4KVWA

Crystal structure of aspergillus terreus aristolochene synthase complexed with (3r,6r,9ar)-6,9a-dimethyl-3-(prop-1-en-2-yl)decahydroquinolizin-5-ium
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
304
structure length
304
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Aristolochene synthase
publication title Mechanistic insights from the binding of substrate and carbocation intermediate analogues to aristolochene synthase.
pubmed doi rcsb
source organism Aspergillus terreus
total genus 132
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2013-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4kvwA00
5ILJA 2I19A 4OMGA 5DHKA 3ZOUA 4OGUA 1YJ4A 3PDEA 5ILHA 5DGSF 3N5JF 3WCFA 3LJIA 2PS4A 3WEIA 1HM7A 3KRFB 3PKOA 2AZLA 2P1CA 2Z4WA 3VJ8A 3PYAA 3NPRA 3WCHA 4LZ0A 4DZWA 2FTZA 3MZVA 4H5EF 4OMHA 5HN9A 2E93A 5E8HA 3ZL6A 2ZCRA 3B7LA 2E4OA 3SAEA 3WEGA 4JXYA 5IKHA 2Z4VA 4DEMF 5B0KA 5DJPF 2F9KF 4LXWA 3OACA 3N1WF 1YQ7A 1DGPA 3VJBA 5IMPA 3LEEA 3VJAA 5B02A 1VG4A 3WSAA 5JA0F 4LZ3A 3CC9A 2OPNA 4JZBA 4KWDA 5B0MA 2Q9YA 5B00A 3KRAB 3DYFA 5IK9A 3VJCA 3M9UA 3LMDA 4KKMA 4LUUA 3N1VF 1ZW5A 3CP6A 2AZJA 2E92A 2E95A 3NF2A 3P5RA 2E8XA 4N1ZF 4DHDA 3SDUA 1V4IA 1RQJA 3UCAA 3DYGA 3EGTA 2ZCQA 5EATA 4NKEA 2ZEVA 2PS8A 2AEKA 3WEHA 1V4HA 4NUAA 1N1BA 3KRFA 5DIQF 3QKCA 5I1UA 3N46F 2J5CA 4JZXA 2F8ZF 4JXNA 3P8RA 4LPHF 3RYWA 2J1PA 5E8KA 3ICMA 4NG6A 3LSNA 1HXAA 2QISA 2EWGA 3ICZA 4H5DF 4RXEA 5IN8A 1JFAA 5JV0F 4P0XA 5ER8A 5B01A 2Z7IA 3ACXA 3N0FA 3WEKA 1WL0A 5C05A 3PH7A 4NFIF 3M01A 3BNXA 3V1XA 1YHMA 4KQSA 2OPMA 3LOMA 4KQUA 2PS6A 3RBMA 4DXJA 4LPGF 1UBYA 4WK5A 1UBVA 1VG6A 3ZMBA 5IL3A 5ERMA 3SDRA 3LGKA 3Q2QA 3IPIA 5AFXA 4Q23A 1V4EA 3ID0A 5ILIA 5EASA 3N45F 3KRCB 3WCDA 5JV2F 2Q9ZA 5ERNA 3P8LA 4RXCA 1YYTA 4K10A 5ILDA 2F89F 4NKFA 2ONGA 1N21A 1WMWA 3ZCDA 1V4JA 4XQTF 2OA6A 2DH4A 4KFAA 4XQRF 3OABB 3Q30A 3WC9A 3OYRA 4E9UA 4JYXA 3N3DA 2VF6A 2ZCOA 3WEJA 1YHKA 4LLSA 5DW7A 4RYPA 3WJNA 1HXGA 4LA5A 3LLWA 3P5PA 2J1OA 5ILYA 4LTVA 3RYEA 3MAVA 2Z50A 4LLTA 5IMIA 3AE0A 5DHIA 3KB9A 4XQSF 4FP4A 3TFPA 1YV5A 1YHLA 2OGDA 3S9VA 3PYBA 3WCEA 4DI5A 2Q58A 5HNAA 4RXDA 4E9ZA 5HN8A 4HD1A 3VJEA 4UMJA 1N20A 4EA1A 3SDVA 3LG5A 4KPDA 2PS5A 4DWBA 5KSXF 3P41A 4QPFA 4LFVF 3WEFA 3G4FA 5CG6A 4MC8A 1N23A 4PVYF 5AYPA 1KIZA 3ASXA 1N24A 2E94A 3EFQA 4OKMA 4QXSF 4LFEA 4GP1A 3Q2ZA 2PS7A 2Z4YA 3M0GA 3WE9A 5JV1F 3Q1OA 3WCLA 4KQ5A 3M02A 4N9UA 2ZEUA 4EA2A 2F94F 5DZ2A 2E8UA 2Z7HA 3AQBB 3RMGA 3OACB 5IKAA 1YYQA 3WSBA 3ACYA 2FORA 1HM4A 3KRAA 5CG5A 1YYRA 3VJ9A 3N3LF 1WL1A 4KK2A 2AZKA 3G4DA 2Z78A 5EROA 4EA0A 3WCMA 1EZFA 4OKZA 2RAHA 3WCGA 5AHUB 4RXAA 4KVDA 5IVGA 3WJOA 4NFJF 3ICNA 3SDTA 2F7MF 3AQCB 1N1ZA 5B0JA 5ILZA 3N49F 1RTRA 2E90A 3KRPB 1HX9A 5ILKA 1WL3A 5B03A 2Z4ZA 3N5HF 5DGMF 5DJVF 3BNYA 4GAXA 4ZQ8A 3LK5A 3ACWA 4F6XA 2E8WA 3WJKA 5IM1A 2Q80A 4P0WA 1HXCA 4FJQA 1VG2A 2ZY1A 3WCCA 1VG7A 3WCBA 1WL2A 5B0LA 5A0KA 2F8CF 1DI1A 2E8TA 4F6VA 3LVSA 3TS7A 5A0JA 4L2XF 5HN7A 3KROB 4RNQA 5IK0A 3M00A 4JVJF 1VG3A 1YYUA 2ZCSA 1KIYA 5DJRF 4P0VA 5IK6A 3EZ3A 1WKZA 3KRCA 4LOBA 4GP2A 3IBAA 3DYHA 2AELA 4MC3A 4KVIA 3LDWA 4LTZA 3W7FA 2AETA 2F92F 2E8VA 5IL8A 3V66A 3V1VA 4KUXA 2E91A 3TFNA 3ZMCA 3TC1A 1N22A 4H5CF 3KRPA 4PVXF 3OABA 5JUZF 5DGNF 3APZA 3N6KF 3ICKA 3KBKA 1JFGA 4LIXA 1RQIA 1WY0A 4F62A 3WCAA 3VJDA 1FPSA 3N0GA 4GA3A 3TFVA 2H8OA 1V4KA 3WCIA 1YYSA 3AQ0A 4KVYA 3ADZA 5E8LA 5EAUA 2ONHA 3NRIA 3WCJA 1UBXA 5H9DA 4DWGA 4LZCA 3S4JA 5AELA 2Z52A 4LA6A 2Z4XA 4MC0A 3QQVA 1UBWA 2O1OA 3SDQA 3KROA 3LGZB 4KVWA 3LZ9A 4NFKF 5IMNA 1PS1A 4KPJA 5A0IA 3CKEA 4E1EA 5B0IA 3NPKA 4LFGA
chains in the Genus database with same CATH superfamily
5ILJA 2I19A 4OMGA 5DHKA 3ZOUA 4OGUA 1YJ4A 3PDEA 5ILHA 5DGSF 3N5JF 3WCFA 3LJIA 2PS4A 3WEIA 1HM7A 3KRFB 3PKOA 2AZLA 2P1CA 2Z4WA 3VJ8A 3PYAA 3NPRA 3WCHA 4LZ0A 4DZWA 2FTZA 3MZVA 4H5EF 4OMHA 5HN9A 2E93A 5E8HA 3ZL6A 2ZCRA 3B7LA 2E4OA 3SAEA 3WEGA 4JXYA 5IKHA 2Z4VA 4DEMF 5B0KA 5DJPF 2F9KF 4LXWA 3OACA 3N1WF 1YQ7A 1DGPA 3VJBA 5IMPA 3LEEA 3VJAA 5B02A 1VG4A 3WSAA 5JA0F 4LZ3A 3CC9A 2OPNA 4JZBA 4KWDA 5B0MA 2Q9YA 5B00A 3KRAB 3DYFA 5IK9A 3VJCA 3M9UA 3LMDA 4KKMA 4LUUA 3N1VF 1ZW5A 3CP6A 2AZJA 2E92A 2E95A 3NF2A 3P5RA 2E8XA 4N1ZF 4DHDA 3SDUA 1V4IA 1RQJA 3UCAA 3DYGA 3EGTA 2ZCQA 5EATA 4NKEA 2ZEVA 2PS8A 2AEKA 3WEHA 1V4HA 4NUAA 1N1BA 3KRFA 5DIQF 3QKCA 5I1UA 3N46F 2J5CA 4JZXA 2F8ZF 4JXNA 3P8RA 4LPHF 3RYWA 2J1PA 5E8KA 3ICMA 4NG6A 3LSNA 1HXAA 2QISA 2EWGA 3ICZA 4H5DF 4RXEA 5IN8A 1JFAA 5JV0F 4P0XA 5ER8A 5B01A 2Z7IA 3ACXA 3N0FA 3WEKA 1WL0A 5C05A 3PH7A 4NFIF 3M01A 3BNXA 3V1XA 1YHMA 4KQSA 2OPMA 3LOMA 4KQUA 2PS6A 3RBMA 4DXJA 4LPGF 1UBYA 4WK5A 1UBVA 1VG6A 3ZMBA 5IL3A 5ERMA 3SDRA 3LGKA 3Q2QA 3IPIA 5AFXA 4Q23A 1V4EA 3ID0A 5ILIA 5EASA 3N45F 3KRCB 3WCDA 5JV2F 2Q9ZA 5ERNA 3P8LA 4RXCA 1YYTA 4K10A 5ILDA 2F89F 4NKFA 2ONGA 1N21A 1WMWA 3ZCDA 1V4JA 4XQTF 2OA6A 2DH4A 4KFAA 4XQRF 3OABB 3Q30A 3WC9A 3OYRA 4E9UA 4JYXA 3N3DA 2VF6A 2ZCOA 3WEJA 1YHKA 4LLSA 5DW7A 4RYPA 3WJNA 1HXGA 4LA5A 3LLWA 3P5PA 2J1OA 5ILYA 4LTVA 3RYEA 3MAVA 2Z50A 4LLTA 5IMIA 3AE0A 5DHIA 3KB9A 4XQSF 4FP4A 3TFPA 1YV5A 1YHLA 2OGDA 3S9VA 3PYBA 3WCEA 4DI5A 2Q58A 5HNAA 4RXDA 4E9ZA 5HN8A 4HD1A 3VJEA 4UMJA 1N20A 4EA1A 3SDVA 3LG5A 4KPDA 2PS5A 4DWBA 5KSXF 3P41A 4QPFA 4LFVF 3WEFA 3G4FA 5CG6A 4MC8A 1N23A 4PVYF 5AYPA 1KIZA 3ASXA 1N24A 2E94A 3EFQA 4OKMA 4QXSF 4LFEA 4GP1A 3Q2ZA 2PS7A 2Z4YA 3M0GA 3WE9A 5JV1F 3Q1OA 3WCLA 4KQ5A 3M02A 4N9UA 2ZEUA 4EA2A 2F94F 5DZ2A 2E8UA 2Z7HA 3AQBB 3RMGA 3OACB 5IKAA 1YYQA 3WSBA 3ACYA 2FORA 1HM4A 3KRAA 5CG5A 1YYRA 3VJ9A 3N3LF 1WL1A 4KK2A 2AZKA 3G4DA 2Z78A 5EROA 4EA0A 3WCMA 1EZFA 4OKZA 2RAHA 3WCGA 5AHUB 4RXAA 4KVDA 5IVGA 3WJOA 4NFJF 3ICNA 3SDTA 2F7MF 3AQCB 1N1ZA 5B0JA 5ILZA 3N49F 1RTRA 2E90A 3KRPB 1HX9A 5ILKA 1WL3A 5B03A 2Z4ZA 3N5HF 5DGMF 5DJVF 3BNYA 4GAXA 4ZQ8A 3LK5A 3ACWA 4F6XA 2E8WA 3WJKA 5IM1A 2Q80A 4P0WA 1HXCA 4FJQA 1VG2A 2ZY1A 3WCCA 1VG7A 3WCBA 1WL2A 5B0LA 5A0KA 2F8CF 1DI1A 2E8TA 4F6VA 3LVSA 3TS7A 5A0JA 4L2XF 5HN7A 3KROB 4RNQA 5IK0A 3M00A 4JVJF 1VG3A 1YYUA 2ZCSA 1KIYA 5DJRF 4P0VA 5IK6A 3EZ3A 1WKZA 3KRCA 4LOBA 4GP2A 3IBAA 3DYHA 2AELA 4MC3A 4KVIA 3LDWA 4LTZA 3W7FA 2AETA 2F92F 2E8VA 5IL8A 3V66A 3V1VA 4KUXA 2E91A 3TFNA 3ZMCA 3TC1A 1N22A 4H5CF 3KRPA 4PVXF 3OABA 5JUZF 5DGNF 3APZA 3N6KF 3ICKA 3KBKA 1JFGA 4LIXA 1RQIA 1WY0A 4F62A 3WCAA 3VJDA 1FPSA 3N0GA 4GA3A 3TFVA 2H8OA 1V4KA 3WCIA 1YYSA 3AQ0A 4KVYA 3ADZA 5E8LA 5EAUA 2ONHA 3NRIA 3WCJA 1UBXA 5H9DA 4DWGA 4LZCA 3S4JA 5AELA 2Z52A 4LA6A 2Z4XA 4MC0A 3QQVA 1UBWA 2O1OA 3SDQA 3KROA 3LGZB 4KVWA 3LZ9A 4NFKF 5IMNA 1PS1A 4KPJA 5A0IA 3CKEA 4E1EA 5B0IA 3NPKA 4LFGA
chains in the Genus database with same CATH topology
5ILJA 2I19A 4OMGA 5DHKA 3ZOUA 4OGUA 1YJ4A 3PDEA 5ILHA 5DGSF 3N5JF 3WCFA 3LJIA 2PS4A 3WEIA 1HM7A 3KRFB 3PKOA 2AZLA 2P1CA 2Z4WA 3VJ8A 3PYAA 3NPRA 3WCHA 4LZ0A 4DZWA 2FTZA 3MZVA 4H5EF 4OMHA 5HN9A 2E93A 5E8HA 3ZL6A 2ZCRA 3B7LA 2E4OA 3SAEA 3WEGA 4JXYA 5IKHA 2Z4VA 4DEMF 5B0KA 5DJPF 2F9KF 4LXWA 3OACA 3N1WF 1YQ7A 1DGPA 3VJBA 5IMPA 3LEEA 3VJAA 5B02A 1VG4A 3WSAA 5JA0F 4LZ3A 3CC9A 2OPNA 4JZBA 4KWDA 5B0MA 2Q9YA 5B00A 3KRAB 3DYFA 5IK9A 3VJCA 3M9UA 3LMDA 4KKMA 4LUUA 3N1VF 1ZW5A 3CP6A 2AZJA 2E92A 2E95A 3NF2A 3P5RA 2E8XA 4N1ZF 4DHDA 3SDUA 1V4IA 1RQJA 3UCAA 3DYGA 3EGTA 2ZCQA 5EATA 4NKEA 2ZEVA 2PS8A 2AEKA 3WEHA 1V4HA 4NUAA 1N1BA 3KRFA 5DIQF 3QKCA 5I1UA 3N46F 2J5CA 4JZXA 2F8ZF 4JXNA 3P8RA 4LPHF 3RYWA 2J1PA 5E8KA 3ICMA 4NG6A 3LSNA 1HXAA 2QISA 2EWGA 3ICZA 4H5DF 4RXEA 5IN8A 1JFAA 5JV0F 4P0XA 5ER8A 5B01A 2Z7IA 3ACXA 3N0FA 3WEKA 1WL0A 5C05A 3PH7A 4NFIF 3M01A 3BNXA 3V1XA 1YHMA 4KQSA 2OPMA 3LOMA 4KQUA 2PS6A 3RBMA 4DXJA 4LPGF 1UBYA 4WK5A 1UBVA 1VG6A 3ZMBA 5IL3A 5ERMA 3SDRA 3LGKA 3Q2QA 3IPIA 5AFXA 4Q23A 1V4EA 3ID0A 5ILIA 5EASA 3N45F 3KRCB 3WCDA 5JV2F 2Q9ZA 5ERNA 3P8LA 4RXCA 1YYTA 4K10A 5ILDA 2F89F 4NKFA 2ONGA 1N21A 1WMWA 3ZCDA 1V4JA 4XQTF 2OA6A 2DH4A 4KFAA 4XQRF 3OABB 3Q30A 3WC9A 3OYRA 4E9UA 4JYXA 3N3DA 2VF6A 2ZCOA 3WEJA 1YHKA 4LLSA 5DW7A 4RYPA 3WJNA 1HXGA 4LA5A 3LLWA 3P5PA 2J1OA 5ILYA 4LTVA 3RYEA 3MAVA 2Z50A 4LLTA 5IMIA 3AE0A 5DHIA 3KB9A 4XQSF 4FP4A 3TFPA 1YV5A 1YHLA 2OGDA 3S9VA 3PYBA 3WCEA 4DI5A 2Q58A 5HNAA 4RXDA 4E9ZA 5HN8A 4HD1A 3VJEA 4UMJA 1N20A 4EA1A 3SDVA 3LG5A 4KPDA 2PS5A 4DWBA 5KSXF 3P41A 4QPFA 4LFVF 3WEFA 3G4FA 5CG6A 4MC8A 1N23A 4PVYF 5AYPA 1KIZA 3ASXA 1N24A 2E94A 3EFQA 4OKMA 4QXSF 4LFEA 4GP1A 3Q2ZA 2PS7A 2Z4YA 3M0GA 3WE9A 5JV1F 3Q1OA 3WCLA 4KQ5A 3M02A 4N9UA 2ZEUA 4EA2A 2F94F 5DZ2A 2E8UA 2Z7HA 3AQBB 3RMGA 3OACB 5IKAA 1YYQA 3WSBA 3ACYA 2FORA 1HM4A 3KRAA 5CG5A 1YYRA 3VJ9A 3N3LF 1WL1A 4KK2A 2AZKA 3G4DA 2Z78A 5EROA 4EA0A 3WCMA 1EZFA 4OKZA 2RAHA 3WCGA 5AHUB 4RXAA 4KVDA 5IVGA 3WJOA 4NFJF 3ICNA 3SDTA 2F7MF 3AQCB 1N1ZA 5B0JA 5ILZA 3N49F 1RTRA 2E90A 3KRPB 1HX9A 5ILKA 1WL3A 5B03A 2Z4ZA 3N5HF 5DGMF 5DJVF 3BNYA 4GAXA 4ZQ8A 3LK5A 3ACWA 4F6XA 2E8WA 3WJKA 5IM1A 2Q80A 4P0WA 1HXCA 4FJQA 1VG2A 2ZY1A 3WCCA 1VG7A 3WCBA 1WL2A 5B0LA 5A0KA 2F8CF 1DI1A 2E8TA 4F6VA 3LVSA 3TS7A 5A0JA 4L2XF 5HN7A 3KROB 4RNQA 5IK0A 3M00A 4JVJF 1VG3A 1YYUA 2ZCSA 1KIYA 5DJRF 4P0VA 5IK6A 3EZ3A 1WKZA 3KRCA 4LOBA 4GP2A 3IBAA 3DYHA 2AELA 4MC3A 4KVIA 3LDWA 4LTZA 3W7FA 2AETA 2F92F 2E8VA 5IL8A 3V66A 3V1VA 4KUXA 2E91A 3TFNA 3ZMCA 3TC1A 1N22A 4H5CF 3KRPA 4PVXF 3OABA 5JUZF 5DGNF 3APZA 3N6KF 3ICKA 3KBKA 1JFGA 4LIXA 1RQIA 1WY0A 4F62A 3WCAA 3VJDA 1FPSA 3N0GA 4GA3A 3TFVA 2H8OA 1V4KA 3WCIA 1YYSA 3AQ0A 4KVYA 3ADZA 5E8LA 5EAUA 2ONHA 3NRIA 3WCJA 1UBXA 5H9DA 4DWGA 4LZCA 3S4JA 5AELA 2Z52A 4LA6A 2Z4XA 4MC0A 3QQVA 1UBWA 2O1OA 3SDQA 3KROA 3LGZB 4KVWA 3LZ9A 4NFKF 5IMNA 1PS1A 4KPJA 5A0IA 3CKEA 4E1EA 5B0IA 3NPKA 4LFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILJ A;  2I19 A;  4OMG A;  5DHK A;  3ZOU A;  4OGU A;  1YJ4 A;  3PDE A;  5ILH A;  5DGS F;  3N5J F;  3WCF A;  3LJI A;  2PS4 A;  3WEI A;  1HM7 A;  3KRF B;  3PKO A;  2AZL A;  2P1C A;  2Z4W A;  3VJ8 A;  3PYA A;  3NPR A;  3WCH A;  4LZ0 A;  4DZW A;  2FTZ A;  3MZV A;  4H5E F;  4OMH A;  5HN9 A;  2E93 A;  5E8H A;  3ZL6 A;  2ZCR A;  3B7L A;  2E4O A;  3SAE A;  3WEG A;  4JXY A;  5IKH A;  2Z4V A;  4DEM F;  5B0K A;  5DJP F;  2F9K F;  4LXW A;  3OAC A;  3N1W F;  1YQ7 A;  1DGP A;  3VJB A;  5IMP A;  3LEE A;  3VJA A;  5B02 A;  1VG4 A;  3WSA A;  5JA0 F;  4LZ3 A;  3CC9 A;  2OPN A;  4JZB A;  4KWD A;  5B0M A;  2Q9Y A;  5B00 A;  3KRA B;  3DYF A;  5IK9 A;  3VJC A;  3M9U A;  3LMD A;  4KKM A;  4LUU A;  3N1V F;  1ZW5 A;  3CP6 A;  2AZJ A;  2E92 A;  2E95 A;  3NF2 A;  3P5R A;  2E8X A;  4N1Z F;  4DHD A;  3SDU A;  1V4I A;  1RQJ A;  3UCA A;  3DYG A;  3EGT A;  2ZCQ A;  5EAT A;  4NKE A;  2ZEV A;  2PS8 A;  2AEK A;  3WEH A;  1V4H A;  4NUA A;  1N1B A;  3KRF A;  5DIQ F;  3QKC A;  5I1U A;  3N46 F;  2J5C A;  4JZX A;  2F8Z F;  4JXN A;  3P8R A;  4LPH F;  3RYW A;  2J1P A;  5E8K A;  3ICM A;  4NG6 A;  3LSN A;  1HXA A;  2QIS A;  2EWG A;  3ICZ A;  4H5D F;  4RXE A;  5IN8 A;  1JFA A;  5JV0 F;  4P0X A;  5ER8 A;  5B01 A;  2Z7I A;  3ACX A;  3N0F A;  3WEK A;  1WL0 A;  5C05 A;  3PH7 A;  4NFI F;  3M01 A;  3BNX A;  3V1X A;  1YHM A;  4KQS A;  2OPM A;  3LOM A;  4KQU A;  2PS6 A;  3RBM A;  4DXJ A;  4LPG F;  1UBY A;  4WK5 A;  1UBV A;  1VG6 A;  3ZMB A;  5IL3 A;  5ERM A;  3SDR A;  3LGK A;  3Q2Q A;  3IPI A;  5AFX A;  4Q23 A;  1V4E A;  3ID0 A;  5ILI A;  5EAS A;  3N45 F;  3KRC B;  3WCD A;  5JV2 F;  2Q9Z A;  5ERN A;  3P8L A;  4RXC A;  1YYT A;  4K10 A;  5ILD A;  2F89 F;  4NKF A;  2ONG A;  1N21 A;  1WMW A;  3ZCD A;  1V4J A;  4XQT F;  2OA6 A;  2DH4 A;  4KFA A;  4XQR F;  3OAB B;  3Q30 A;  3WC9 A;  3OYR A;  4E9U A;  4JYX A;  3N3D A;  2VF6 A;  2ZCO A;  3WEJ A;  1YHK A;  4LLS A;  5DW7 A;  4RYP A;  3WJN A;  1HXG A;  4LA5 A;  3LLW A;  3P5P A;  2J1O A;  5ILY A;  4LTV A;  3RYE A;  3MAV A;  2Z50 A;  4LLT A;  5IMI A;  3AE0 A;  5DHI A;  3KB9 A;  4XQS F;  4FP4 A;  3TFP A;  1YV5 A;  1YHL A;  2OGD A;  3S9V A;  3PYB A;  3WCE A;  4DI5 A;  2Q58 A;  5HNA A;  4RXD A;  4E9Z A;  5HN8 A;  4HD1 A;  3VJE A;  4UMJ A;  1N20 A;  4EA1 A;  3SDV A;  3LG5 A;  4KPD A;  2PS5 A;  4DWB A;  5KSX F;  3P41 A;  4QPF A;  4LFV F;  3WEF A;  3G4F A;  5CG6 A;  4MC8 A;  1N23 A;  4PVY F;  5AYP A;  1KIZ A;  3ASX A;  1N24 A;  2E94 A;  3EFQ A;  4OKM A;  4QXS F;  4LFE A;  4GP1 A;  3Q2Z A;  2PS7 A;  2Z4Y A;  3M0G A;  3WE9 A;  5JV1 F;  3Q1O A;  3WCL A;  4KQ5 A;  3M02 A;  4N9U A;  2ZEU A;  4EA2 A;  2F94 F;  5DZ2 A;  2E8U A;  2Z7H A;  3AQB B;  3RMG A;  3OAC B;  5IKA A;  1YYQ A;  3WSB A;  3ACY A;  2FOR A;  1HM4 A;  3KRA A;  5CG5 A;  1YYR A;  3VJ9 A;  3N3L F;  1WL1 A;  4KK2 A;  2AZK A;  3G4D A;  2Z78 A;  5ERO A;  4EA0 A;  3WCM A;  1EZF A;  4OKZ A;  2RAH A;  3WCG A;  5AHU B;  4RXA A;  4KVD A;  5IVG A;  3WJO A;  4NFJ F;  3ICN A;  3SDT A;  2F7M F;  3AQC B;  1N1Z A;  5B0J A;  5ILZ A;  3N49 F;  1RTR A;  2E90 A;  3KRP B;  1HX9 A;  5ILK A;  1WL3 A;  5B03 A;  2Z4Z A;  3N5H F;  5DGM F;  5DJV F;  3BNY A;  4GAX A;  4ZQ8 A;  3LK5 A;  3ACW A;  4F6X A;  2E8W A;  3WJK A;  5IM1 A;  2Q80 A;  4P0W A;  1HXC A;  4FJQ A;  1VG2 A;  2ZY1 A;  3WCC A;  1VG7 A;  3WCB A;  1WL2 A;  5B0L A;  5A0K A;  2F8C F;  1DI1 A;  2E8T A;  4F6V A;  3LVS A;  3TS7 A;  5A0J A;  4L2X F;  5HN7 A;  3KRO B;  4RNQ A;  5IK0 A;  3M00 A;  4JVJ F;  1VG3 A;  1YYU A;  2ZCS A;  1KIY A;  5DJR F;  4P0V A;  5IK6 A;  3EZ3 A;  1WKZ A;  3KRC A;  4LOB A;  4GP2 A;  3IBA A;  3DYH A;  2AEL A;  4MC3 A;  4KVI A;  3LDW A;  4LTZ A;  3W7F A;  2AET A;  2F92 F;  2E8V A;  5IL8 A;  3V66 A;  3V1V A;  4KUX A;  2E91 A;  3TFN A;  3ZMC A;  3TC1 A;  1N22 A;  4H5C F;  3KRP A;  4PVX F;  3OAB A;  5JUZ F;  5DGN F;  3APZ A;  3N6K F;  3ICK A;  3KBK A;  1JFG A;  4LIX A;  1RQI A;  1WY0 A;  4F62 A;  3WCA A;  3VJD A;  1FPS A;  3N0G A;  4GA3 A;  3TFV A;  2H8O A;  1V4K A;  3WCI A;  1YYS A;  3AQ0 A;  4KVY A;  3ADZ A;  5E8L A;  5EAU A;  2ONH A;  3NRI A;  3WCJ A;  1UBX A;  5H9D A;  4DWG A;  4LZC A;  3S4J A;  5AEL A;  2Z52 A;  4LA6 A;  2Z4X A;  4MC0 A;  3QQV A;  1UBW A;  2O1O A;  3SDQ A;  3KRO A;  3LGZ B;  4KVW A;  3LZ9 A;  4NFK F;  5IMN A;  1PS1 A;  4KPJ A;  5A0I A;  3CKE A;  4E1E A;  5B0I A;  3NPK A;  4LFG A; 
#chains in the Genus database with same CATH topology
 5ILJ A;  2I19 A;  4OMG A;  5DHK A;  3ZOU A;  4OGU A;  1YJ4 A;  3PDE A;  5ILH A;  5DGS F;  3N5J F;  3WCF A;  3LJI A;  2PS4 A;  3WEI A;  1HM7 A;  3KRF B;  3PKO A;  2AZL A;  2P1C A;  2Z4W A;  3VJ8 A;  3PYA A;  3NPR A;  3WCH A;  4LZ0 A;  4DZW A;  2FTZ A;  3MZV A;  4H5E F;  4OMH A;  5HN9 A;  2E93 A;  5E8H A;  3ZL6 A;  2ZCR A;  3B7L A;  2E4O A;  3SAE A;  3WEG A;  4JXY A;  5IKH A;  2Z4V A;  4DEM F;  5B0K A;  5DJP F;  2F9K F;  4LXW A;  3OAC A;  3N1W F;  1YQ7 A;  1DGP A;  3VJB A;  5IMP A;  3LEE A;  3VJA A;  5B02 A;  1VG4 A;  3WSA A;  5JA0 F;  4LZ3 A;  3CC9 A;  2OPN A;  4JZB A;  4KWD A;  5B0M A;  2Q9Y A;  5B00 A;  3KRA B;  3DYF A;  5IK9 A;  3VJC A;  3M9U A;  3LMD A;  4KKM A;  4LUU A;  3N1V F;  1ZW5 A;  3CP6 A;  2AZJ A;  2E92 A;  2E95 A;  3NF2 A;  3P5R A;  2E8X A;  4N1Z F;  4DHD A;  3SDU A;  1V4I A;  1RQJ A;  3UCA A;  3DYG A;  3EGT A;  2ZCQ A;  5EAT A;  4NKE A;  2ZEV A;  2PS8 A;  2AEK A;  3WEH A;  1V4H A;  4NUA A;  1N1B A;  3KRF A;  5DIQ F;  3QKC A;  5I1U A;  3N46 F;  2J5C A;  4JZX A;  2F8Z F;  4JXN A;  3P8R A;  4LPH F;  3RYW A;  2J1P A;  5E8K A;  3ICM A;  4NG6 A;  3LSN A;  1HXA A;  2QIS A;  2EWG A;  3ICZ A;  4H5D F;  4RXE A;  5IN8 A;  1JFA A;  5JV0 F;  4P0X A;  5ER8 A;  5B01 A;  2Z7I A;  3ACX A;  3N0F A;  3WEK A;  1WL0 A;  5C05 A;  3PH7 A;  4NFI F;  3M01 A;  3BNX A;  3V1X A;  1YHM A;  4KQS A;  2OPM A;  3LOM A;  4KQU A;  2PS6 A;  3RBM A;  4DXJ A;  4LPG F;  1UBY A;  4WK5 A;  1UBV A;  1VG6 A;  3ZMB A;  5IL3 A;  5ERM A;  3SDR A;  3LGK A;  3Q2Q A;  3IPI A;  5AFX A;  4Q23 A;  1V4E A;  3ID0 A;  5ILI A;  5EAS A;  3N45 F;  3KRC B;  3WCD A;  5JV2 F;  2Q9Z A;  5ERN A;  3P8L A;  4RXC A;  1YYT A;  4K10 A;  5ILD A;  2F89 F;  4NKF A;  2ONG A;  1N21 A;  1WMW A;  3ZCD A;  1V4J A;  4XQT F;  2OA6 A;  2DH4 A;  4KFA A;  4XQR F;  3OAB B;  3Q30 A;  3WC9 A;  3OYR A;  4E9U A;  4JYX A;  3N3D A;  2VF6 A;  2ZCO A;  3WEJ A;  1YHK A;  4LLS A;  5DW7 A;  4RYP A;  3WJN A;  1HXG A;  4LA5 A;  3LLW A;  3P5P A;  2J1O A;  5ILY A;  4LTV A;  3RYE A;  3MAV A;  2Z50 A;  4LLT A;  5IMI A;  3AE0 A;  5DHI A;  3KB9 A;  4XQS F;  4FP4 A;  3TFP A;  1YV5 A;  1YHL A;  2OGD A;  3S9V A;  3PYB A;  3WCE A;  4DI5 A;  2Q58 A;  5HNA A;  4RXD A;  4E9Z A;  5HN8 A;  4HD1 A;  3VJE A;  4UMJ A;  1N20 A;  4EA1 A;  3SDV A;  3LG5 A;  4KPD A;  2PS5 A;  4DWB A;  5KSX F;  3P41 A;  4QPF A;  4LFV F;  3WEF A;  3G4F A;  5CG6 A;  4MC8 A;  1N23 A;  4PVY F;  5AYP A;  1KIZ A;  3ASX A;  1N24 A;  2E94 A;  3EFQ A;  4OKM A;  4QXS F;  4LFE A;  4GP1 A;  3Q2Z A;  2PS7 A;  2Z4Y A;  3M0G A;  3WE9 A;  5JV1 F;  3Q1O A;  3WCL A;  4KQ5 A;  3M02 A;  4N9U A;  2ZEU A;  4EA2 A;  2F94 F;  5DZ2 A;  2E8U A;  2Z7H A;  3AQB B;  3RMG A;  3OAC B;  5IKA A;  1YYQ A;  3WSB A;  3ACY A;  2FOR A;  1HM4 A;  3KRA A;  5CG5 A;  1YYR A;  3VJ9 A;  3N3L F;  1WL1 A;  4KK2 A;  2AZK A;  3G4D A;  2Z78 A;  5ERO A;  4EA0 A;  3WCM A;  1EZF A;  4OKZ A;  2RAH A;  3WCG A;  5AHU B;  4RXA A;  4KVD A;  5IVG A;  3WJO A;  4NFJ F;  3ICN A;  3SDT A;  2F7M F;  3AQC B;  1N1Z A;  5B0J A;  5ILZ A;  3N49 F;  1RTR A;  2E90 A;  3KRP B;  1HX9 A;  5ILK A;  1WL3 A;  5B03 A;  2Z4Z A;  3N5H F;  5DGM F;  5DJV F;  3BNY A;  4GAX A;  4ZQ8 A;  3LK5 A;  3ACW A;  4F6X A;  2E8W A;  3WJK A;  5IM1 A;  2Q80 A;  4P0W A;  1HXC A;  4FJQ A;  1VG2 A;  2ZY1 A;  3WCC A;  1VG7 A;  3WCB A;  1WL2 A;  5B0L A;  5A0K A;  2F8C F;  1DI1 A;  2E8T A;  4F6V A;  3LVS A;  3TS7 A;  5A0J A;  4L2X F;  5HN7 A;  3KRO B;  4RNQ A;  5IK0 A;  3M00 A;  4JVJ F;  1VG3 A;  1YYU A;  2ZCS A;  1KIY A;  5DJR F;  4P0V A;  5IK6 A;  3EZ3 A;  1WKZ A;  3KRC A;  4LOB A;  4GP2 A;  3IBA A;  3DYH A;  2AEL A;  4MC3 A;  4KVI A;  3LDW A;  4LTZ A;  3W7F A;  2AET A;  2F92 F;  2E8V A;  5IL8 A;  3V66 A;  3V1V A;  4KUX A;  2E91 A;  3TFN A;  3ZMC A;  3TC1 A;  1N22 A;  4H5C F;  3KRP A;  4PVX F;  3OAB A;  5JUZ F;  5DGN F;  3APZ A;  3N6K F;  3ICK A;  3KBK A;  1JFG A;  4LIX A;  1RQI A;  1WY0 A;  4F62 A;  3WCA A;  3VJD A;  1FPS A;  3N0G A;  4GA3 A;  3TFV A;  2H8O A;  1V4K A;  3WCI A;  1YYS A;  3AQ0 A;  4KVY A;  3ADZ A;  5E8L A;  5EAU A;  2ONH A;  3NRI A;  3WCJ A;  1UBX A;  5H9D A;  4DWG A;  4LZC A;  3S4J A;  5AEL A;  2Z52 A;  4LA6 A;  2Z4X A;  4MC0 A;  3QQV A;  1UBW A;  2O1O A;  3SDQ A;  3KRO A;  3LGZ B;  4KVW A;  3LZ9 A;  4NFK F;  5IMN A;  1PS1 A;  4KPJ A;  5A0I A;  3CKE A;  4E1E A;  5B0I A;  3NPK A;  4LFG A; 
#chains in the Genus database with same CATH homology
 5ILJ A;  2I19 A;  4OMG A;  5DHK A;  3ZOU A;  4OGU A;  1YJ4 A;  3PDE A;  5ILH A;  5DGS F;  3N5J F;  3WCF A;  3LJI A;  2PS4 A;  3WEI A;  1HM7 A;  3KRF B;  3PKO A;  2AZL A;  2P1C A;  2Z4W A;  3VJ8 A;  3PYA A;  3NPR A;  3WCH A;  4LZ0 A;  4DZW A;  2FTZ A;  3MZV A;  4H5E F;  4OMH A;  5HN9 A;  2E93 A;  5E8H A;  3ZL6 A;  2ZCR A;  3B7L A;  2E4O A;  3SAE A;  3WEG A;  4JXY A;  5IKH A;  2Z4V A;  4DEM F;  5B0K A;  5DJP F;  2F9K F;  4LXW A;  3OAC A;  3N1W F;  1YQ7 A;  1DGP A;  3VJB A;  5IMP A;  3LEE A;  3VJA A;  5B02 A;  1VG4 A;  3WSA A;  5JA0 F;  4LZ3 A;  3CC9 A;  2OPN A;  4JZB A;  4KWD A;  5B0M A;  2Q9Y A;  5B00 A;  3KRA B;  3DYF A;  5IK9 A;  3VJC A;  3M9U A;  3LMD A;  4KKM A;  4LUU A;  3N1V F;  1ZW5 A;  3CP6 A;  2AZJ A;  2E92 A;  2E95 A;  3NF2 A;  3P5R A;  2E8X A;  4N1Z F;  4DHD A;  3SDU A;  1V4I A;  1RQJ A;  3UCA A;  3DYG A;  3EGT A;  2ZCQ A;  5EAT A;  4NKE A;  2ZEV A;  2PS8 A;  2AEK A;  3WEH A;  1V4H A;  4NUA A;  1N1B A;  3KRF A;  5DIQ F;  3QKC A;  5I1U A;  3N46 F;  2J5C A;  4JZX A;  2F8Z F;  4JXN A;  3P8R A;  4LPH F;  3RYW A;  2J1P A;  5E8K A;  3ICM A;  4NG6 A;  3LSN A;  1HXA A;  2QIS A;  2EWG A;  3ICZ A;  4H5D F;  4RXE A;  5IN8 A;  1JFA A;  5JV0 F;  4P0X A;  5ER8 A;  5B01 A;  2Z7I A;  3ACX A;  3N0F A;  3WEK A;  1WL0 A;  5C05 A;  3PH7 A;  4NFI F;  3M01 A;  3BNX A;  3V1X A;  1YHM A;  4KQS A;  2OPM A;  3LOM A;  4KQU A;  2PS6 A;  3RBM A;  4DXJ A;  4LPG F;  1UBY A;  4WK5 A;  1UBV A;  1VG6 A;  3ZMB A;  5IL3 A;  5ERM A;  3SDR A;  3LGK A;  3Q2Q A;  3IPI A;  5AFX A;  4Q23 A;  1V4E A;  3ID0 A;  5ILI A;  5EAS A;  3N45 F;  3KRC B;  3WCD A;  5JV2 F;  2Q9Z A;  5ERN A;  3P8L A;  4RXC A;  1YYT A;  4K10 A;  5ILD A;  2F89 F;  4NKF A;  2ONG A;  1N21 A;  1WMW A;  3ZCD A;  1V4J A;  4XQT F;  2OA6 A;  2DH4 A;  4KFA A;  4XQR F;  3OAB B;  3Q30 A;  3WC9 A;  3OYR A;  4E9U A;  4JYX A;  3N3D A;  2VF6 A;  2ZCO A;  3WEJ A;  1YHK A;  4LLS A;  5DW7 A;  4RYP A;  3WJN A;  1HXG A;  4LA5 A;  3LLW A;  3P5P A;  2J1O A;  5ILY A;  4LTV A;  3RYE A;  3MAV A;  2Z50 A;  4LLT A;  5IMI A;  3AE0 A;  5DHI A;  3KB9 A;  4XQS F;  4FP4 A;  3TFP A;  1YV5 A;  1YHL A;  2OGD A;  3S9V A;  3PYB A;  3WCE A;  4DI5 A;  2Q58 A;  5HNA A;  4RXD A;  4E9Z A;  5HN8 A;  4HD1 A;  3VJE A;  4UMJ A;  1N20 A;  4EA1 A;  3SDV A;  3LG5 A;  4KPD A;  2PS5 A;  4DWB A;  5KSX F;  3P41 A;  4QPF A;  4LFV F;  3WEF A;  3G4F A;  5CG6 A;  4MC8 A;  1N23 A;  4PVY F;  5AYP A;  1KIZ A;  3ASX A;  1N24 A;  2E94 A;  3EFQ A;  4OKM A;  4QXS F;  4LFE A;  4GP1 A;  3Q2Z A;  2PS7 A;  2Z4Y A;  3M0G A;  3WE9 A;  5JV1 F;  3Q1O A;  3WCL A;  4KQ5 A;  3M02 A;  4N9U A;  2ZEU A;  4EA2 A;  2F94 F;  5DZ2 A;  2E8U A;  2Z7H A;  3AQB B;  3RMG A;  3OAC B;  5IKA A;  1YYQ A;  3WSB A;  3ACY A;  2FOR A;  1HM4 A;  3KRA A;  5CG5 A;  1YYR A;  3VJ9 A;  3N3L F;  1WL1 A;  4KK2 A;  2AZK A;  3G4D A;  2Z78 A;  5ERO A;  4EA0 A;  3WCM A;  1EZF A;  4OKZ A;  2RAH A;  3WCG A;  5AHU B;  4RXA A;  4KVD A;  5IVG A;  3WJO A;  4NFJ F;  3ICN A;  3SDT A;  2F7M F;  3AQC B;  1N1Z A;  5B0J A;  5ILZ A;  3N49 F;  1RTR A;  2E90 A;  3KRP B;  1HX9 A;  5ILK A;  1WL3 A;  5B03 A;  2Z4Z A;  3N5H F;  5DGM F;  5DJV F;  3BNY A;  4GAX A;  4ZQ8 A;  3LK5 A;  3ACW A;  4F6X A;  2E8W A;  3WJK A;  5IM1 A;  2Q80 A;  4P0W A;  1HXC A;  4FJQ A;  1VG2 A;  2ZY1 A;  3WCC A;  1VG7 A;  3WCB A;  1WL2 A;  5B0L A;  5A0K A;  2F8C F;  1DI1 A;  2E8T A;  4F6V A;  3LVS A;  3TS7 A;  5A0J A;  4L2X F;  5HN7 A;  3KRO B;  4RNQ A;  5IK0 A;  3M00 A;  4JVJ F;  1VG3 A;  1YYU A;  2ZCS A;  1KIY A;  5DJR F;  4P0V A;  5IK6 A;  3EZ3 A;  1WKZ A;  3KRC A;  4LOB A;  4GP2 A;  3IBA A;  3DYH A;  2AEL A;  4MC3 A;  4KVI A;  3LDW A;  4LTZ A;  3W7F A;  2AET A;  2F92 F;  2E8V A;  5IL8 A;  3V66 A;  3V1V A;  4KUX A;  2E91 A;  3TFN A;  3ZMC A;  3TC1 A;  1N22 A;  4H5C F;  3KRP A;  4PVX F;  3OAB A;  5JUZ F;  5DGN F;  3APZ A;  3N6K F;  3ICK A;  3KBK A;  1JFG A;  4LIX A;  1RQI A;  1WY0 A;  4F62 A;  3WCA A;  3VJD A;  1FPS A;  3N0G A;  4GA3 A;  3TFV A;  2H8O A;  1V4K A;  3WCI A;  1YYS A;  3AQ0 A;  4KVY A;  3ADZ A;  5E8L A;  5EAU A;  2ONH A;  3NRI A;  3WCJ A;  1UBX A;  5H9D A;  4DWG A;  4LZC A;  3S4J A;  5AEL A;  2Z52 A;  4LA6 A;  2Z4X A;  4MC0 A;  3QQV A;  1UBW A;  2O1O A;  3SDQ A;  3KRO A;  3LGZ B;  4KVW A;  3LZ9 A;  4NFK F;  5IMN A;  1PS1 A;  4KPJ A;  5A0I A;  3CKE A;  4E1E A;  5B0I A;  3NPK A;  4LFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...