4EA2A

Crystal structure of dehydrosqualene synthase (crtm) aureus complexed with sq-109
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
284
structure length
281
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 115
structure length 281
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4ea2A00
5ILKA 4KVIA 4DI5A 3SDRA 3WEKA 3NPRA 5DHIA 5IL8A 2F8CF 3KB9A 5B0LA 5IK0A 3M01A 3QQVA 3ZMBA 4LA6A 2I19A 4QPFA 4WK5A 3OABB 3CC9A 3LZ9A 3LJIA 4JZXA 3LMDA 2AEKA 1WL3A 4H5CF 3PYAA 4RNQA 3KRFA 1YYQA 4LZ0A 3N5JF 2OPNA 4OKMA 4KVYA 1UBWA 4HD1A 2FTZA 3PYBA 3APZA 3KROA 3G4FA 2EWGA 4JZBA 3LSNA 4DWBA 3N1VF 3ICNA 4PVYF 5EAUA 1VG7A 3ID0A 2AZKA 4LTVA 3M00A 5KSXF 3WC9A 3W7FA 3KROB 3BNYA 3KRPA 4NFKF 1KIZA 4LUUA 1PS1A 2J1PA 2E93A 5HN8A 3ZCDA 4LFVF 4JYXA 3KRAA 3WSAA 2VF6A 2ZEVA 1VG4A 4GAXA 1V4EA 4LPGF 3LG5A 2F9KF 5IVGA 3WCEA 3S9VA 3KRCB 1V4IA 4P0VA 4XQRF 1HM7A 1WY0A 3N6KF 5ILYA 5IMPA 3WCAA 2PS4A 3G4DA 3VJBA 4KK2A 4NFIF 5DJRF 3P8LA 5IK9A 2PS7A 4F62A 3WEJA 3CKEA 2OGDA 2ONHA 5B03A 3QKCA 3TC1A 3UCAA 5EATA 4LLSA 1RTRA 3EFQA 2ZCRA 3NPKA 4GP2A 3Q2ZA 5HN7A 3WJNA 1UBYA 3TFVA 4RXAA 3SDTA 1HXGA 1N20A 3N1WF 1N21A 3V1XA 3ZOUA 3WJKA 4LOBA 4JXNA 3ZL6A 4LA5A 3VJEA 2P1CA 3N5HF 1VG6A 3WCMA 5DIQF 3OACA 2F7MF 2Z4VA 2PS6A 3WEGA 2FORA 1V4JA 3SDUA 3ACYA 3PH7A 3VJDA 3N0FA 2ZCQA 5A0KA 3TS7A 1FPSA 1DI1A 2ZEUA 4KKMA 1V4HA 3ICMA 2Z4YA 4GP1A 4DZWA 4LPHF 4Q23A 3S4JA 2OA6A 4RXEA 4P0XA 3KRFB 1YQ7A 5B0MA 4KVWA 3B7LA 3LEEA 3WCFA 2J1OA 2Q9ZA 2Q80A 5A0IA 3M9UA 2E8TA 3TFNA 4DWGA 5HN9A 3EZ3A 3P5RA 2ZY1A 5JUZF 4E9ZA 2Z78A 4KVDA 3PDEA 3ACXA 2E8XA 5IL3A 3KBKA 3ZMCA 3VJAA 3LDWA 3LGZB 5AELA 1EZFA 3KRPB 4DEMF 1YYRA 5ERMA 5E8LA 3VJ9A 5JV0F 4RYPA 4LZCA 2PS5A 3KRAB 4LLTA 5DHKA 3ACWA 5DW7A 1YYUA 4FP4A 4EA0A 3N46F 2E92A 1VG3A 2Z52A 2Z4WA 5JV1F 5DZ2A 4KPDA 5EASA 2ZCSA 3DYFA 2E8UA 2Z4XA 3NRIA 3V66A 3VJCA 3SAEA 5ILHA 2QISA 3Q2QA 5ILDA 3WCBA 4FJQA 4RXDA 5H9DA 4LXWA 1HXAA 3WCJA 2AZJA 1JFGA 1YYTA 1N23A 3MZVA 4H5EF 5CG5A 2E94A 3RMGA 3EGTA 5ILIA 4OMGA 4KFAA 1WL0A 4JXYA 3SDVA 4E1EA 3V1VA 5IMNA 1YHMA 1YYSA 5C05A 1N24A 1HM4A 2Z4ZA 3WEHA 4MC8A 5E8KA 4K10A 3NF2A 4NG6A 5IMIA 1N1ZA 3LVSA 4NUAA 3Q30A 4PVXF 5IN8A 5AYPA 3ICKA 5EROA 2J5CA 3WCCA 4DHDA 4NKEA 4OGUA 1WKZA 3OABA 5DJVF 3AE0A 5IM1A 4OKZA 1RQIA 2Z7HA 1UBXA 2PS8A 3OACB 3M0GA 4EA2A 5JV2F 3N45F 3VJ8A 2AZLA 5IKAA 3WEIA 3N0GA 5ERNA 1HXCA 4EA1A 5AFXA 2E4OA 2Z7IA 3LK5A 4LFEA 2ZCOA 5DGNF 5B02A 3WCGA 2F8ZF 2Q9YA 4GA3A 3P8RA 4NKFA 4N9UA 3ADZA 4DXJA 4UMJA 4JVJF 3WE9A 3AQ0A 5HNAA 2F89F 2ONGA 1UBVA 3WSBA 4KPJA 3PKOA 2E8VA 4LFGA 5ER8A 2Q58A 1V4KA 3AQCB 3ICZA 4MC0A 3WCHA 3IBAA 3SDQA 3N3LF 4OMHA 5E8HA 3AQBB 2F92F 1N22A 4XQSF 3ASXA 1YHKA 3CP6A 1VG2A 4KWDA 3Q1OA 3BNXA 5AHUB 3LGKA 1WL2A 4F6VA 4LZ3A 4L2XF 3WCDA 4KUXA 4RXCA 2F94F 4KQUA 4P0WA 5DGSF 4N1ZF 1YHLA 5A0JA 3DYHA 3DYGA 3KRCA 3M02A 4H5DF 1KIYA 5DJPF 5CG6A 3N49F 3RYEA 5DGMF 3OYRA 5B0JA 3LOMA 2E90A 2H8OA 3WJOA 3WEFA 1HX9A 1YV5A 1JFAA 1RQJA 4LTZA 3P5PA 4F6XA 4XQTF 2E95A 4QXSF 3RYWA 2RAHA 5IK6A 5B0IA 2O1OA 1WMWA 3MAVA 2AELA 2Z50A 4KQSA 2AETA 3IPIA 5IKHA 3P41A 4E9UA 5I1UA 1DGPA 4NFJF 4ZQ8A 3WCLA 2E8WA 1N1BA 4LIXA 5B0KA 3LLWA 1YJ4A 4MC3A 3N3DA 1WL1A 3TFPA 5JA0F 2DH4A 5B00A 5ILZA 3WCIA 2E91A 3RBMA 5B01A 2OPMA 5ILJA 1ZW5A 4KQ5A
chains in the Genus database with same CATH superfamily
5ILKA 4KVIA 4DI5A 3SDRA 3WEKA 3NPRA 5DHIA 5IL8A 2F8CF 3KB9A 5B0LA 5IK0A 3M01A 3QQVA 3ZMBA 4LA6A 2I19A 4QPFA 4WK5A 3OABB 3CC9A 3LZ9A 3LJIA 4JZXA 3LMDA 2AEKA 1WL3A 4H5CF 3PYAA 4RNQA 3KRFA 1YYQA 4LZ0A 3N5JF 2OPNA 4OKMA 4KVYA 1UBWA 4HD1A 2FTZA 3PYBA 3APZA 3KROA 3G4FA 2EWGA 4JZBA 3LSNA 4DWBA 3N1VF 3ICNA 4PVYF 5EAUA 1VG7A 3ID0A 2AZKA 4LTVA 3M00A 5KSXF 3WC9A 3W7FA 3KROB 3BNYA 3KRPA 4NFKF 1KIZA 4LUUA 1PS1A 2J1PA 2E93A 5HN8A 3ZCDA 4LFVF 4JYXA 3KRAA 3WSAA 2VF6A 2ZEVA 1VG4A 4GAXA 1V4EA 4LPGF 3LG5A 2F9KF 5IVGA 3WCEA 3S9VA 3KRCB 1V4IA 4P0VA 4XQRF 1HM7A 1WY0A 3N6KF 5ILYA 5IMPA 3WCAA 2PS4A 3G4DA 3VJBA 4KK2A 4NFIF 5DJRF 3P8LA 5IK9A 2PS7A 4F62A 3WEJA 3CKEA 2OGDA 2ONHA 5B03A 3QKCA 3TC1A 3UCAA 5EATA 4LLSA 1RTRA 3EFQA 2ZCRA 3NPKA 4GP2A 3Q2ZA 5HN7A 3WJNA 1UBYA 3TFVA 4RXAA 3SDTA 1HXGA 1N20A 3N1WF 1N21A 3V1XA 3ZOUA 3WJKA 4LOBA 4JXNA 3ZL6A 4LA5A 3VJEA 2P1CA 3N5HF 1VG6A 3WCMA 5DIQF 3OACA 2F7MF 2Z4VA 2PS6A 3WEGA 2FORA 1V4JA 3SDUA 3ACYA 3PH7A 3VJDA 3N0FA 2ZCQA 5A0KA 3TS7A 1FPSA 1DI1A 2ZEUA 4KKMA 1V4HA 3ICMA 2Z4YA 4GP1A 4DZWA 4LPHF 4Q23A 3S4JA 2OA6A 4RXEA 4P0XA 3KRFB 1YQ7A 5B0MA 4KVWA 3B7LA 3LEEA 3WCFA 2J1OA 2Q9ZA 2Q80A 5A0IA 3M9UA 2E8TA 3TFNA 4DWGA 5HN9A 3EZ3A 3P5RA 2ZY1A 5JUZF 4E9ZA 2Z78A 4KVDA 3PDEA 3ACXA 2E8XA 5IL3A 3KBKA 3ZMCA 3VJAA 3LDWA 3LGZB 5AELA 1EZFA 3KRPB 4DEMF 1YYRA 5ERMA 5E8LA 3VJ9A 5JV0F 4RYPA 4LZCA 2PS5A 3KRAB 4LLTA 5DHKA 3ACWA 5DW7A 1YYUA 4FP4A 4EA0A 3N46F 2E92A 1VG3A 2Z52A 2Z4WA 5JV1F 5DZ2A 4KPDA 5EASA 2ZCSA 3DYFA 2E8UA 2Z4XA 3NRIA 3V66A 3VJCA 3SAEA 5ILHA 2QISA 3Q2QA 5ILDA 3WCBA 4FJQA 4RXDA 5H9DA 4LXWA 1HXAA 3WCJA 2AZJA 1JFGA 1YYTA 1N23A 3MZVA 4H5EF 5CG5A 2E94A 3RMGA 3EGTA 5ILIA 4OMGA 4KFAA 1WL0A 4JXYA 3SDVA 4E1EA 3V1VA 5IMNA 1YHMA 1YYSA 5C05A 1N24A 1HM4A 2Z4ZA 3WEHA 4MC8A 5E8KA 4K10A 3NF2A 4NG6A 5IMIA 1N1ZA 3LVSA 4NUAA 3Q30A 4PVXF 5IN8A 5AYPA 3ICKA 5EROA 2J5CA 3WCCA 4DHDA 4NKEA 4OGUA 1WKZA 3OABA 5DJVF 3AE0A 5IM1A 4OKZA 1RQIA 2Z7HA 1UBXA 2PS8A 3OACB 3M0GA 4EA2A 5JV2F 3N45F 3VJ8A 2AZLA 5IKAA 3WEIA 3N0GA 5ERNA 1HXCA 4EA1A 5AFXA 2E4OA 2Z7IA 3LK5A 4LFEA 2ZCOA 5DGNF 5B02A 3WCGA 2F8ZF 2Q9YA 4GA3A 3P8RA 4NKFA 4N9UA 3ADZA 4DXJA 4UMJA 4JVJF 3WE9A 3AQ0A 5HNAA 2F89F 2ONGA 1UBVA 3WSBA 4KPJA 3PKOA 2E8VA 4LFGA 5ER8A 2Q58A 1V4KA 3AQCB 3ICZA 4MC0A 3WCHA 3IBAA 3SDQA 3N3LF 4OMHA 5E8HA 3AQBB 2F92F 1N22A 4XQSF 3ASXA 1YHKA 3CP6A 1VG2A 4KWDA 3Q1OA 3BNXA 5AHUB 3LGKA 1WL2A 4F6VA 4LZ3A 4L2XF 3WCDA 4KUXA 4RXCA 2F94F 4KQUA 4P0WA 5DGSF 4N1ZF 1YHLA 5A0JA 3DYHA 3DYGA 3KRCA 3M02A 4H5DF 1KIYA 5DJPF 5CG6A 3N49F 3RYEA 5DGMF 3OYRA 5B0JA 3LOMA 2E90A 2H8OA 3WJOA 3WEFA 1HX9A 1YV5A 1JFAA 1RQJA 4LTZA 3P5PA 4F6XA 4XQTF 2E95A 4QXSF 3RYWA 2RAHA 5IK6A 5B0IA 2O1OA 1WMWA 3MAVA 2AELA 2Z50A 4KQSA 2AETA 3IPIA 5IKHA 3P41A 4E9UA 5I1UA 1DGPA 4NFJF 4ZQ8A 3WCLA 2E8WA 1N1BA 4LIXA 5B0KA 3LLWA 1YJ4A 4MC3A 3N3DA 1WL1A 3TFPA 5JA0F 2DH4A 5B00A 5ILZA 3WCIA 2E91A 3RBMA 5B01A 2OPMA 5ILJA 1ZW5A 4KQ5A
chains in the Genus database with same CATH topology
5ILKA 4KVIA 4DI5A 3SDRA 3WEKA 3NPRA 5DHIA 5IL8A 2F8CF 3KB9A 5B0LA 5IK0A 3M01A 3QQVA 3ZMBA 4LA6A 2I19A 4QPFA 4WK5A 3OABB 3CC9A 3LZ9A 3LJIA 4JZXA 3LMDA 2AEKA 1WL3A 4H5CF 3PYAA 4RNQA 3KRFA 1YYQA 4LZ0A 3N5JF 2OPNA 4OKMA 4KVYA 1UBWA 4HD1A 2FTZA 3PYBA 3APZA 3KROA 3G4FA 2EWGA 4JZBA 3LSNA 4DWBA 3N1VF 3ICNA 4PVYF 5EAUA 1VG7A 3ID0A 2AZKA 4LTVA 3M00A 5KSXF 3WC9A 3W7FA 3KROB 3BNYA 3KRPA 4NFKF 1KIZA 4LUUA 1PS1A 2J1PA 2E93A 5HN8A 3ZCDA 4LFVF 4JYXA 3KRAA 3WSAA 2VF6A 2ZEVA 1VG4A 4GAXA 1V4EA 4LPGF 3LG5A 2F9KF 5IVGA 3WCEA 3S9VA 3KRCB 1V4IA 4P0VA 4XQRF 1HM7A 1WY0A 3N6KF 5ILYA 5IMPA 3WCAA 2PS4A 3G4DA 3VJBA 4KK2A 4NFIF 5DJRF 3P8LA 5IK9A 2PS7A 4F62A 3WEJA 3CKEA 2OGDA 2ONHA 5B03A 3QKCA 3TC1A 3UCAA 5EATA 4LLSA 1RTRA 3EFQA 2ZCRA 3NPKA 4GP2A 3Q2ZA 5HN7A 3WJNA 1UBYA 3TFVA 4RXAA 3SDTA 1HXGA 1N20A 3N1WF 1N21A 3V1XA 3ZOUA 3WJKA 4LOBA 4JXNA 3ZL6A 4LA5A 3VJEA 2P1CA 3N5HF 1VG6A 3WCMA 5DIQF 3OACA 2F7MF 2Z4VA 2PS6A 3WEGA 2FORA 1V4JA 3SDUA 3ACYA 3PH7A 3VJDA 3N0FA 2ZCQA 5A0KA 3TS7A 1FPSA 1DI1A 2ZEUA 4KKMA 1V4HA 3ICMA 2Z4YA 4GP1A 4DZWA 4LPHF 4Q23A 3S4JA 2OA6A 4RXEA 4P0XA 3KRFB 1YQ7A 5B0MA 4KVWA 3B7LA 3LEEA 3WCFA 2J1OA 2Q9ZA 2Q80A 5A0IA 3M9UA 2E8TA 3TFNA 4DWGA 5HN9A 3EZ3A 3P5RA 2ZY1A 5JUZF 4E9ZA 2Z78A 4KVDA 3PDEA 3ACXA 2E8XA 5IL3A 3KBKA 3ZMCA 3VJAA 3LDWA 3LGZB 5AELA 1EZFA 3KRPB 4DEMF 1YYRA 5ERMA 5E8LA 3VJ9A 5JV0F 4RYPA 4LZCA 2PS5A 3KRAB 4LLTA 5DHKA 3ACWA 5DW7A 1YYUA 4FP4A 4EA0A 3N46F 2E92A 1VG3A 2Z52A 2Z4WA 5JV1F 5DZ2A 4KPDA 5EASA 2ZCSA 3DYFA 2E8UA 2Z4XA 3NRIA 3V66A 3VJCA 3SAEA 5ILHA 2QISA 3Q2QA 5ILDA 3WCBA 4FJQA 4RXDA 5H9DA 4LXWA 1HXAA 3WCJA 2AZJA 1JFGA 1YYTA 1N23A 3MZVA 4H5EF 5CG5A 2E94A 3RMGA 3EGTA 5ILIA 4OMGA 4KFAA 1WL0A 4JXYA 3SDVA 4E1EA 3V1VA 5IMNA 1YHMA 1YYSA 5C05A 1N24A 1HM4A 2Z4ZA 3WEHA 4MC8A 5E8KA 4K10A 3NF2A 4NG6A 5IMIA 1N1ZA 3LVSA 4NUAA 3Q30A 4PVXF 5IN8A 5AYPA 3ICKA 5EROA 2J5CA 3WCCA 4DHDA 4NKEA 4OGUA 1WKZA 3OABA 5DJVF 3AE0A 5IM1A 4OKZA 1RQIA 2Z7HA 1UBXA 2PS8A 3OACB 3M0GA 4EA2A 5JV2F 3N45F 3VJ8A 2AZLA 5IKAA 3WEIA 3N0GA 5ERNA 1HXCA 4EA1A 5AFXA 2E4OA 2Z7IA 3LK5A 4LFEA 2ZCOA 5DGNF 5B02A 3WCGA 2F8ZF 2Q9YA 4GA3A 3P8RA 4NKFA 4N9UA 3ADZA 4DXJA 4UMJA 4JVJF 3WE9A 3AQ0A 5HNAA 2F89F 2ONGA 1UBVA 3WSBA 4KPJA 3PKOA 2E8VA 4LFGA 5ER8A 2Q58A 1V4KA 3AQCB 3ICZA 4MC0A 3WCHA 3IBAA 3SDQA 3N3LF 4OMHA 5E8HA 3AQBB 2F92F 1N22A 4XQSF 3ASXA 1YHKA 3CP6A 1VG2A 4KWDA 3Q1OA 3BNXA 5AHUB 3LGKA 1WL2A 4F6VA 4LZ3A 4L2XF 3WCDA 4KUXA 4RXCA 2F94F 4KQUA 4P0WA 5DGSF 4N1ZF 1YHLA 5A0JA 3DYHA 3DYGA 3KRCA 3M02A 4H5DF 1KIYA 5DJPF 5CG6A 3N49F 3RYEA 5DGMF 3OYRA 5B0JA 3LOMA 2E90A 2H8OA 3WJOA 3WEFA 1HX9A 1YV5A 1JFAA 1RQJA 4LTZA 3P5PA 4F6XA 4XQTF 2E95A 4QXSF 3RYWA 2RAHA 5IK6A 5B0IA 2O1OA 1WMWA 3MAVA 2AELA 2Z50A 4KQSA 2AETA 3IPIA 5IKHA 3P41A 4E9UA 5I1UA 1DGPA 4NFJF 4ZQ8A 3WCLA 2E8WA 1N1BA 4LIXA 5B0KA 3LLWA 1YJ4A 4MC3A 3N3DA 1WL1A 3TFPA 5JA0F 2DH4A 5B00A 5ILZA 3WCIA 2E91A 3RBMA 5B01A 2OPMA 5ILJA 1ZW5A 4KQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILK A;  4KVI A;  4DI5 A;  3SDR A;  3WEK A;  3NPR A;  5DHI A;  5IL8 A;  2F8C F;  3KB9 A;  5B0L A;  5IK0 A;  3M01 A;  3QQV A;  3ZMB A;  4LA6 A;  2I19 A;  4QPF A;  4WK5 A;  3OAB B;  3CC9 A;  3LZ9 A;  3LJI A;  4JZX A;  3LMD A;  2AEK A;  1WL3 A;  4H5C F;  3PYA A;  4RNQ A;  3KRF A;  1YYQ A;  4LZ0 A;  3N5J F;  2OPN A;  4OKM A;  4KVY A;  1UBW A;  4HD1 A;  2FTZ A;  3PYB A;  3APZ A;  3KRO A;  3G4F A;  2EWG A;  4JZB A;  3LSN A;  4DWB A;  3N1V F;  3ICN A;  4PVY F;  5EAU A;  1VG7 A;  3ID0 A;  2AZK A;  4LTV A;  3M00 A;  5KSX F;  3WC9 A;  3W7F A;  3KRO B;  3BNY A;  3KRP A;  4NFK F;  1KIZ A;  4LUU A;  1PS1 A;  2J1P A;  2E93 A;  5HN8 A;  3ZCD A;  4LFV F;  4JYX A;  3KRA A;  3WSA A;  2VF6 A;  2ZEV A;  1VG4 A;  4GAX A;  1V4E A;  4LPG F;  3LG5 A;  2F9K F;  5IVG A;  3WCE A;  3S9V A;  3KRC B;  1V4I A;  4P0V A;  4XQR F;  1HM7 A;  1WY0 A;  3N6K F;  5ILY A;  5IMP A;  3WCA A;  2PS4 A;  3G4D A;  3VJB A;  4KK2 A;  4NFI F;  5DJR F;  3P8L A;  5IK9 A;  2PS7 A;  4F62 A;  3WEJ A;  3CKE A;  2OGD A;  2ONH A;  5B03 A;  3QKC A;  3TC1 A;  3UCA A;  5EAT A;  4LLS A;  1RTR A;  3EFQ A;  2ZCR A;  3NPK A;  4GP2 A;  3Q2Z A;  5HN7 A;  3WJN A;  1UBY A;  3TFV A;  4RXA A;  3SDT A;  1HXG A;  1N20 A;  3N1W F;  1N21 A;  3V1X A;  3ZOU A;  3WJK A;  4LOB A;  4JXN A;  3ZL6 A;  4LA5 A;  3VJE A;  2P1C A;  3N5H F;  1VG6 A;  3WCM A;  5DIQ F;  3OAC A;  2F7M F;  2Z4V A;  2PS6 A;  3WEG A;  2FOR A;  1V4J A;  3SDU A;  3ACY A;  3PH7 A;  3VJD A;  3N0F A;  2ZCQ A;  5A0K A;  3TS7 A;  1FPS A;  1DI1 A;  2ZEU A;  4KKM A;  1V4H A;  3ICM A;  2Z4Y A;  4GP1 A;  4DZW A;  4LPH F;  4Q23 A;  3S4J A;  2OA6 A;  4RXE A;  4P0X A;  3KRF B;  1YQ7 A;  5B0M A;  4KVW A;  3B7L A;  3LEE A;  3WCF A;  2J1O A;  2Q9Z A;  2Q80 A;  5A0I A;  3M9U A;  2E8T A;  3TFN A;  4DWG A;  5HN9 A;  3EZ3 A;  3P5R A;  2ZY1 A;  5JUZ F;  4E9Z A;  2Z78 A;  4KVD A;  3PDE A;  3ACX A;  2E8X A;  5IL3 A;  3KBK A;  3ZMC A;  3VJA A;  3LDW A;  3LGZ B;  5AEL A;  1EZF A;  3KRP B;  4DEM F;  1YYR A;  5ERM A;  5E8L A;  3VJ9 A;  5JV0 F;  4RYP A;  4LZC A;  2PS5 A;  3KRA B;  4LLT A;  5DHK A;  3ACW A;  5DW7 A;  1YYU A;  4FP4 A;  4EA0 A;  3N46 F;  2E92 A;  1VG3 A;  2Z52 A;  2Z4W A;  5JV1 F;  5DZ2 A;  4KPD A;  5EAS A;  2ZCS A;  3DYF A;  2E8U A;  2Z4X A;  3NRI A;  3V66 A;  3VJC A;  3SAE A;  5ILH A;  2QIS A;  3Q2Q A;  5ILD A;  3WCB A;  4FJQ A;  4RXD A;  5H9D A;  4LXW A;  1HXA A;  3WCJ A;  2AZJ A;  1JFG A;  1YYT A;  1N23 A;  3MZV A;  4H5E F;  5CG5 A;  2E94 A;  3RMG A;  3EGT A;  5ILI A;  4OMG A;  4KFA A;  1WL0 A;  4JXY A;  3SDV A;  4E1E A;  3V1V A;  5IMN A;  1YHM A;  1YYS A;  5C05 A;  1N24 A;  1HM4 A;  2Z4Z A;  3WEH A;  4MC8 A;  5E8K A;  4K10 A;  3NF2 A;  4NG6 A;  5IMI A;  1N1Z A;  3LVS A;  4NUA A;  3Q30 A;  4PVX F;  5IN8 A;  5AYP A;  3ICK A;  5ERO A;  2J5C A;  3WCC A;  4DHD A;  4NKE A;  4OGU A;  1WKZ A;  3OAB A;  5DJV F;  3AE0 A;  5IM1 A;  4OKZ A;  1RQI A;  2Z7H A;  1UBX A;  2PS8 A;  3OAC B;  3M0G A;  4EA2 A;  5JV2 F;  3N45 F;  3VJ8 A;  2AZL A;  5IKA A;  3WEI A;  3N0G A;  5ERN A;  1HXC A;  4EA1 A;  5AFX A;  2E4O A;  2Z7I A;  3LK5 A;  4LFE A;  2ZCO A;  5DGN F;  5B02 A;  3WCG A;  2F8Z F;  2Q9Y A;  4GA3 A;  3P8R A;  4NKF A;  4N9U A;  3ADZ A;  4DXJ A;  4UMJ A;  4JVJ F;  3WE9 A;  3AQ0 A;  5HNA A;  2F89 F;  2ONG A;  1UBV A;  3WSB A;  4KPJ A;  3PKO A;  2E8V A;  4LFG A;  5ER8 A;  2Q58 A;  1V4K A;  3AQC B;  3ICZ A;  4MC0 A;  3WCH A;  3IBA A;  3SDQ A;  3N3L F;  4OMH A;  5E8H A;  3AQB B;  2F92 F;  1N22 A;  4XQS F;  3ASX A;  1YHK A;  3CP6 A;  1VG2 A;  4KWD A;  3Q1O A;  3BNX A;  5AHU B;  3LGK A;  1WL2 A;  4F6V A;  4LZ3 A;  4L2X F;  3WCD A;  4KUX A;  4RXC A;  2F94 F;  4KQU A;  4P0W A;  5DGS F;  4N1Z F;  1YHL A;  5A0J A;  3DYH A;  3DYG A;  3KRC A;  3M02 A;  4H5D F;  1KIY A;  5DJP F;  5CG6 A;  3N49 F;  3RYE A;  5DGM F;  3OYR A;  5B0J A;  3LOM A;  2E90 A;  2H8O A;  3WJO A;  3WEF A;  1HX9 A;  1YV5 A;  1JFA A;  1RQJ A;  4LTZ A;  3P5P A;  4F6X A;  4XQT F;  2E95 A;  4QXS F;  3RYW A;  2RAH A;  5IK6 A;  5B0I A;  2O1O A;  1WMW A;  3MAV A;  2AEL A;  2Z50 A;  4KQS A;  2AET A;  3IPI A;  5IKH A;  3P41 A;  4E9U A;  5I1U A;  1DGP A;  4NFJ F;  4ZQ8 A;  3WCL A;  2E8W A;  1N1B A;  4LIX A;  5B0K A;  3LLW A;  1YJ4 A;  4MC3 A;  3N3D A;  1WL1 A;  3TFP A;  5JA0 F;  2DH4 A;  5B00 A;  5ILZ A;  3WCI A;  2E91 A;  3RBM A;  5B01 A;  2OPM A;  5ILJ A;  1ZW5 A;  4KQ5 A; 
#chains in the Genus database with same CATH topology
 5ILK A;  4KVI A;  4DI5 A;  3SDR A;  3WEK A;  3NPR A;  5DHI A;  5IL8 A;  2F8C F;  3KB9 A;  5B0L A;  5IK0 A;  3M01 A;  3QQV A;  3ZMB A;  4LA6 A;  2I19 A;  4QPF A;  4WK5 A;  3OAB B;  3CC9 A;  3LZ9 A;  3LJI A;  4JZX A;  3LMD A;  2AEK A;  1WL3 A;  4H5C F;  3PYA A;  4RNQ A;  3KRF A;  1YYQ A;  4LZ0 A;  3N5J F;  2OPN A;  4OKM A;  4KVY A;  1UBW A;  4HD1 A;  2FTZ A;  3PYB A;  3APZ A;  3KRO A;  3G4F A;  2EWG A;  4JZB A;  3LSN A;  4DWB A;  3N1V F;  3ICN A;  4PVY F;  5EAU A;  1VG7 A;  3ID0 A;  2AZK A;  4LTV A;  3M00 A;  5KSX F;  3WC9 A;  3W7F A;  3KRO B;  3BNY A;  3KRP A;  4NFK F;  1KIZ A;  4LUU A;  1PS1 A;  2J1P A;  2E93 A;  5HN8 A;  3ZCD A;  4LFV F;  4JYX A;  3KRA A;  3WSA A;  2VF6 A;  2ZEV A;  1VG4 A;  4GAX A;  1V4E A;  4LPG F;  3LG5 A;  2F9K F;  5IVG A;  3WCE A;  3S9V A;  3KRC B;  1V4I A;  4P0V A;  4XQR F;  1HM7 A;  1WY0 A;  3N6K F;  5ILY A;  5IMP A;  3WCA A;  2PS4 A;  3G4D A;  3VJB A;  4KK2 A;  4NFI F;  5DJR F;  3P8L A;  5IK9 A;  2PS7 A;  4F62 A;  3WEJ A;  3CKE A;  2OGD A;  2ONH A;  5B03 A;  3QKC A;  3TC1 A;  3UCA A;  5EAT A;  4LLS A;  1RTR A;  3EFQ A;  2ZCR A;  3NPK A;  4GP2 A;  3Q2Z A;  5HN7 A;  3WJN A;  1UBY A;  3TFV A;  4RXA A;  3SDT A;  1HXG A;  1N20 A;  3N1W F;  1N21 A;  3V1X A;  3ZOU A;  3WJK A;  4LOB A;  4JXN A;  3ZL6 A;  4LA5 A;  3VJE A;  2P1C A;  3N5H F;  1VG6 A;  3WCM A;  5DIQ F;  3OAC A;  2F7M F;  2Z4V A;  2PS6 A;  3WEG A;  2FOR A;  1V4J A;  3SDU A;  3ACY A;  3PH7 A;  3VJD A;  3N0F A;  2ZCQ A;  5A0K A;  3TS7 A;  1FPS A;  1DI1 A;  2ZEU A;  4KKM A;  1V4H A;  3ICM A;  2Z4Y A;  4GP1 A;  4DZW A;  4LPH F;  4Q23 A;  3S4J A;  2OA6 A;  4RXE A;  4P0X A;  3KRF B;  1YQ7 A;  5B0M A;  4KVW A;  3B7L A;  3LEE A;  3WCF A;  2J1O A;  2Q9Z A;  2Q80 A;  5A0I A;  3M9U A;  2E8T A;  3TFN A;  4DWG A;  5HN9 A;  3EZ3 A;  3P5R A;  2ZY1 A;  5JUZ F;  4E9Z A;  2Z78 A;  4KVD A;  3PDE A;  3ACX A;  2E8X A;  5IL3 A;  3KBK A;  3ZMC A;  3VJA A;  3LDW A;  3LGZ B;  5AEL A;  1EZF A;  3KRP B;  4DEM F;  1YYR A;  5ERM A;  5E8L A;  3VJ9 A;  5JV0 F;  4RYP A;  4LZC A;  2PS5 A;  3KRA B;  4LLT A;  5DHK A;  3ACW A;  5DW7 A;  1YYU A;  4FP4 A;  4EA0 A;  3N46 F;  2E92 A;  1VG3 A;  2Z52 A;  2Z4W A;  5JV1 F;  5DZ2 A;  4KPD A;  5EAS A;  2ZCS A;  3DYF A;  2E8U A;  2Z4X A;  3NRI A;  3V66 A;  3VJC A;  3SAE A;  5ILH A;  2QIS A;  3Q2Q A;  5ILD A;  3WCB A;  4FJQ A;  4RXD A;  5H9D A;  4LXW A;  1HXA A;  3WCJ A;  2AZJ A;  1JFG A;  1YYT A;  1N23 A;  3MZV A;  4H5E F;  5CG5 A;  2E94 A;  3RMG A;  3EGT A;  5ILI A;  4OMG A;  4KFA A;  1WL0 A;  4JXY A;  3SDV A;  4E1E A;  3V1V A;  5IMN A;  1YHM A;  1YYS A;  5C05 A;  1N24 A;  1HM4 A;  2Z4Z A;  3WEH A;  4MC8 A;  5E8K A;  4K10 A;  3NF2 A;  4NG6 A;  5IMI A;  1N1Z A;  3LVS A;  4NUA A;  3Q30 A;  4PVX F;  5IN8 A;  5AYP A;  3ICK A;  5ERO A;  2J5C A;  3WCC A;  4DHD A;  4NKE A;  4OGU A;  1WKZ A;  3OAB A;  5DJV F;  3AE0 A;  5IM1 A;  4OKZ A;  1RQI A;  2Z7H A;  1UBX A;  2PS8 A;  3OAC B;  3M0G A;  4EA2 A;  5JV2 F;  3N45 F;  3VJ8 A;  2AZL A;  5IKA A;  3WEI A;  3N0G A;  5ERN A;  1HXC A;  4EA1 A;  5AFX A;  2E4O A;  2Z7I A;  3LK5 A;  4LFE A;  2ZCO A;  5DGN F;  5B02 A;  3WCG A;  2F8Z F;  2Q9Y A;  4GA3 A;  3P8R A;  4NKF A;  4N9U A;  3ADZ A;  4DXJ A;  4UMJ A;  4JVJ F;  3WE9 A;  3AQ0 A;  5HNA A;  2F89 F;  2ONG A;  1UBV A;  3WSB A;  4KPJ A;  3PKO A;  2E8V A;  4LFG A;  5ER8 A;  2Q58 A;  1V4K A;  3AQC B;  3ICZ A;  4MC0 A;  3WCH A;  3IBA A;  3SDQ A;  3N3L F;  4OMH A;  5E8H A;  3AQB B;  2F92 F;  1N22 A;  4XQS F;  3ASX A;  1YHK A;  3CP6 A;  1VG2 A;  4KWD A;  3Q1O A;  3BNX A;  5AHU B;  3LGK A;  1WL2 A;  4F6V A;  4LZ3 A;  4L2X F;  3WCD A;  4KUX A;  4RXC A;  2F94 F;  4KQU A;  4P0W A;  5DGS F;  4N1Z F;  1YHL A;  5A0J A;  3DYH A;  3DYG A;  3KRC A;  3M02 A;  4H5D F;  1KIY A;  5DJP F;  5CG6 A;  3N49 F;  3RYE A;  5DGM F;  3OYR A;  5B0J A;  3LOM A;  2E90 A;  2H8O A;  3WJO A;  3WEF A;  1HX9 A;  1YV5 A;  1JFA A;  1RQJ A;  4LTZ A;  3P5P A;  4F6X A;  4XQT F;  2E95 A;  4QXS F;  3RYW A;  2RAH A;  5IK6 A;  5B0I A;  2O1O A;  1WMW A;  3MAV A;  2AEL A;  2Z50 A;  4KQS A;  2AET A;  3IPI A;  5IKH A;  3P41 A;  4E9U A;  5I1U A;  1DGP A;  4NFJ F;  4ZQ8 A;  3WCL A;  2E8W A;  1N1B A;  4LIX A;  5B0K A;  3LLW A;  1YJ4 A;  4MC3 A;  3N3D A;  1WL1 A;  3TFP A;  5JA0 F;  2DH4 A;  5B00 A;  5ILZ A;  3WCI A;  2E91 A;  3RBM A;  5B01 A;  2OPM A;  5ILJ A;  1ZW5 A;  4KQ5 A; 
#chains in the Genus database with same CATH homology
 5ILK A;  4KVI A;  4DI5 A;  3SDR A;  3WEK A;  3NPR A;  5DHI A;  5IL8 A;  2F8C F;  3KB9 A;  5B0L A;  5IK0 A;  3M01 A;  3QQV A;  3ZMB A;  4LA6 A;  2I19 A;  4QPF A;  4WK5 A;  3OAB B;  3CC9 A;  3LZ9 A;  3LJI A;  4JZX A;  3LMD A;  2AEK A;  1WL3 A;  4H5C F;  3PYA A;  4RNQ A;  3KRF A;  1YYQ A;  4LZ0 A;  3N5J F;  2OPN A;  4OKM A;  4KVY A;  1UBW A;  4HD1 A;  2FTZ A;  3PYB A;  3APZ A;  3KRO A;  3G4F A;  2EWG A;  4JZB A;  3LSN A;  4DWB A;  3N1V F;  3ICN A;  4PVY F;  5EAU A;  1VG7 A;  3ID0 A;  2AZK A;  4LTV A;  3M00 A;  5KSX F;  3WC9 A;  3W7F A;  3KRO B;  3BNY A;  3KRP A;  4NFK F;  1KIZ A;  4LUU A;  1PS1 A;  2J1P A;  2E93 A;  5HN8 A;  3ZCD A;  4LFV F;  4JYX A;  3KRA A;  3WSA A;  2VF6 A;  2ZEV A;  1VG4 A;  4GAX A;  1V4E A;  4LPG F;  3LG5 A;  2F9K F;  5IVG A;  3WCE A;  3S9V A;  3KRC B;  1V4I A;  4P0V A;  4XQR F;  1HM7 A;  1WY0 A;  3N6K F;  5ILY A;  5IMP A;  3WCA A;  2PS4 A;  3G4D A;  3VJB A;  4KK2 A;  4NFI F;  5DJR F;  3P8L A;  5IK9 A;  2PS7 A;  4F62 A;  3WEJ A;  3CKE A;  2OGD A;  2ONH A;  5B03 A;  3QKC A;  3TC1 A;  3UCA A;  5EAT A;  4LLS A;  1RTR A;  3EFQ A;  2ZCR A;  3NPK A;  4GP2 A;  3Q2Z A;  5HN7 A;  3WJN A;  1UBY A;  3TFV A;  4RXA A;  3SDT A;  1HXG A;  1N20 A;  3N1W F;  1N21 A;  3V1X A;  3ZOU A;  3WJK A;  4LOB A;  4JXN A;  3ZL6 A;  4LA5 A;  3VJE A;  2P1C A;  3N5H F;  1VG6 A;  3WCM A;  5DIQ F;  3OAC A;  2F7M F;  2Z4V A;  2PS6 A;  3WEG A;  2FOR A;  1V4J A;  3SDU A;  3ACY A;  3PH7 A;  3VJD A;  3N0F A;  2ZCQ A;  5A0K A;  3TS7 A;  1FPS A;  1DI1 A;  2ZEU A;  4KKM A;  1V4H A;  3ICM A;  2Z4Y A;  4GP1 A;  4DZW A;  4LPH F;  4Q23 A;  3S4J A;  2OA6 A;  4RXE A;  4P0X A;  3KRF B;  1YQ7 A;  5B0M A;  4KVW A;  3B7L A;  3LEE A;  3WCF A;  2J1O A;  2Q9Z A;  2Q80 A;  5A0I A;  3M9U A;  2E8T A;  3TFN A;  4DWG A;  5HN9 A;  3EZ3 A;  3P5R A;  2ZY1 A;  5JUZ F;  4E9Z A;  2Z78 A;  4KVD A;  3PDE A;  3ACX A;  2E8X A;  5IL3 A;  3KBK A;  3ZMC A;  3VJA A;  3LDW A;  3LGZ B;  5AEL A;  1EZF A;  3KRP B;  4DEM F;  1YYR A;  5ERM A;  5E8L A;  3VJ9 A;  5JV0 F;  4RYP A;  4LZC A;  2PS5 A;  3KRA B;  4LLT A;  5DHK A;  3ACW A;  5DW7 A;  1YYU A;  4FP4 A;  4EA0 A;  3N46 F;  2E92 A;  1VG3 A;  2Z52 A;  2Z4W A;  5JV1 F;  5DZ2 A;  4KPD A;  5EAS A;  2ZCS A;  3DYF A;  2E8U A;  2Z4X A;  3NRI A;  3V66 A;  3VJC A;  3SAE A;  5ILH A;  2QIS A;  3Q2Q A;  5ILD A;  3WCB A;  4FJQ A;  4RXD A;  5H9D A;  4LXW A;  1HXA A;  3WCJ A;  2AZJ A;  1JFG A;  1YYT A;  1N23 A;  3MZV A;  4H5E F;  5CG5 A;  2E94 A;  3RMG A;  3EGT A;  5ILI A;  4OMG A;  4KFA A;  1WL0 A;  4JXY A;  3SDV A;  4E1E A;  3V1V A;  5IMN A;  1YHM A;  1YYS A;  5C05 A;  1N24 A;  1HM4 A;  2Z4Z A;  3WEH A;  4MC8 A;  5E8K A;  4K10 A;  3NF2 A;  4NG6 A;  5IMI A;  1N1Z A;  3LVS A;  4NUA A;  3Q30 A;  4PVX F;  5IN8 A;  5AYP A;  3ICK A;  5ERO A;  2J5C A;  3WCC A;  4DHD A;  4NKE A;  4OGU A;  1WKZ A;  3OAB A;  5DJV F;  3AE0 A;  5IM1 A;  4OKZ A;  1RQI A;  2Z7H A;  1UBX A;  2PS8 A;  3OAC B;  3M0G A;  4EA2 A;  5JV2 F;  3N45 F;  3VJ8 A;  2AZL A;  5IKA A;  3WEI A;  3N0G A;  5ERN A;  1HXC A;  4EA1 A;  5AFX A;  2E4O A;  2Z7I A;  3LK5 A;  4LFE A;  2ZCO A;  5DGN F;  5B02 A;  3WCG A;  2F8Z F;  2Q9Y A;  4GA3 A;  3P8R A;  4NKF A;  4N9U A;  3ADZ A;  4DXJ A;  4UMJ A;  4JVJ F;  3WE9 A;  3AQ0 A;  5HNA A;  2F89 F;  2ONG A;  1UBV A;  3WSB A;  4KPJ A;  3PKO A;  2E8V A;  4LFG A;  5ER8 A;  2Q58 A;  1V4K A;  3AQC B;  3ICZ A;  4MC0 A;  3WCH A;  3IBA A;  3SDQ A;  3N3L F;  4OMH A;  5E8H A;  3AQB B;  2F92 F;  1N22 A;  4XQS F;  3ASX A;  1YHK A;  3CP6 A;  1VG2 A;  4KWD A;  3Q1O A;  3BNX A;  5AHU B;  3LGK A;  1WL2 A;  4F6V A;  4LZ3 A;  4L2X F;  3WCD A;  4KUX A;  4RXC A;  2F94 F;  4KQU A;  4P0W A;  5DGS F;  4N1Z F;  1YHL A;  5A0J A;  3DYH A;  3DYG A;  3KRC A;  3M02 A;  4H5D F;  1KIY A;  5DJP F;  5CG6 A;  3N49 F;  3RYE A;  5DGM F;  3OYR A;  5B0J A;  3LOM A;  2E90 A;  2H8O A;  3WJO A;  3WEF A;  1HX9 A;  1YV5 A;  1JFA A;  1RQJ A;  4LTZ A;  3P5P A;  4F6X A;  4XQT F;  2E95 A;  4QXS F;  3RYW A;  2RAH A;  5IK6 A;  5B0I A;  2O1O A;  1WMW A;  3MAV A;  2AEL A;  2Z50 A;  4KQS A;  2AET A;  3IPI A;  5IKH A;  3P41 A;  4E9U A;  5I1U A;  1DGP A;  4NFJ F;  4ZQ8 A;  3WCL A;  2E8W A;  1N1B A;  4LIX A;  5B0K A;  3LLW A;  1YJ4 A;  4MC3 A;  3N3D A;  1WL1 A;  3TFP A;  5JA0 F;  2DH4 A;  5B00 A;  5ILZ A;  3WCI A;  2E91 A;  3RBM A;  5B01 A;  2OPM A;  5ILJ A;  1ZW5 A;  4KQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...