  5EAS A;  1DGP A;  3N1V F;  3LSN A;  4OKM A;  3KRP A;  5ILJ A;  3DYH A;  3Q30 A;  3ACW A;  4LZ3 A;  3ZOU A;  2AZL A;  5DGM F;  1WKZ A;  3BNX A;  5B0M A;  2E8X A;  4RNQ A;  4E9Z A;  1WL0 A;  4MC8 A;  3WCD A;  1DI1 A;  1WL3 A;  1WL1 A;  3SDU A;  5IKH A;  3SDR A;  4XQT F;  2Z4Z A;  3ID0 A;  1VG7 A;  5ERO A;  1YHL A;  3WCE A;  5E8L A;  2E93 A;  3Q2Z A;  3NPK A;  5IM1 A;  4RXA A;  3ICN A;  3OAB B;  2Z4X A;  2OPM A;  3KRC B;  2AEL A;  4N1Z F;  1V4I A;  5EAT A;  1N23 A;  4EA0 A;  1HXA A;  4KUX A;  3N0G A;  5EAU A;  1UBX A;  1HM7 A;  2F89 F;  3G4F A;  4FP4 A;  4LLS A;  3WCB A;  2F92 F;  4QPF A;  3OAB A;  2AZJ A;  3KRC A;  3WCL A;  5B0J A;  4LTV A;  2F94 F;  2AZK A;  5B0K A;  2OA6 A;  3G4D A;  1WL2 A;  4LIX A;  2E94 A;  2J5C A;  1YQ7 A;  3CP6 A;  3DYG A;  3VJA A;  3RYW A;  3AQB B;  3LGZ B;  2Z7H A;  5DHI A;  4KPD A;  3N3L F; 
#chains in the Genus database with same CATH homology
 3M02 A;  3Q1O A;  5DIQ F;  5I1U A;  2ZCR A;  3KBK A;  2PS5 A;  3CC9 A;  3TC1 A;  2EWG A;  1V4E A;  5ILI A;  5IL3 A;  1YYR A;  2Q58 A;  3LOM A;  4KQ5 A;  3VJD A;  5ILK A;  4P0V A;  3NPR A;  4RXE A;  2PS4 A;  3M01 A;  4KVD A;  4F62 A;  3AE0 A;  3NF2 A;  3LLW A;  2Z78 A;  3NRI A;  3WEH A;  3WEK A;  3SAE A;  2E4O A;  1UBY A;  2ZEU A;  4KVW A;  2E8U A;  2Z7I A;  4N9U A;  4XQR F;  3ACY A;  4LFV F;  3WEF A;  1N20 A;  4KKM A;  1WY0 A;  4H5D F;  1UBW A;  3CKE A;  3WEJ A;  2ZEV A;  2ZY1 A;  5JV1 F;  1KIY A;  3M0G A;  3VJ8 A;  2E95 A;  3V1X A;  3N49 F;  3S4J A;  4WK5 A;  3N6K F;  4DZW A;  5DHK A;  1VG6 A;  2VF6 A;  1N21 A;  3WJN A;  5DGN F;  1N24 A;  4DXJ A;  4KQU A;  2F7M F;  1RQJ A;  3N5H F;  4LUU A;  5CG5 A;  2F8C F;  3KRO B;  4LA5 A;  3LG5 A;  3N1W F;  2PS7 A;  3WEG A;  2Z52 A;  2FTZ A;  2F9K F;  4LFG A;  3AQC B;  2ONG A;  2QIS A;  4H5E F;  3ZCD A;  4JZX A;  3WCA A;  4ZQ8 A;  3ZMB A;  4NUA A;  3WCC A;  4GA3 A;  4NFJ F;  4MC3 A;  3V66 A;  4KK2 A;  1PS1 A;  3KRO A;  4DI5 A;  2O1O A;  3V1V A;  1YYS A;  4NKF A;  5HN7 A;  3VJ9 A;  5IK0 A;  3LEE A;  4EA2 A;  4GAX A;  3LGK A;  3N46 F;  2J1O A;  5JV2 F;  4L2X F;  3N5J F;  4LLT A;  5E8K A;  5ILH A;  4QXS F;  2RAH A;  1YYT A;  3WJO A;  3BNY A;  1V4J A;  5IN8 A;  2FOR A;  4LZC A;  4DHD A;  3MZV A;  2PS8 A;  3QKC A;  5JUZ F;  4F6V A;  4LFE A;  3WCG A;  2E90 A;  3LJI A;  4KQS A;  1VG3 A;  4RXD A;  5IKA A;  5B0L A;  4LA6 A;  5A0K A;  5B01 A;  1HXC A;  5JA0 F;  3WCI A;  3P5P A;  4OMG A;  4LTZ A;  3ICK A;  2E91 A;  4FJQ A;  3WEI A;  1YJ4 A;  5CG6 A;  3WSA A;  3ASX A;  3Q2Q A;  1JFG A;  3WCJ A;  1YYU A;  3WJK A;  4F6X A;  4E1E A;  3WC9 A;  1HM4 A;  3RBM A;  1WMW A;  5HN8 A;  3S9V A;  4H5C F;  3M9U A;  2P1C A;  3KB9 A;  3VJB A;  5AEL A;  5HNA A;  5ILD A;  4UMJ A;  3EFQ A;  1FPS A;  2E92 A;  5H9D A;  5IMN A;  2AEK A;  3LZ9 A;  2F8Z F;  4KFA A;  1HXG A;  3IPI A;  3PKO A;  3OAC B;  3ZMC A;  5IK9 A;  3P5R A;  3P41 A;  3SDQ A;  4LXW A;  3ZL6 A;  3P8R A;  1V4K A;  2I19 A;  5DW7 A;  3TFN A;  5ILY A;  5JV0 F;  3RMG A;  3AQ0 A;  4JYX A;  3OYR A;  2ZCS A;  4OGU A;  3OAC A;  4KWD A;  1N22 A;  3ICZ A;  3DYF A;  5IK6 A;  5KSX F;  3UCA A;  4RXC A;  3N45 F;  2H8O A;  4HD1 A;  3PYA A;  4GP2 A;  3EZ3 A;  4XQS F;  3KRA B;  2Z4W A;  3APZ A;  2ONH A;  1ZW5 A;  3LK5 A;  5DJV F;  1N1Z A;  5E8H A;  4NFK F;  4LPG F;  3ADZ A;  1RQI A;  4E9U A;  4PVY F;  2E8T A;  3TFP A;  4KVY A;  3LVS A;  4KPJ A;  3SDV A;  3WCH A;  4P0X A;  4P0W A;  3KRA A;  3SDT A;  4GP1 A;  5A0I A;  2Z4Y A;  4EA1 A;  4JVJ F;  4JXN A;  2Q9Y A;  4JZB A;  4MC0 A;  1YV5 A;  5AHU B;  1VG4 A;  2Z50 A;  3WCM A;  5IVG A;  1YYQ A;  3W7F A;  3ICM A;  2AET A;  3KRF B;  3P8L A;  3N3D A;  5AFX A;  1N1B A;  5A0J A;  4DEM F;  1VG2 A;  4OMH A;  3LMD A;  3PDE A;  5AYP A;  4JXY A;  3M00 A;  3VJE A;  3WE9 A;  4NG6 A;  5ILZ A;  4K10 A;  5ER8 A;  2OGD A;  3KRF A;  1HX9 A;  1YHM A;  3LDW A;  3EGT A;  3RYE A;  5ERN A;  5IMP A;  3WSB A;  5HN9 A;  3IBA A;  2Q80 A;  2PS6 A;  2Z4V A;  3QQV A;  1KIZ A;  2E8W A;  2E8V A;  5B02 A;  3PH7 A;  1EZF A;  3PYB A;  3TFV A;  3N0F A;  1RTR A;  1UBV A;  5IL8 A;  2DH4 A;  3B7L A;  3TS7 A;  4DWB A;  5B0I A;  4Q23 A;  3MAV A;  5DZ2 A;  3WCF A;  2Q9Z A;  4LZ0 A;  1YHK A;  3KRP B;  4RYP A;  5ERM A;  2OPN A;  3ACX A;  4NKE A;  5DJP F;  4KVI A;  5DJR F;  4LPH F;  1V4H A;  4DWG A;  4LOB A;  4NFI F;  4PVX F;  5IMI A;  5DGS F;  2ZCO A;  3VJC A;  5B03 A;  1JFA A;  2J1P A;  5B00 A;  5C05 A;  2ZCQ A;  4OKZ A;  5EAS A;  1DGP A;  3N1V F;  3LSN A;  4OKM A;  3KRP A;  5ILJ A;  3DYH A;  3Q30 A;  3ACW A;  4LZ3 A;  3ZOU A;  2AZL A;  5DGM F;  1WKZ A;  3BNX A;  5B0M A;  2E8X A;  4RNQ A;  4E9Z A;  1WL0 A;  4MC8 A;  3WCD A;  1DI1 A;  1WL3 A;  1WL1 A;  3SDU A;  5IKH A;  3SDR A;  4XQT F;  2Z4Z A;  3ID0 A;  1VG7 A;  5ERO A;  1YHL A;  3WCE A;  5E8L A;  2E93 A;  3Q2Z A;  3NPK A;  5IM1 A;  4RXA A;  3ICN A;  3OAB B;  2Z4X A;  2OPM A;  3KRC B;  2AEL A;  4N1Z F;  1V4I A;  5EAT A;  1N23 A;  4EA0 A;  1HXA A;  4KUX A;  3N0G A;  5EAU A;  1UBX A;  1HM7 A;  2F89 F;  3G4F A;  4FP4 A;  4LLS A;  3WCB A;  2F92 F;  4QPF A;  3OAB A;  2AZJ A;  3KRC A;  3WCL A;  5B0J A;  4LTV A;  2F94 F;  2AZK A;  5B0K A;  2OA6 A;  3G4D A;  1WL2 A;  4LIX A;  2E94 A;  2J5C A;  1YQ7 A;  3CP6 A;  3DYG A;  3VJA A;  3RYW A;  3AQB B;  3LGZ B;  2Z7H A;  5DHI A;  4KPD A;  3N3L F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...